WGS Statistics
Organism WGS Record. Vs Total IGHV IGLV IGKV TRAV TRBV TRGV TRDV
Capra aegagrus JXYW00000000.1 (JXYW01) 171 2 20 6 69 46 6 22
Capra aegagrus CBYH000000000.1 (CBYH01) 159 2 20 7 61 41 7 21
Vgene Table
Organism Vgene Locus contig Contig Pos. AA sequence
Capra aegagrus V0 trgv JXYW01043539.1 33219 GLGLSKVEQAQISLSTEVKKSIDIHCKIESTNFESETVYWYRQKRNQALEHLVYVISTTAAARNQVDGKNKIEARKDARMFTSTLTVNFVEKDDVGIYYCAGWS
Capra aegagrus V1 trgv JXYW01043539.1 44568 GLGQLTLEQPELSVTGTREKSIIMTCKVFSKDFSKDYIHWYRQKPDQGLEQLLYVSTAPAQNHLGGKKNKLEARKDAPSSTSTLKISFLEKEDEATYYCAGWL
Capra aegagrus V2 trgv JXYW01043540.1 4387 GDIKMKISQHQLSSTRRPDRTVHISCKLSGVPLENAIVHWYQEKEGEPLKRILYGSANSYKLDKPNSRLEMDNKKNGIFYLVINNVVKSDEATYYCACWD
Capra aegagrus V3 trgv JXYW01043542.1 4440 TQVSSNMEEDKLSVTRATGSSVVIDCDLTQNYIHWYKFQEGTVPRRLLYYDVYYSKVVLESGISEGKYHVYKGTGKSYTFVISNLQESDSGTYYCAVWE
Capra aegagrus V4 trgv JXYW01043543.1 8152 MQVSSNMEGEKMSITKAAVPGAFVEIICDLITQTVKYIHWYKYQEGTAPRRLLYYDISYSKIVLESGISEGKYKVYKEKSYTFAISNLQESDSGMYYCAVWE
Capra aegagrus V5 trbv JXYW01045593.1 6167 TWGTGVFQTPKYLLTQMGTKTSLECEQKLNHDNMYWYKQDSKKLLKAMFHYNNKELIENETVPSRFSPESPDKAHLNLHIDSLEPGDSAVYFCASS
Capra aegagrus V6 trbv JXYW01045593.1 10496 VSADPGITQIPKYLVMGTTDKKSLKCEQHLGHNAMYWYKQSAQKLPELMFIHNYRKLNGNESVPSRFWPECPDSSQCRLDLSAPKPQDSAVYLCASSR
Capra aegagrus V7 trbv JXYW01045594.1 15420 LVDSEVTQTPKYLIKSRKEQATLGCSPESGHRSVNWYQQALGQGPRFLVQYYRGQVSGEENMPDRFSAKQFSDFRSELNLSSLELTDSAVYLCASSQ
Capra aegagrus V8 trbv JXYW01045594.1 20274 AVHAGVTQDPRFQVVRTGQRVTLRCTQDLNYDYMYWYRQDPGHGLRLIHYSDGPPATEKGDVPDGYNVSRPSTEDFPLTLESASRSQTSVYFCASSY
Capra aegagrus V9 trbv JXYW01045594.1 24506 LVDSEVTQTPKYLIKSRKQQATLRCSPESGHFSVYWYQQVLGQGPQFLVQYYNQKVSGEAHLPDRFSGKQFSDSRSELNLSSLELMDSAMYLCASSQ
Capra aegagrus V10 trbv JXYW01045594.1 28957 LVDSEVTQTPKYLIKSRKQQATLRCSPESGHFSVYWYQQVLGQGPQFLVQYYNQKVSGEAHLPDRFSGKQFSDSRSELNLSSLELMDSAMYLCASSQ
Capra aegagrus V11 trbv JXYW01045598.1 528 LVDSEVTQTPKYLIKSRQQQVTLSCSPESAHHSVYWYQQALGQGPQFLVQYYNREMIQKGKISDRFSGKQFSDFHSELNLTSLELTDSAVYLCANSQ
Capra aegagrus V12 trbv JXYW01045598.1 3572 LVDSEVTQTPKFLTKSRKQQVTLRCSPESGHRSVYWFQQALGQGPQFLVQYFDGKVYQRGNMSDRFSGQQSGSELNLTSLELMDSALYLCASSQ
Capra aegagrus V13 trbv JXYW01045598.1 5313 AVHAGVTQDPRFQVVRTGQSTTLKCTQDLGHDRMYWYQQDLAHGLRLIHYSAGMHTSKPGSVPDGYSASRSNSENISLTLESANHSQTSAYFCASSY
Capra aegagrus V14 trbv JXYW01045603.1 7133 AVHAGVTQDPRFQVVRTGQNVTLYCTQDLGHDRMFWYRQDLGHGLRLIHYSVIPPATEKGAVPEGYSVSRPSTEDFPLTLESANASQTSVYFCSCGY
Capra aegagrus V15 trbv JXYW01045606.1 13185 LVESEVTQTPKYLIKSRKEQVTLRCSPKSGHRSVYWYQQALGQGPQFLVQYYSQQVSGEAQLPDRFSGKQFSDFHSELNLTSLELTDSAVYLCASSQ
Capra aegagrus V16 trbv JXYW01045606.1 18567 VVHAGVTQDPRFQVVRTGQRATLKCTQDLNHDSMYWYRQDLGHGLRLIHYSAAAPNTKRVPEGYSVSRPSTEDFPLTLESANRSQTSVYFCASSY
Capra aegagrus V17 trbv JXYW01045607.1 1560 LVDSGVTQTPRYLIKARGQRGTLRCSPVSGHLSVYWYQQALGQGPQFLVQYYSQNVYGEAQLPDRFSGEQFSDSSSELNLTSLELTDSAVYLCASSQ
Capra aegagrus V18 trbv JXYW01045612.1 1581 LVDSEVTQTPKYLIKSRKEQVTLRCSPKSGHRSVYWYQQALGQGPQFLVQYYDGEIYQKENISDRFSGKQFSDARSELSLTPLELTDSAVYLCASSQ
Capra aegagrus V19 trbv JXYW01045613.1 973 AVHAGVSQDPRLQVVRTGQRETVTCTQDLGHNSVCWYRLDPGHGLRLIHYSAAYPSTEKGDVPEGYSVSRPSTEDFPLTLRSANRSQTSVYFCASSY
Capra aegagrus V20 trbv JXYW01045614.1 1579 LVDSGVTQTPRYLIKARGQRGTLRCSPVSGHLSVYWYQQVLGQGPQFLVEYYNQDVRGETNLPDRFSGEQFSDSSSELNLTSLELTDSAVYLCASSQ
Capra aegagrus V21 trbv JXYW01045615.1 2104 AVHSGVTQAPRFQVVRTGQSMTLKCTQDLGHNSMYWYRQDPGHGLRLIHYSRGPPTTEKGDMPDGYSVFRSSKENFPLMLESANPSQTSVYFCASSY
Capra aegagrus V22 trbv JXYW01045620.1 213 LVDSGVTQTPRYLIKARGQQGTLRCSPVSGHLYVYWYQQALGQGPQFLVQYYSQDVYGEAQLPDRFSGKQFSDSSSELNLTSLELTDSAVYLCASSK
Capra aegagrus V24 trbv JXYW01045624.1 8324 VVHAGVTQDPRFQVVRTGQNTTLYCTQDLGHDRMFWYRQDLGHGLRLIHYSAAAPTTEKGDVPEGYSVSRISTEDFPLTLKSASRSQTSVYFCASSY
