WGS Statistics
Organism WGS Record. Vs Total IGHV IGLV IGKV TRAV TRBV TRGV TRDV
Balaenoptera bonaerensis BAUQ00000000.1 (BAUQ01) 51 1 9 3 18 15 2 3
Vgene Table
Organism Vgene Locus contig Contig Pos. AA sequence
Balaenoptera bonaerensis V19 trbv BAUQ01018008.1 17295 VRAQTIRQWPLITVQPAGSPLSLECTVKGASSPNLYWYRQAAGGTLQLLFYSVGIGQIDSEEPQNFEASRPQDDLFILSSKKLLLSDSGFYLCAWS
Balaenoptera bonaerensis V22 trbv BAUQ01023520.1 4502 LKDAVVTQFPRHRVSKTGKELTLQCSQNMSHNSMYWYRQDPGFGLRLIYYSTSTRITEKGDVPEGYRVSRDELEYFPLTLESASTNQTSVYLCASSE
Balaenoptera bonaerensis V28 trav BAUQ01032335.1 5411 VSGKNGVEQGPRYLSALEGDFVTINCSYSGEMTTLQWLQQNPGGGVVSLLILSLEMKKKGRVSATINRKERHSSLHITASHPRDSATYFCAVE
Balaenoptera bonaerensis V83 igkv BAUQ01116076.1 1048 SNGDIVLTQTPLSLSVIPGDPASISCRSSQSLVDSDGDTYLSWYLQKPGESPQLLIYEVSNRASGVPDRFTGSGSGTDFTLKISRVEAEDVGVYYCQQAMEDP
Balaenoptera bonaerensis V114 iglv BAUQ01161599.1 4093 SVASYELTQPPSVSVALGQTSKITCSGDLLDKKYTSWHQQKPGQAPVLVIYQDSKRPSGIPDRFSGSSSGNTATLTISGARAEDEADYYCGSADSSDY
Balaenoptera bonaerensis V143 trdv BAUQ01193176.1 6345 VMSAAVLVPQDQARSVSVGEPVTLRCSMKGESISNYYTFWYRKTPGNTMTFIYREGGTYGPGFEDNFRGKIDSLNNQAVLNILEASERDEGSYYCAS
Balaenoptera bonaerensis V159 trbv BAUQ01214402.1 6102 PGNAGVTQDPKFRVLRTGQSVTLKCAQDLDHHYMCWYRQDLGHGLRLIYYSSATGTANKGDVPDGYSVSRSNLEDFPLTLASATPSQTSVYLCASSY
Balaenoptera bonaerensis V160 trbv BAUQ01214402.1 10352 PVDAAVTQKPRYHIIRAGNKMVLECSQHMNHLGMFWYRQDPGQGPRLIHYSNGVGSTGEGDVTEGYSVSRNKNEHFPLTLESARTNQTSLYLCASSE
Balaenoptera bonaerensis V167 trbv BAUQ01223185.1 5750 LSITGPVEAGITQEPRYKITVTGETVTLECHQTDNHDYMYWYRQDLGHGLRLIHYSYGVGNIEKGEIPDGYNVSRSNTEDFPLTLESVIPSRTSVYFCASSD
Balaenoptera bonaerensis V185 iglv BAUQ01248853.1 4274 SWAQSALTQPPSVSGNPGQTVTITCAGTSSDIGKYNYVSWYQQRPGTAPKTLIYQVNKRPSGIPDRFSGSKSGNTASLTISGLQAEDEADYYCSSGTSS
Balaenoptera bonaerensis V202 trbv BAUQ01270980.1 3209 SMDADITQTPRNRIANTGKNTVLECSQTKGHESMYWYRQDPGLGLRLIYYSHGVDDVNKGDVSDGYNVSRKERAKFSLFLEPVTPNQTALYFCASSI
Balaenoptera bonaerensis V203 trbv BAUQ01273281.1 9343 ASADTGITQIPKYLVMETRSKKSLRCEQHLGHNSMYWYKQSAQKPLELMFVYNYKELASNETVPSRFWPKCPDSSHLYLHVDTLKLEDSALYLCASSK