Capra aegagrus V25 trbv JXYW01045624.1 10520 LVDSGVTQTPRYLIKARGQRGTLRCSPVSGHLSVYWYKLVLGQGPQFLVQYYSQDVWGETNLPDRFSGEQFSDSSSELNLTSLELMDSAVYLCASSQ
Capra aegagrus V26 trbv JXYW01045627.1 784 AVHAGVSQDPRFQVVRTGQNATLKCTQDLGHDGMYWYQDLGHGLRLIHYSAGPPSTEKGDVPDGYRVSRSSKENFPLMLESASRSQTSVYFCASSY
Capra aegagrus V27 trbv JXYW01045627.1 3130 LVDSGVTQIPKYLIKSRKQQVTLRCSPESGHRYVSWYQQALGKSPQFLVQYYDGKVRTKGNMPDRFSGEQFSDSRSQMNLSALELTDSAMYLCASRQ
Capra aegagrus V28 trbv JXYW01045627.1 6049 VVHAGVTQDPRFQVVRTGQRATLKCTQDLNHDSMYWYRQDPGHGLRLIHYSSFTDATYKGDVPDGYNVSRSSTENFPLTLESANPSQTSVYFCASST
Capra aegagrus V29 trbv JXYW01045627.1 8897 HTGAGVVSQSPRHRVTGRGQNVTLRCDPISGHISLYWYRQTLGQGPEFLTYFQNEQELDKSGMPKNRFSAKRPQSTYSYLNIQPAEPGDSAVYLCASSP
Capra aegagrus V30 trbv JXYW01045628.1 4898 PLEAEVTQTPRHLIKTKGQTATLRCSPMSGHSSVSWYQQARSQGPQFLFEFYETLQRDKGNFSNRFSAKQFRDFSSELNVNFLELTDSALYLCASSL
Capra aegagrus V31 trbv JXYW01045628.1 9862 HTRAGVVSQSPGYRVTGRGQNVTLRCDPIPGHQVLYWYRQMLGQGPEYLTYFQGKEEPDKSGMPKNRFSAERPESTYSYLKIQPVEPKDSAVYLCASSP
Capra aegagrus V32 trbv JXYW01045628.1 32199 TTDANLGVTQTPRHEVTEKGQAVTLSCEPIKSHTALYWYRQTSVRGLELLIYFRSEAPVDESGMPKDRFSAKMPNASFSTLKIQPTDPGDSATYLCASSK
Capra aegagrus V33 trbv JXYW01045631.1 10936 PTDAGVTQTPRHEVTEKGQAVTLSCEPIKSHAALFWYRQTSVRGLELLIYFNNQSPVDESGMPKDRFSAKMPNASFSTLKIQPTEPGDSATYLCASSK
Capra aegagrus V34 trbv JXYW01045631.1 15745 HVGAMVIQNPRYLVTGLGKPVTLSCSQDMKHDVMYWYQQKPSQAPKLLLYYYDKEITREKNTSENFQSSRPNTSFCSLDIRSAGLGDSAVYLCASSR
Capra aegagrus V35 trbv JXYW01045631.1 20793 FLEAEVTQTPGHLVQGKGLEVEMYCVPKKGHIYVFWYQQILAKEFKFLISFQNDKVLDDKEMPKKRFSAKCPSNSPCSLKIQPAEPQDSAMYFCASSD
Capra aegagrus V36 trbv JXYW01045632.1 10938 TVAGEVTQTPKYLLKKEGGAVTLECEQDFDYDSMYWYRQDPGLGLRRIFFSQVVKDVQEEDIAKGYSASREKKPFFPLTVTSAQKNQTALYLCAASR
Capra aegagrus V37 trbv JXYW01045633.1 1047 GSGLGAVVSQQPRRAVSKSGASVTIECRAVDFQATTVFWYRQFPKRGLVLMATSNAGTDATYEQGYNKDKLPISQPNLTFSSLMVTNVDPADSSLYFCGAR
Capra aegagrus V38 trbv JXYW01045633.1 7813 SMDTEVTQSPSHLVKGKDQKAKMDCVPIKGHSYVYWYRKKPEGAFEFLVYLQNQDVVEDTAMFKQQFSADCPPNSPCSLEIKSTKAADSALYFCASSQ
Capra aegagrus V39 trbv JXYW01045633.1 13067 SMDTEVTQNPSHLVKGKDQRAKMDCVPIKGHSNVYWYRKKLEAFEFLVYLWNGKITEDTAMFKQRFSAECPQNSPCSLEIKSTEAPDSALYFCASS
Capra aegagrus V40 trbv JXYW01045634.1 1797 SMDTEVTQSPSHLVKGKDQRAKMDCVPKKGHSYVYWYRRKLEEAFEFLVYLQDEKIIEDTDMFKQRFSAECPQTSPCSLGIKSTKASDSALYFCASSQ
Capra aegagrus V41 trbv JXYW01045635.1 2723 SMDTEVIQSPGHLVKGKDQKAKMDCVPIKGHVHVYWYRKKPEGAFEFLVYLQNQDIVEDTEVFQQQFLAQWPQNSPCSLEIKSTKAADSALYFCASSQ
Capra aegagrus V42 trbv JXYW01045635.1 6636 SMDTEVTQSPSHLVKGKGQKAKMDCVPIKGHINVYWYRRKLEEALEFLVYLQKQDIVEDTEVFKEQFSAQCPQNSPCSLEIKSTKAADSALYFCASSQ
Capra aegagrus V43 trbv JXYW01045636.1 3146 SMDTEVTQRPSHLIKGKDQKAKMDCVPKEGHPYVYWYRKKLEGAFEFLVYFQNQDTMEDTVEFKQRFSAECPQNSPCSLEIKSTEAADSALYFCASSQ
Capra aegagrus V44 trbv JXYW01045636.1 7584 PKDAEIYQIGFLLAEAGQDVTLECKRNLGYSAMYWYQQDPGQGLKLTYYSTLETDIQRGDLSEGYSVSREKKELFPLTVKSAHTKQTAVYLCSG
Capra aegagrus V45 trbv JXYW01045636.1 13143 SMDTGVTQTPRNRIAVTGKSTVLECSQTKGHESMYWYRQDPGRGLRLVYSSYDINGINKGDVSAGYNVSRKEKAKFSLYLEPATPNQKAIYFCASSI
Capra aegagrus V46 trbv JXYW01045636.1 19530 FTDADVYQTPRHCVTGTGRKITLECSQTMGHDNMYWYQQDPGMELQLIHYSYGVNTTEKGERSSRSTVSRISKEHFPLTLETASSSQTSSYFCASSD
Capra aegagrus V47 trbv JXYW01045636.1 21461 LEDAAVIQFPRHRILKAEKEFTLQCSQKMNHYAMYWYRQDPGFGLQLIYYSTGPDTFKKGDVPEGYHVSRDELDHFPLTLKSASPNQTSVYFCA
Capra aegagrus V48 trbv JXYW01045639.1 2613 PLEADVTQSPRHRITETRKRVTLTCSQNMNHDVLYWYRQDPGLGPKLVYFSRNVGFVEKGDISDGYTASREEKPNFPLILELTSTNQTSLYLCASSE
Capra aegagrus V49 trbv JXYW01045639.1 8709 LMDAQVTQTPRYLVKRRGEKVVIECMQNMDHERMFWYRQDPALGLRLLHFSIDVDVLEEGDVPYGYSVSRTKKKSFPLTLESATTNQTAMYLCASSE
Capra aegagrus V50 trbv JXYW01045640.1 4112 SVFGALLSQKPSRAIRQRGTSMTIDCQVDSQLTLMYWYRQLPGQSLVLMATANQGSKATYESGFTEDKFPISRPNLAFSTLTVSNASSEDSSSYFCSAG
Capra aegagrus V51 trdv JXYW01102352.1 2612 KGVLCNQVTQSSPEQRVASGREVTLQCTFQTTYSNPDLYWYRKTPDAVFQFVLYRDNTRSHDADFARGRFTVQHSVRSKTFHLVISSVRPEDTATYYCALEL
Capra aegagrus V52 trav JXYW01102442.1 1326 SIMAQKVTQNQSEISVLEKEDVTLNCAYEANSYTYYLFWYKQPPSREMIFLIHQESYNELNTTKGQYFLNFQKATSSISLTITDLQLEDSAVYFCALR
Capra aegagrus V53 trav JXYW01102450.1 1859 VSSKQDVSQSPEALSVREGDSLVLNCSHTDSALYFLQWFRQDPGKGLTSLLSIQANQKEQASGRVTVSLDKSSRHSALYIATSQHSDSTTYLCAV
Capra aegagrus V54 igkv JXYW01113007.1 25017 SNGAIVLTQTPRSLSVIPGETASISCRASQNVQNRYGDNFLHWYVQKPSQSPQLLIYAASNRASGVSDRFTGSGSGTDFTLKISRVEAEDAGVYYCQQSKETP
Capra aegagrus V55 igkv JXYW01113009.1 4254 SIGDIVLTQTPLSLSVIPGGTASISCKSSQSLKYSDGNTYLYWFQHKPGQSPRRLIYLVSNRDTGVPDRFTGSGAETDFTLTISSVQAEDAGVYYCFQAINYP
Capra aegagrus V56 igkv JXYW01113016.1 11909 SIGAMMQTQTLRSLSVIHGEKASISCRASQSIQNRYGYNFLHWYVQKPSQSPQLLIYRASNWESGVPDRFTSSGLGADTILIVSRVEAEDARVYYCQQSLQ
Capra aegagrus V57 igkv JXYW01113016.1 21139 SSGDVVLTQTPLSLSVIPGETASISCKSSQSLVHSDGKTYLNWIKHKPGQSPEGLIYQVSNRYSGVSDRLTGSGSGTDFTFTISRVQAEDAGVYYCYQGTEAP
Capra aegagrus V58 igkv JXYW01113019.1 7125 ARCDIQVTQSPSSLSASLTERVSITCRTSQSVSNYLNWYQQKPGQAPKLLIYYATRLHTDVPSRFSGSGSGTDYTLTISSLEADDAATYYCLQGYS
Capra aegagrus V59 igkv JXYW01113020.1 13279 ASGEAVLYQTPAYIAVPLGESISITCRANQSISDYLSWHKQKPGQAPMILIYDADNRRNGVPERFTATQSGTDFVFTISQIEADDAAMYYCQQSYVFP
Capra aegagrus V60 trav JXYW01123509.1 57 GTNGDSVTQTEHVVTLPETASLTLKCTYQSSYSVSLFWYVQYQNKELELLLKSSLGNQKVTSRGFEATHISSDSSFHLQKSSVKTSDSAVYYCALS
Capra aegagrus V61 trav JXYW01149644.1 240 VRGVDVEQSPPALSLQEGASYTLQCNFSTSPQSVNWYLQNSGGHLIQLFYIPSGTKQDGRLKATTAPAERRSSLHISSSQTTDSATYFCAARHSAPQ
Capra aegagrus V62 iglv JXYW01164527.1 1171 SRAQAVLTQPSSVSRSLGQRVTITCSGSSSNTGGNFVGWCQQLPGMAPKTLIYGDSNRPSGVPGWFSGSKSGNSASMTIASLQAKEEAGYYCLSWDDSLNC
Capra aegagrus V63 iglv JXYW01164530.1 147 SWAQAVLTQPSSVSWSPGQRVFITCSGSSSNVGTGNYVGWYQQVPGSAPKLLIYGATSRASGVPDRFSGSRSGNTATLTISSLQAEDEADYYCSSYQSGYSY
Capra aegagrus V64 iglv JXYW01164553.1 1779 SWAQAVLTQPSSVSGSPGQRVSITCSGSNIGSSGVGWYQQLPGSGLKTVIYYNSNRPSGVPDRFSGSKSGNTATLTISSLQAEDEADYYCASYQSGYSY
Capra aegagrus V65 iglv JXYW01164556.1 334 SWAQAVLIQPPSVSGSPGQRVSITCSGSSSNIGRYGVGWYQQLPGSAPKLLIYCTTSGASGSSDGFSGSRSGNTATLTISSLQAEDEADYYCATYESSSYN
Capra aegagrus V66 iglv JXYW01164566.1 336 SWAHAVLTQPPSVSGSLGQSVTISCSGSSNIGILGVSWYQQLQGSAPKTLIYGSNKRPSGVPDRFSGTKSGNTGTLTITSLQAEDEADYYCASADLILNS
Capra aegagrus V67 iglv JXYW01164566.1 3118 SLSQPLLTQPASLSASPGASARLTCTLSSGYNVGNYSIYWYQQKAGSPPRYLLRFKSDSDKHQGSGVPNRFSGSKDASTNAGLLLISEVQPEDEADYYCAVWHG
Capra aegagrus V68 iglv JXYW01164568.1 335 SWAQAVLIQPPSVSGSPGQRVSITCSGSSSNIGRYGVGWYQQLPGSAPKLLIYCTTSGASGSSDGFSCSMSGNTATLTISSLQAEDEADYYCATYDSSSYN
Capra aegagrus V69 iglv JXYW01164574.1 267 SWAQAVLTQPSSVSRSLGQRVSITCSGSSSNVGYGNYVGWYQQVPGSGLRTLIYGATSRASGVPDRFSSSKSGNTATLTISSLQAEDEADYFCSSYDSSGYN
Capra aegagrus V70 iglv JXYW01164580.1 506 SWAQAVLTQPPSVSGSPGQSVSITCTGSSSNIGRYGVAWYQQLPGSAPKLLIYCTTSGALGSSDRFSCSMSGNTATLTISSLQAEDEADYYCATYDSSSYN
Capra aegagrus V71 iglv JXYW01164584.1 3891 SRAQAVLTQPSSVSRSLGQRVTITCSGSSSNNGGNFVGWCQQLPGTAPKTPIYGDSNRPSGGPEWFSGSKSGNSASMTIASLQAEEEAGYYCLSWDDSLNG
Capra aegagrus V72 iglv JXYW01164884.1 420 SWAQAVLTQPPSVSRSLGQTVTISCSGSSSNIGILGVSWYQQLPGSAPRTLIYDSNKRPSGVPDRFSGTKSGNTGTLTITSLQAEDEADYYCASADLILNS
Capra aegagrus V73 iglv JXYW01164905.1 3058 SWAQSALTQPASNPGQTVTISCTGTSSDIGGYNYVGWYQQLPGSAPKTLIYNVNKRPSGIPARFSGSKSGNTATLTISGLQAEDEADYYCSSARS
Capra aegagrus V74 iglv JXYW01164905.1 6555 SWAQSALTQPASVSGNPGQTVTISCTGTSSDIGGYNYVGWYQQLPGSAPKSLIYEVSKRPSVIPARFSGSKSGNTATLTISGLQAEDEADYYCSSARSG