Balaenoptera bonaerensis V214 trgv BAUQ01293765.1 22 HLEQPQLSSTKKLSKTARLECVVSGVTISKMSVYWYQERPGQAMQHLLHILSNNTVKRESDVTLGKFEADKIPETSTSTLTIHNVREQDAAIYYCALWE
Balaenoptera bonaerensis V277 trav BAUQ01450468.1 7804 TLSLAKTIQPIFIDSYEGQEVNISCNHTNIATEDYIFWYRQFPNQGPQFVIQGYKTNIANEVASLFIPTERKSSTLSLPCAALKDAAVYYCIVS
Balaenoptera bonaerensis V283 trav BAUQ01463688.1 508 MRSQQKGVEQSPASLHVPEGAVASLNCTYSDRASDYFSWYRQYPSKGPELLLDGYMNNDKEEGRYTAQVNKAKQYVSLLMRDSQPSDSATYLCAV
Balaenoptera bonaerensis V301 trav BAUQ01512346.1 1462 GTNGDSVTQTEGPVTVTEGAPRTLHCTYQTSDSAPYLFWYVQYLNKAPQFLLKGSKANQRAEHQGFQATLVTSDSSFHLQKPSVQTSDSAVYYCALS
Balaenoptera bonaerensis V324 igkv BAUQ01599542.1 3920 CWGQIALTQSPETLAASQGSFVSITCKSSMEVGTSMAWYQQKPKEAPRLLIFGASARASGTPSRFQGSGSGFDFSLAIHGVQAEDVGVYYCQ
Balaenoptera bonaerensis V369 trbv BAUQ01029990.1 1970 GSGLSALVSQHPSRAICKSGASVTIQCRSVDFQASTVFWYHQFPKQDLVLIATSNADSDATYEQGYTKAKYPVSHPNLTFSSLMVTNVHPADSSLYFCGAR
Balaenoptera bonaerensis V370 trbv BAUQ01029991.1 2041 TVDGGVTQTPKYLFNVEGRDVTLKCEQDFDYDVMYWYRQDPGQGLRLIYYSQTVKDVRKGDIAEGYSASREKKSLFALTLTSTQKNQTALYLCAANI
Balaenoptera bonaerensis V390 ighv BAUQ01053630.1 5315 VLSQVQLQQRGPGLVKPSQTLTLTCAVSGFSITTSSYYWSWIRQPPGKGLEWIGYIGYDGSTYYSPSLRSRISISRDTSKNQFSPQLSSVTTEDTAVYYCAR
Balaenoptera bonaerensis V391 trav BAUQ01053934.1 2810 VSGKNQVEQNPPSLMVLEGQNCTFQCNYTVSPFGNLRWYKQDTGRGLVSLIIMSHSDSKKLNGRYTVTLDASAKHSSLHITAAQLSDPAFYLCVVG
Balaenoptera bonaerensis V392 trav BAUQ01053935.1 16991 VSLGEKVEQSPSTLTVQEGNSSVITCTYTDTALDYFLWYKKEPGKGPQLLIDSHSNTSKKEPQRWSVLLNDKAKRLSLHISDTQPGDSAVYFCATS
Balaenoptera bonaerensis V393 trav BAUQ01053935.1 9313 PSIAQKVTQNQPVILVQEKEVVTLDCIYDTSDFSYSLFWYKQPSSGAMILLIRQDTYNQQNATEGRYSLNFQKANKSIKLAISASQLEDSAVYFCALSE
Balaenoptera bonaerensis V394 trav BAUQ01053935.1 1528 QTREDSVTQMDGQMTLPEGAALTINCTYSATGYPITFWYVQYPGEGPQVLLKAMKDNEKGTNKEFEATYHGESKSFHLEKASVQDSDSAVYYCALS
Balaenoptera bonaerensis V402 trbv BAUQ01061466.1 9293 PTDAGVTQTPRHEVTEVGHAVTLSCEPISDHTVLYWYRQTLVQGLEFLIYFLNQAPMDESGMPKDRFSAKMPNASFSTLKIQPTEPGDSATYLCASSK