Capra aegagrus V75 iglv JXYW01164905.1 14286 SWAQSALTQPASVSGNLGQMVTISCTGTSSDIGGYNYIGWYQQLPGSAPKTLIYNVNKRPSGIPARFSGSKSGNTATLTISGLQAEDEADYYCSSYKSGGT
Capra aegagrus V76 iglv JXYW01164906.1 77 SWAQSALTQPASVSGNPGQTVTISCTGTSSDIGGYNYIGWYQQLPGSAPKTLIYNVNKRPSGIPARFSGSKPGNTATLTISGLQAEDEADYYCSSARSG
Capra aegagrus V77 iglv JXYW01164913.1 2039 SWAQSALTQPASVSGNPGQTVTISCTGTSSDIGSYNGVGWYQQLPGSAPKTLIYNVNKRPSGIPARFSGSKSGNTATLTISGLQAEDEADYYCSSYKSGGT
Capra aegagrus V78 iglv JXYW01164919.1 2092 SVVSYELTQPTSVSVALGQTAKVTCSGDLLDENFAHWYQQKPGQAPVLVIYLNSERASGIPDRFSGSSSGSTATLTISGVQAEDEADYFCQSYDSSNN
Capra aegagrus V79 iglv JXYW01164924.1 96 SVVSYELTQPTSVSVALGQTAKITCQGDLLDEKYTAWYQQKPGQAPVKVICKDSERPSGILDRFSGSSSGKTATLTISGARTEDEADYYCQSADSSNN
Capra aegagrus V80 iglv JXYW01164926.1 4383 SVVSYELTQPTSVSVVLGQTAKVTCSGDLLDEQYTQWHQQKPGQAPELVIYEDSKRRSGIPDRFSGSSSSKTAILTISGVRAEDEADYYCVSWDSGNYN
Capra aegagrus V81 trav JXYW01166721.1 1559 GVRGVKVEQSPSVLSLQEGANSTLWCRSSDTVKSVQWFQQNPKGSLITLFFIASGTKQNERLSSTVNSKERYSTLHITASQLEDTATYLCAVE
Capra aegagrus V82 trav JXYW01166721.1 5029 VILGNKVEQSPSTLSVQEGNSSVITCTCTDTASAYFPWYKQEPGKCPQLLVAIHSNMGEKNDQRVTVLLNKTANHLSLHIATIQPGDSAVYFCAAR
Capra aegagrus V83 trav JXYW01166722.1 9468 VSSQQNTVEQSPASLPVPEGAVASLGCTYSDSASQYFTWYRQYPGKGPEFLLLVYPDKDKEEGKFTAQSNKSNKHVSLHIRDSEPSDSATYLCAV
Capra aegagrus V84 trav JXYW01166725.1 3160 GTRAQTVTQPESHIPVSEGDPVQVKCSYSYSGSPVLFWYVQYPRQRLQLLLKDTSRESIQGFTAELSRAEASFHLKKPSAREEDSAVYYCALG
Capra aegagrus V85 trav JXYW01166725.1 7755 VNSQQGEQNLQTLSIQEGESVTMNCSYKSITITALQWYRQDSRRGFVHLILMRSNERQKHSGRLLFTLDSSIQSSSVSIAASQAEDAATYLCAP
Capra aegagrus V86 trav JXYW01258435.1 7294 GARAQTVTQPESHISVSKGDPVQVKCSYSYSGSPVLFWYVQYPRQHLQLLLKHTSRENIQGFTAELSRAEASFHLKKPSAQEGDSAVYYCALG
Capra aegagrus V87 trav JXYW01262766.1 376 VSGKNQVEQSPPSLAVLEGENCTFQCNYTVSPFNNLRWYTQDTGRGLISLITMTYSDNKKSNGRYTATMDATAKHSSLHLTAAQLSDPAFYICVVG
Capra aegagrus V88 trdv JXYW01270892.1 814 SGVAQSVTQDQPDILSEVGKTVTLNCRYETSWDMFYYYIFWYKQLPSGQMTYLIRQYSDDGNARDGRYSVNFQKAHKSISLTISALELEDSAKYFCLLLD
Capra aegagrus V89 trav JXYW01270898.1 267 TVIDAKTTQPSSMDCAEGDDVTLPCNHSTIGGNEYIHWYRQNPNQSPQYVIHGLRGTVNSSMASLNIASDRKSSTLVLPQVTLRDAAVYYCIVRE
Capra aegagrus V90 trdv JXYW01270901.1 717 SSVAQRVTQNQPDISTQVGEIVTLSCRYETVQGHYHIFWYKQLPSGEMIYLIGHDSSSQNARYGRYSVNFKISLKFISLTISDLELEDSAKYFCTLWE
Capra aegagrus V91 ighv JXYW01283138.1 1443 VLSQVQLQESGPSLVKPSQTLSLTCTVSGFSLTSYGVGWVRQAPGKTPEWLGGIDSDGDTSYNPALKSRLSITRDTSKSQVSLSLRSVTTEDTAVYYCAR
Capra aegagrus V92 trav JXYW01288829.1 1059 VSLGNKVEQSPSTLSIQEGDSSVITCTYTDGNSEYFPWYKQEPGKGPQLLIAIRSNKDKEEDQRLTVLLNKTAKRLSLHIATTEAGDSAVYFCAAR
Capra aegagrus V93 trav JXYW01288832.1 2422 QTHGNSVTQMDGQVSRSEGTSVTINCTYSASGYPALFWYVQYPGEGPQLLLKAMKASDKGTNKGFEATYNTETTSFHLEKASVQESDSAVYYCALS
Capra aegagrus V94 trav JXYW01288833.1 1397 VSLGNKVEQNPSTLNVQEGNSSVITCTYTDGYSEYFPWYKQEPGKGPQLLIAIHSNKGKEEDQKLTVLLNKTAKSLSLHIATTEAGDSAVYFCAAR
Capra aegagrus V95 trav JXYW01289535.1 352 TVIDAKTTQPNSMDCAEGEDVNLPCNHSTIRGDDYIHWYRQNPNQSPQYVIHGLRGTVNGSMASLTIASDRKSSTLVLPQVTLRDAAVYYCALRE
Capra aegagrus V96 trdv JXYW01317338.1 4120 SCVAQRVIQDQPDISGQLGQSVTLNCQYATSWSYNYLFWYKLLPNGEMIYLISQVSSGQNARNGRYSVNIQKAHKSISLTISDLQLEDSAEYFCALWD
Capra aegagrus V97 trav JXYW01327490.1 1579 NVFDAKTTQPSSMDHPEGEDVNLHCNHSTISGDDYIHWFQQNPNQSPHYVIRGFRDTVNSSRASLHIASDRKSSTLVLPQVTLRDAAVYYCIVRE
Capra aegagrus V98 trdv JXYW01327499.1 5305 SGVAQRVIQDQPDISSQLGQSVTLNCRYGTTWSSYYLFWYKLLPSGEMIYLIHQVSSGQNARNGRYSVNFQKARKSISLTISDLQLEDSAEYFCALWE
Capra aegagrus V99 trav JXYW01331352.1 1148 MNGQQIKHFPEFLLLQEGENFTTYCNSSSTFYSLQWYKQSPGGSPVLLMILAKAGEAKTEQRLTGRLRETRQHSSLHLAAAQLSDAGSYFCAE
Capra aegagrus V100 trav JXYW01331354.1 1018 VRGVDVEQSPQGLSLHEGASYTLQCNFSTSSQSVKWYLQNSGGRLIHQFYIPSGTKRDGRLNATTVPKEGHSSLHISSSQTTDSGTYFCAAQHNAPQ
Capra aegagrus V101 trdv JXYW01331356.1 1666 SSVAQKVTQYQPDITSQVRNVVILNCRYETSWNVYTYWIFWYKQLPSGEMTYLIHQYSEDGNERDGHYSVNFQKAHKFISLTISSLKLEHSGKYFCALWE
Capra aegagrus V102 trav JXYW01332536.1 617 SVINAKTTQPSSMDCAEGEDVNLPCNHSTIGGNDYIHWYRQNPNQSPQYVIHGLRGTVNRSMASLHIALDRKSSTLVLPQVTLRDAAVYYCALRE
Capra aegagrus V103 trav JXYW01332537.1 733 VRGVDVEQSPPALSLQEGASYMLQCNFSTFPQSVNWYLQNPGGRIIHLFYITSGTKQDGRLNATTVPTERRSSLHISSSQTTDSGTYFCAAQHSAPQ
Capra aegagrus V104 trav JXYW01337211.1 3312 AGAQSVTQPDDHITVSEGARLELKCNYSSSGSPYLFWYVQYPNQGLQLLLKYESGDNLVSGIKGFEAELRRSEKSFHLRKIPAHWKDSAKYFCVLS
Capra aegagrus V105 trav JXYW01356635.1 5654 LSGEDRVEQSPQTLRIQEGDSLSLNCSYTVSSFSGLQWYRQDPGKGPELLFLLYSVGDEKQKERLRATLLKKGSSLLIGAPKPEDSATYLCAVE
Capra aegagrus V106 trav JXYW01362206.1 1508 GVKAVKVEQSPSVLNLQEGANCTLRCNFSATVQTLQWFQQNPGGSLISLFFIASGRKQNERLSSTVNSKERYSTLHITASQLEDAATYLCAVE
Capra aegagrus V107 trav JXYW01362810.1 3724 KSRGEKVEQYPSFQSVQEGDNCVINCTYIDSASDYFVWYKQEPGKGLQLLIHTLSNVDKKEGQGLIVLLNKKNKHLSLNITATHPGDSATYFCAAR
Capra aegagrus V108 trav JXYW01362813.1 4089 DSRGQSVTQPDDPVLVSEGTSLELKCNYSYGATPYLFWYVQYPGQRPQLLLKYFSGNTVVQGTRGFLAEFNSSDFSFNLRKFSAHWSDSAEYFCALS
Capra aegagrus V109 trav JXYW01365135.1 1927 MNGQQIKHFPEFLLLQEGENFTTYCNSSSLLSSLQWYKQRPGGSPVLLMILAKPGEAKTEQRLTGRLGLTGRLGESRQHSSLHLAAAQLSDAGTYFCAE
Capra aegagrus V110 trdv JXYW01365136.1 212 SGVAQKVTQDQSDVSSQLGQSVTLNCRYETSWSTYYLYWYKQLPSGQMTYVIHQGSQVTNARKDRYSVNFKKADKSISLTISALQLEDSAKYFCALSV
Capra aegagrus V111 trav JXYW01010666.1 748 VRGVDVEQSPPALSLQEGASYMLQCNFSTFPQSVNWYLQNPGGRIIHLFYITSGTKQDGRLNATTVPTERRSSLHISSSQTTDSGTYFCAAQHSAPQ
Capra aegagrus V112 trgv JXYW01040762.1 17044 IQQEIRLSQRSVMVGSAGGAMTMPCQVSRSVNYVHWFRQLEGQAPERLLYLALSKRDVQWDSVLGGDKVSAARGGDGKSCTMSLRKLAKSDEGLYYCAAWD
Capra aegagrus V113 trbv JXYW01045649.1 17150 VRAQTIHQWPSTRVQPAGSPLSLECTVKGTSSPTLYWYRQEAGGSLQLLFSSVGVDQIEPREFQNLEASRPQDGQFILSSKKLQLNNSGFYLCAWS
Capra aegagrus V114 trdv JXYW01102369.1 5743 VMSAVVLVPQDQEKTVPVGKSVTLSCSMKGAMFISKHYIFWYRKTPGNTMTFIYREEGVYGPGFEDNFRGKIDNSTNQAMLEILKASERDEGFYYCASD
Capra aegagrus V115 trdv JXYW01102370.1 65152 SNNVESADVPTVYKKEGESVTVECKFSVSYTYYMMYWYRQPSSGEMIYMINIYSQSKQTREGRYSVEFYKPNQMLKLTISALTLSDSAIYFCAVRE
Capra aegagrus V116 trav JXYW01102378.1 9818 LSVAQTVTQPQPEESVQEADTVTLDCTYSTSESDYYLFWYKQPPSGETVFIIHQYAYEQQNATNDRYSVNFQKEAKAFSLRISDSQLEDAAMYFCAYSG
Capra aegagrus V117 trav JXYW01102378.1 6615 PSVAQMVTQPQPEESVQETGTVNLHCTYTTSESNYYLFWYKQPPSAEMVFIIRQNAYEQQNATNDRYSVNFQKEAKAFSLKISDSQLEDAAMYFCAYSG
Capra aegagrus V118 trav JXYW01102389.1 10608 VKSDDDVMQSPSSLIVLEGSNATLSCSYKVTNVQSLHWYKQEEKVPTFLFALISTGIEKTSGRLRGTLDRKELLSTLHITVTKPGDSATYLCAVE
Capra aegagrus V119 trav JXYW01102389.1 4439 LRRADWIRSQESEVSGAEGKTVSLFCNYYTSSRSFVSLFWYRQYPNQAPEYILYRQWGSSGKGYASFATERFYSDNTANTTNLYIKKVVPADTALYLCALE
Capra aegagrus V120 trav JXYW01102397.1 41701 VLGDSKTTQPNSVEGTEEEPVHLPCNHSTISGSEYIYWYRQIPRQGPEYLVHGLNNNVTNRMASLSIAKDRKSSTLVLPQVTLRDTAVYYCILR
Capra aegagrus V121 trav JXYW01102397.1 33775 LRVQMKVEQSPRVLTLQEGRNSSLICNYSISMTSVQWFQQNPDGRLISLFYIASGMQQKERLKSTINSKERYSQLYIRDSQPGDSATYFCAVE
Capra aegagrus V122 trdv JXYW01102397.1 23977 SSMADKVTQAQTTVTGQEGEAATIGCTYETSRTYYTLFWYRQFPGGRMEFLIYQDSNQANARRDRYSVNFQKGKKTISLTISSLHLADSAKYFCALWE
Capra aegagrus V123 trav JXYW01102397.1 12651 ILGDSKTTQPNSVEGTEEDPVHLPCNHSTISGPEYIYWYRQIPRQGPEYLVHGLNNNVTNRMASLSIAKDRKSSTLVLPQVTLRDTAVYYCILR
Capra aegagrus V124 trav JXYW01102397.1 4614 VSAQQLNQSPQSMSIQEGEDLSMNCNSSSTLNLLLWYKQDAGEGLILLIKLLKGGELARNGKLTAQFRGTRKDSLLNNSAFEPKDGGTYFCAG
Capra aegagrus V125 trav JXYW01102400.1 3655 LSVQTKVEQSPGVLTLQEGRNSSLICNYSISIRSVQWFQQNPDGRLISLFYIASGMQQKERLKSTINSKERYSQLYIRDSQPGDSATYFCAVE