Balaenoptera bonaerensis V403 trbv BAUQ01061466.1 5095 HMGAMVIQNPGYLVTRMGKPVTLSCSQNLNHEVMFWYQQKLSPAPSLLFYYYDKEFNNEKDTSDNLQSSWPNTSFCSLGIRSAGLGDSATYLCASSR
Balaenoptera bonaerensis V404 trbv BAUQ01061466.1 598 FLEAEVSQTPGHLVQGKGQKVKMYCVPRKGDVYVFWYRQILAKEFKFLISFQNNDVLDETEMPKERFSAECPPNSPCSLEIQPAELQDSAVYLCASSD
Balaenoptera bonaerensis V453 trgv BAUQ01119355.1 6065 TSGDIQIIQRITSITKKKGNTASLECQIKTDMLKKSVYIHWYRQKPEQPLNRILYISSNENVVHEQGISEERYEARKWPSNSLLSLRIHGATAEDAALYYCACWD
Balaenoptera bonaerensis V536 iglv BAUQ01237729.1 4483 SWAQSGLTQPPSVSGNPGQTVTITCAGTSSDIGKYNYVSWYQQRPGTAPKTLIYEVNKRPSGISDRFSGSKSGNTATLTISGLQAEDEANYYCSSAGSG
Balaenoptera bonaerensis V546 trav BAUQ01254264.1 1236 LRGEDQVDQSPQTLKIREGGSLTLNCSYTVSNFRGLQWYRQDPGTGPELLFLLHSVGDEKQKERLKATLLKKGSSLHIAAPEPEDSATYLCAVE
Balaenoptera bonaerensis V550 trbv BAUQ01259190.1 7304 PLEADVTQSPRHQITETRKRVTLTCSQNMNHDAMYWYRQDPGLGLKLIYFSSNLELVEKGDVPDGYIVSRKKKPDFPLTLASASTNQTSLYLCASSL
Balaenoptera bonaerensis V560 trav BAUQ01268615.1 1899 AHTQVVQVNDSMYGFIGTDVVLHCSFANPLPGVKITQVTWQKATNGSKQNVAIYNPAMGVSVLAPYRERVEFLRPSFTDGTIRLSRLELEDEGVYICEF
Balaenoptera bonaerensis V565 iglv BAUQ01275510.1 408 SWAQSALTQPPSVSGNLGQTVTISCAGTSSDIGKYNGVSWYQQLPGMAPKTLIYNVNKRPSGIPARFSGSKSGNTATLTISGLQAEDEADYYCSSGSSSST
Balaenoptera bonaerensis V570 iglv BAUQ01281717.1 339 SWAQSGLTQPPSVSGNLGQTVTISCAGTSSDIGKYNYVGWYQQHPGMAPKMLIYDVNKRPSGIPARFSGSKSGNTATLTISGLQAEDEADYYCSSYTSS
Balaenoptera bonaerensis V573 trav BAUQ01285502.1 7316 ASSDDKVIQSPPSLVVREGTRATLNCSYKVTNFQSLHWYKQEEKAFTFLFILISAGIEKRSGRLRGTLDRKELLSTLHITATKPGDSATYLCAVE
Balaenoptera bonaerensis V574 trav BAUQ01285502.1 2565 PGKADWIRPQETEVSGTEGKTVSLLCNYYTSSTSFVDLYWYRQYPNQAPEYILYRGWGYSGKGYASFATERFYSENTANTTNLYIKRVLRADTALYHCALR
Balaenoptera bonaerensis V593 trdv BAUQ01322333.1 13789 KDVLCNQVTQISQEQTVASGSEVTLQCIFQTAFSDPDLYWYQIRPDRSFQFVLYRDSTTSYDADFARGRFSVQYSLTHKTFHLVISSVRTEDSATYYCALS
Balaenoptera bonaerensis V630 trav BAUQ01387693.1 1730 GMSGQQLNQSPRFMSIQEGEDVSMNCNSSSTLNLLLWYKQDAGGGPILLITLYKGGELTRNGKLTAQFSGTRKDSFLNISASEPKDAGTYFCAG