Capra aegagrus V126 trav JXYW01102402.1 4464 ESTQQLEQNPKFLRIQEGGNVTVYCNSSSTFTVFQWYRQKPEEGPVLLVTLTKPKEVKEQKRIRAEFGEARKDSSLLITAAQPGDAGTYLCAG
Capra aegagrus V127 trav JXYW01102406.1 14904 MNGQQIKHFPEFLLLQEGENFTTYCNFSSTFYNLQWYKQRPGGSPVLLMILTKGGEVKTQQRLTVRFGESRQHSSLHLMGTQPSDVGTYFCAA
Capra aegagrus V128 trav JXYW01102406.1 5922 IMVDVEITQLSSMDCAEGEDVNLPCNHSTVDALDYIHWYRQTPNQSPQYVIHGFRDTVNSSMSSLNIASDRKSSTLVLSQVTLRDTAVYYCVLRE
Capra aegagrus V129 trav JXYW01102411.1 17511 VRGVDVEQSPPALTPQEGASSTLWCNFSTFADSVWWYLQKPGGRLIHLIYIPSGTRQEGRLNATAVPKERRSSLHISSLRTTDSGTYFCAVWHSAPQ
Capra aegagrus V130 trdv JXYW01102411.1 4468 YSVAQQVTQVQTAVPSQVGQTVTLNCRYEVSWTTAFYYIFWYKQLPRGEMTLLIRQYSEHGNTRNGRYSVNLQKAHKSLSLIISALQLEDSAKYFCALWE
Capra aegagrus V131 trav JXYW01102418.1 2249 GTGAQLVTQPDGHINVSEGNRLELRCNYSYGGSIYLFWYVQYPSQGLQFLLKYLSGPTRVKGIKGFEAEFRKDENSFHLMKASAHWSDSAKYFCALC
Capra aegagrus V132 trdv JXYW01102420.1 9834 SGVAQKVTQDQSDVSSQVGQSVTLNCRYETSWGAYYLFWYKQLPSGQMTYLIQQYSGYSNARNGRYSVNFQKADKSISLIISSLQLEDSAKYFCALSV
Capra aegagrus V133 trav JXYW01102420.1 3017 NVIDAKTTQPSSMDYAEEEDVTLTCSHSTIGGNVYIHWYRQNPNQSPQYVIHGLRGTGNSSMASLTINSDRKSSTLVLPQCTLRDATVYYCVLRE
Capra aegagrus V134 trdv JXYW01102424.1 12955 SGVAQKVTQDQPDIASQVGESAAMNCQYETSRNSYNIFWYKQLPSGEMIYLIGQNSYSPNARDGRYSINFQRSLKAISLIISALKLEDSAKYFCALWE
Capra aegagrus V135 trav JXYW01102424.1 7064 VSSLLTVEQRPPLLRVQEGESTNFTCSFPSSSFYALHWYRWEPAKGPKNLFVISVHGDEKKQGRVRVTLNTKEGYSSMYIRGSQPEDSATYLCA
Capra aegagrus V136 trav JXYW01102426.1 14063 TVIDAKTTQPSSMDCAEEEDVTLPCNHSTISGNEYILWYRQNPNQSPQYVIHGLRGTVNGSMASLNIASDRKSSTLVLPQVTLRDAAVYYCIVRE
Capra aegagrus V137 trdv JXYW01102426.1 2352 SSVAQRVTQDQPDISSQVGEVVTLSCRYETIQSRYNIFWYKQLPSGEMIYLIGQGSSSQNARYGRYSLNLQRSRKSISLTISDLELEDSAKYFCALWE
Capra aegagrus V138 trav JXYW01102429.1 2519 GVRGVKVEQSPSVLSLQEGANSTLWCNSSDTVNSVQWFQQNPGGSLTRLFFIASGMKQNERLSSTVNSKERYSTLHITASQLEDTATYLCAVE
Capra aegagrus V139 trav JXYW01102437.1 351 SIMAQKVTQNQSEISVLEKEDVTLNCAYEANSYTYYLFWYKQPPSREMIFLIHQESYNELNTTKGQYFLNFQKAMSSISLTISDLQLEDSAVYFCALR
Capra aegagrus V140 trav JXYW01102438.1 760 SIMAQKVTQNQSEISVLEKEDVTLNCAYEANSYTYYLFWYKQPPSREMIFLIHQESYNELNTTKGQYFLNFQKATSSISLTITDLQLEDSAVYFCALR
Capra aegagrus V141 trav JXYW01102446.1 9539 NVIDAKTTQPNSMDCAEGENVYLPCNHSTIGGDEYVHWYQQNPNQSPQYVIHGLRGTVNGSMASLTIASDRKSSTLVLPQVTLRDAAVYYCIVRE
Capra aegagrus V142 trdv JXYW01102446.1 1720 SGVAQKVTQDQPDITRQVEQSVTLNCLYEVSWYMDYYSIFWYKQLPRGQMTYLIRQYSEDGNARDGRYSVNFQKADKSISLTISALQLEDTAKYFCALRE
Capra aegagrus V143 trdv JXYW01102447.1 1678 SCVAQQVTQNQPDISSQVGQSVTLNCRYETSWSYYYLVWYKQLPSGQMTYLIQQYSENSNTRNGRYSVNFKKADKSISLIISSLQLEDSAKYFCALRD
Capra aegagrus V144 trav JXYW01102455.1 1200 TLSLAKTSQPIIIDSYEGQEVNIPCNHTTIAISEYIFWYRQFPNQGPQFIIQGYTTTVENEVASLLIPPDRKLSTLSLPRASLGDAAVYYCIVQD
Capra aegagrus V145 trav JXYW01102461.1 1853 SAGKGVEQPTEWTAMEGASAQVNCTYQTSGFNGLFWYQQHDGGAPVFLSYNVLDGLETRGHFSSFLRRSDACSYLLLKELHMKDFASYLCAVI
Capra aegagrus V146 trav JXYW01106676.1 439 GTNGDSVNQTEGPVTVPEGALMTLNCTYQTANPAPYLFWYIQHLNKAPQLLLKGLMSDPKPKSEGFQATLVQSDRSFHLQKWAVQASDSAVYYCALS
Capra aegagrus V147 trav JXYW01133209.1 828 GTNGDSVNQTEGPVTVSEGALMTLNCTYQATYSTVYLFWYVQHLNKAPQVLLKGLTADKKVEHEGFQATLVKSDSSFHLQKWAVQASDSAVYYCALS
Capra aegagrus V148 trav JXYW01133211.1 2063 VNSQQGEQNLQTLSIQEGESVTMNCSYKSITITALQWYRQDSRRGFVHLILVRSNERQKHSGRLLFTLDSSIQSSSVSIAASQAEDTATYLCAP
Capra aegagrus V149 trav JXYW01133214.1 5001 VSSQQNTVEQSPASLPVPEGAVASLGCTYSDSNSQYFTWYRQYPGKGPEFLLQVYADKDKEEGKFTAQSNKTNKRVSLRIRDSEPSDSATYLCAV
Capra aegagrus V150 trav JXYW01133232.1 4067 GTNGDSVTQTEGPVTVSEGALMTLNCTYQATYSNVYLFWYVQHLNKAPQLLLKGLTADKKVEHEGFQATLVKSDSSFHLQKQAVQTSDSAVYYCALS