Balaenoptera bonaerensis V644 trav BAUQ01416315.1 2594 VNSQQGEENLQALSIQEGENATMNCSYKTTIDILHWYRQDSRRGFAHLILIRSNEREKGSGRLRVTLDSSIKSSSLSITASQAADTATYLCATE
Balaenoptera bonaerensis V645 trav BAUQ01416316.1 499 GTRAQTVTQPEDHISVFEGFPVQVKCNYSYSGSPELFWYVQYPKQHLQLLLKHTSRESIRGFTADLNKGEASFHLKKPSAQEEDSAVYYCALR
Balaenoptera bonaerensis V649 trbv BAUQ01425318.1 485 PMDAEIYQMRFVLAEAGRDVTLECKQDLSYNAMYWYRQDAGQGLRLIYYSTVEKDVQRGDISEGYSVSREEKGLFPLTVKAAHTNQTALYLCAGS
Balaenoptera bonaerensis V672 iglv BAUQ01495056.1 1085 SWAQSGLTQPPSVSGNPGQTVTISCAGTSSDIGKYNAVSWFQQLPGMAPKTLIYDVNKRPSGIPARFSGSKSGNTASLTISGLQAEDEADYYCSSARSGST
Balaenoptera bonaerensis V674 trav BAUQ01497052.1 3626 SSVAQMVTQPQPEVSVQEADTVTLDCTYSTSESGYYLLWYKQPPSGEMIFIILQEPYKQQNATNSRYSVNFQREAKSFSLRISDSQLEDAAMYFCAYRG
Balaenoptera bonaerensis V677 trbv BAUQ01499683.1 1096 CMDTEVTQSPGHLVKGKEQKAKMHCVPRKGHTRVYWYRKKLEEGFEFLVYLQNKNIVDDTDVFKQRFSAHCPRSSPCSLEVKSTEAGDSALYFCASSQ
Balaenoptera bonaerensis V678 trav BAUQ01503252.1 3345 GTGAQSVTQPDGRITVSEGARLELRCKYSSSVQPTLFWYVQYPDQGLQLLLEYTSRNSLVSGIKGFEAEFRKSETSFHLRKTSAHWKDSAKYFCALS
Balaenoptera bonaerensis V679 trdv BAUQ01503253.1 5853 FGAAQKVTQAQTAISSQLGETVTLNCRYETSWRRYYIFWYKQLPSGEMTFLIDQSSSGQNAKKGRYSINFQERHKFISLTISALLMEDSANYFCALWE
Balaenoptera bonaerensis V686 trav BAUQ01529742.1 440 GTGAQSVTQPDGRITVSEGARLELRCNYSSSLSTYLFWYVQYPNQGLQLLLKYTSGNSLVSGIKGFEAEFRRSDTSFHLRKPSAHWSDSAEYFCALS
Balaenoptera bonaerensis V689 igkv BAUQ01540943.1 1578 SSGDIVMTQTPLSLSVVPGETASISCKSSQSLVHSDGNTYLNWFQHKPGQSPQRLFYQVSKRDSDVSDRFSGSGSGTDFTLKISRVEAEDAGVYYCCQG
Balaenoptera bonaerensis V699 iglv BAUQ01586665.1 9311 VVLTQPRSVLGSLEQKVTISCTRSSGNFGSYYVHWYQQRPGSALTTVIYKDDQRPSGVPNRFSGSIDTSSSAAYLTISGLQPEEEANYYCQSGYDSNK
Balaenoptera bonaerensis V700 iglv BAUQ01588582.1 2489 SWAQSGLMQEGSVSGSVGQEVTLSCTGNGNNVGANTVNWYQQISHGAPKTAMLTGSLPSGIPDRFSGSTSVNTASLTISGLQPEDKADYYCSTWDDSISG
Balaenoptera bonaerensis V703 iglv BAUQ01592761.1 578 SLSQPVPTQPPLLSTSPGASARFTCTLSSGCSVGSYHIFWYQQKPGSSPWYLLRFRSDSDKHQGSGVPSRFSGSKDALANAGLLLIAGLQPEDEADYYCAT