Capra aegagrus V151 iglv JXYW01164542.1 389 SWAQAVLTQPSSVSWSPGQRVFITCSGSSSNVGTGNYVGWYQQVPGSAPKLLIYGATSRASGVPDRFSGSRSGNTATLTITSLQAEDEADYYCASADLSLNS
Capra aegagrus V152 trav JXYW01259139.1 2369 VSSQQNTVEQSPASLPVPEGAVASLGCTYSDSNSQYFAWYRQYLGKGPEFLLNVYLDKDKEEGKFTAQSNKTNKRVSLRIRDSEPSDSATYLCAV
Capra aegagrus V153 trav JXYW01259147.1 3619 QTRGDSVSQMDGQVTLLEGATLTVNCTYSATRYPTLFWYVQYPGEGPQLLLKATKASDKGTNKGFEATYNAKTTSFHLEKASVQESDSAVYHCALS
Capra aegagrus V154 trav JXYW01259148.1 7420 SSIAQKVTQDQSPMSVQEKETVTLDCTYDTSITTYSLFWYKQPSSGVMTFLIRQDSSNKPNATEGCYSLNFQKASKFITLTVSASQLEDSAVYFCAE
Capra aegagrus V155 trav JXYW01259149.1 3644 VSLGNKVEQSPSTLSVQEGNSSVITCTYTDSASAYFPWYKQEPGKGPQLLIAIRSNKDKEEDQRLTVLLNKTAKRLSLHIATTEAGDSAVYFCAAR
Capra aegagrus V156 trav JXYW01259152.1 903 YIIAQKLTQDAQPMLIQEKKAVTLDCTYDTRDASYSLFWYKQPSSGAMIFLLRQDSYGKQNAAEGRCSLNFQKASKSITFVISTSQLEDSAVYFCALRE
Capra aegagrus V157 trav JXYW01259512.1 1110 GNNGDSVNQTEGPVTVSEGALMTLNCTYQTAGFSPYLFWYVQHLNKAPQFLLKGSMTNQRPEHEGFQATLVKSDSSFHLQKRAVQASDSAVYYCALS
Capra aegagrus V158 trdv JXYW01261808.1 678 SGVAQKVTQDQSDVSSQVGQSVTLNCRYETSWSAYYLFWYKQLPSGQMTYVIRQGSLVTNAPKDRYLINFQKADKSISLIISALQLEDSAKYFCALCD
Capra aegagrus V159 trav JXYW01267587.1 1104 TVIDAKTTQPNSMDCAEGENVNLPCNHSTIGGDEYIHWYRQNPNQSPQYVIHGLRGTVNGSMASLTIASDRKSSTLVLPQVTLRDAAVYYCILRE
Capra aegagrus V160 trdv JXYW01271156.1 330 SGVAQKVTQDQPDISSQVGELATMNCHYETSWSSYNIFWYKQLPRGEMIYLIGQNYSPNARDGHYSINFQRSRKAISLIISALKLEDSAKYFCALWE
Capra aegagrus V161 trdv JXYW01271159.1 30302 SGVAQSVTQDQPDILSEVGKTVTLNCRYETSWNMLSYYIFWYKQLSSGQMTYLIRQYSDDGNARDGRYSVNFQEAHKAISLTIPALELEDSAMYFCVLRA
Capra aegagrus V162 trdv JXYW01271159.1 3965 SSVAQRVTQNQPDISTQVGEIVTLSCRYETVQSHETVQSHYHIFWYKQLPSGEMIYIIGHGSSSQNARYGRYSVNFQISRKFISLTISDLELEDSAKYFCTLWE
Capra aegagrus V163 ighv JXYW01274567.1 7371 VLSQVQLQESGPSLVKPSQTLSLTCTVSGFSLTSYAVGWVRQAPGKAPEWVGGISSGGSTGYNPALKSRLSITRDTSKSQVSLSLSSVTTEDTAVYYCAR
Capra aegagrus V165 trav JXYW01283613.1 6238 VRGVDVEQSPPALSLQEGASYTLQCNFSTFPQSVNWYLQNPGGRIIHLFYIPSGTKQDGRLNATTVPKDGHSSLHLSSSQTTDSGTYFCAVQHSAP
Capra aegagrus V166 trav JXYW01286970.1 735 VSLGNKVEQSPSTLSVQEGNSSVITCTYTDGNSDYFPWYKQEPGKGPQLLIAIHSNKDKEEDQRLTVLLNKTAKRLSLHIATTEAGDSAVYFCAAS
Capra aegagrus V167 trav JXYW01294609.1 7162 GTSGDSVTQTEGVVILPEKASLTLKCTYQSSYSDILFWYVQYKNKELELLLKSSLGDQKVTSRGFEATHISSDSSFHLQKSSVQTSDSAGYYCALS
Capra aegagrus V168 trav JXYW01294609.1 664 GTNGDSVNQTEGPVTVSEGALMTLSCTYQTTYSNPYLYWYVQHLNKAPQLLLKGLTADKKVEHEGFQATLVQSDRSFHLQKRAVQASDSAVYYCALS
Capra aegagrus V169 trdv JXYW01295731.1 2776 SIIAEKITQDPQLMLVQEKEAVTLDCTYDTSDSSYSLFWYKQPNSGAMIFLLSQDSYGKENAAEGRYSLNFQKASKSITLVISASQLEDSAVYFCALRE
Capra aegagrus V170 trdv JXYW01344716.1 2165 SGVAQKVTQDQPDISSQVGQSVILNCRYETSWRVYYLFWYKQLPSGQMTYLIQQYSGYSNARDGRYSVNFQKADKSISLIISSLQLEDSAKYFCALSV
Capra aegagrus V171 trav JXYW01352155.1 1206 GVRAVKVEQSPSVLNLQEGANCTLRCNFSATVKTLRWFQQNPGGSLISLFFIASGMKQNERLSSTMNSKERYSTLHITASQLEDAATYLCAVE
Capra aegagrus V172 trav JXYW01363992.1 3663 QTHGDSVRQMDGQVTLLEGATLTVNCTYSAIGYPTLFWYVQYAGEAPELLLKATKANDKGTNEGFEATKDAKTTSFHLEKASVQESDSAVYHCALS
Capra aegagrus V160 trbv CBYH010018189.1 2133 TWGTGVFQTPKYLLTQMGTKTSLECEQKLNHDNMYWYKQDSKKLLKAMFHYNNKELVENETVPSRFSPESPDKAHLNLHIDSLEPGDSAVYFCASS
Capra aegagrus V161 trbv CBYH010018189.1 6522 VSADPGITQIPKYLVMGTTDKKSLKCEQHLGHNAMYWYKQSAQKPPELMFIHSYMKLSGNESVPSRFWPECPDSSQCRLDLSAPKPQDSAVYLCASSR
Capra aegagrus V162 trbv CBYH010018190.1 16608 LVDSEVTQTPKYLIKSRKEQATLGCSPESGHRSVNWYQQALGQGPRFLVQYYRGQVSGEENMPDRFSAKQFSDFRSELNLSSLELTDSAVYLCASSQ
Capra aegagrus V163 trbv CBYH010018190.1 21465 EVHAGVTQDPRFQVVRTGQRVTLRCTQDLNYDYMYWYRQDPGHGLRLIHYSDGPPATEKGDVPDGYNVSRPSTEDFPLTLESASRSQTSVYFCASSY
Capra aegagrus V164 trbv CBYH010018190.1 25377 LVDSEVTQTPKYLIKSRKQQATLRCSPESGHFSVYWYQQALGQGPQFLVQYYNQKVSGEAHLPDRFSGKQFSDSRSELNLSSLELMDSAMYLCASSQ
Capra aegagrus V165 trbv CBYH010018190.1 29282 AVHAGVTQDPRFQVVKTGQRVTLNCTQDLGHNYMYWYRQDPGHGLRLIHYSPGPPTTQQGDVPEGYSISRSSTENFPLTLESANPSQTFVYFCASSY
Capra aegagrus V166 trbv CBYH010018191.1 4912 LVDSEVTQTPKFLTKSRKQQVTLRCSPESGHRSVYWFQQALGQGPQFLVQYFDGKVYQRGNMSDRFSGQQSGSELNLTSLELMDSALYLCASSQ
Capra aegagrus V167 trbv CBYH010018191.1 6653 AVHAGVTQDPRFQVVRTGQSTTLKCTQDLGHDRMYWYQQDLAHGLRLIHYSAGMHTSKPGSVPDGYSASRSNTENFPLTLESANHSQTSAYFCASSY
Capra aegagrus V168 trbv CBYH010018191.1 8893 LVDSGVTQTPKYLIKSRKQQGILRCSPESGHRYVSWYQQALGQGPQFLVQYYDGKVRTKGNMPDRFSGEQFSDSSSQMNLSSLELTDSAVYLCASSQ
Capra aegagrus V169 trbv CBYH010018192.1 8808 LVDSEVTQTPKYLIKSRKQQAMLRCSPEPGHLSVYWYQQALGQGLQFLIQYYNRAENEKGNIPDRFSGKQFSDSSSELNVTSLELTDSAVYLCASSQ
Capra aegagrus V170 trbv CBYH010018198.1 1621 AVHAGVTQDPRFQVVRTGQRATVTCTQDLDHNSMYWYQQDLGPGLRLIHYSAGPPTTEKGDVPDRYRVSRPSRENIPLTLESASHSQTSVYFCASSYSME
Capra aegagrus V197 trdv CBYH010022917.1 127327 KGVLCNQVTQSSPEQRVASGQEVTLQCTFQTTYSNPDLYWYRKRPDAVFQFVLYRDNTRSHDADFARGRFTVQHSVRSKTFHLVISSVRPEDTATYYCALEL
Capra aegagrus V234 trgv CBYH010028795.1 16404 GLGLSKVEQAQISLSTEVKKSIDIHCKIESTNFESETVYWYRQKRNQALEHLVYVISTTTAARNQVDGKNKIEARKDARMFTSTLTVNFVEKDDVGIYYCAGWS
Capra aegagrus V235 trgv CBYH010028795.1 27756 GLGQLTLEQPELSVTGTREKSIIMTCKVFSKDFSKDYIHWYRQKPDQGLEQLLYVSTAPVQNHLGGKKNKLEARKDAPSSTSTLKISFLEKEDEATYYCAGWLS
Capra aegagrus V236 trgv CBYH010028795.1 32068 LPITQRITSITKKKGNMAFLECQIKIDKLKKNVYMHWYRQKPEQPLKRILYISSNENVIHEQGISEERYEARKWPSNALVSLRIHQATEEEAGLYYCACWL
Capra aegagrus V237 trgv CBYH010028795.1 34525 GDIKMKISQHQLSSTRRPDRTAHISCKLSGVSLENAIVHWYQEKEGEPLKRILYGSANSYKLDKPNSRLEMDNKKNGIFYLVINNVVKSDEATYYCACWD
Capra aegagrus V238 trgv CBYH010028796.1 7349 TQVSSNMEEDKLSVTRATGSSVVIDCDLTQNYIHWYKFQEGTVPRRLLYYDVYYSKVVLESGISEGKYHVYKGTGKSYTFVISNLQESDSGTYYCAVWE
Capra aegagrus V239 trgv CBYH010028796.1 21213 MQVSSNMEGEKMSITKAAVPGAFVEIICDLITQTVKYIHWYKYQEGTAPRRLLYYDISYSKIVLESGISEGKYKVYKEKSYTFAISNLQESDSGMYYCAVWE
Capra aegagrus V319 trav CBYH010044203.1 25306 SAGKGVEQPTEWTAMEGASAQVNCTYQTSGFNGLFWYQQHDGGAPVFLSYNVLDGLETRGHFSSFLRRSDACSYLLLKELHMKDFASYLCAVI
Capra aegagrus V320 trav CBYH010044208.1 11933 TLSLAKTSQPIIIDSYEGQEVNIPCNHTTIAISEYIFWYRQFPNQGPQFIIQGYTTTVENEVASLLIPPDRKFSTLSLPRASLGDAAVYYCIVQD
Capra aegagrus V321 trav CBYH010044209.1 832 GVRGVKVEQSPSVLSLQEGANSTLWCNFSDTVNSVQWFQQNPEGSLISLFFIASGTKQNERLSSTVNTKERYSTLHITASQLEDAATYLCAME
Capra aegagrus V322 trav CBYH010044212.1 3361 KSRGEKVEQYPSFQSVQEGDNCVINCTYIDSASDYFVWYKQEPGKGLQLLIHTLSNVDKKEGQGLIVLLNKKNKHLSLNITATHPGDSATYFCAAR
Capra aegagrus V323 trav CBYH010044216.1 4101 DSRGQSVTQPDDPVLVSEGTSLELKCNYSYGATPYLFWYVQYPGQRPQLLLKYFSGNTVVQGTRGFLAEFKSSDFSFNMRKFSAHWSDSAEYFCALS
Capra aegagrus V424 trbv CBYH010073289.1 32614 VRAQTIHQWPSTRVQPAGSPLSLECTVKGTSSPNLYWYRQEAGGSLQLLFSSVGVDQIEPREFQNLEASRPQDGQFILSSKKLQLNNSGFYLCAWS
Capra aegagrus V426 trgv CBYH010074131.1 16030 IQQEIRLSQRSVMVGSAGGAMTMPCQVSRSVNYVHWFRQLEGQAPERLLYLALSKRDVQWDSVLGGDKVSAARGGDGKSCTMSLRKLAKSDEGLYYCAAWD
Capra aegagrus V459 trav CBYH010086010.1 16841 LSVAQTVTQPQPEESVQEADTVTLDCTYSTSESDYYLFWYKQPPSGETVFIIHQYAYEQQNATNDRYSVNFQKEAKAFSLRISDSQLEDAAMYFCAYSG
Capra aegagrus V460 trav CBYH010086010.1 20044 PSVAQTVTQPQPEESVQETGTVNLHCTYTTSESNYYLFWYKQPPSAEMVFIIRQNAYEQQNATNDRYSVNFQKEAKAFSLKISDSQLKDAAMYFCAYSG
Capra aegagrus V461 trav CBYH010086011.1 29175 VSGKNGVEQSPQYLSAQEGDLITINCNYLEGMTTLQWLQQNPGGSIISLLTLSLEMKRKGRVSATINRRERYSSLNITASQPTDSAIYLCAVE
Capra aegagrus V462 trdv CBYH010086012.1 17021 SNNVESADVPTVYKKEGESVTVECKFSVSYTYYMMYWYRQPSSGEMIYMINIYSQSKQTREGRYSVEFYKPNQMLKLTISALTLSDSAIYFCAIRE
Capra aegagrus V463 trdv CBYH010086014.1 17466 VMSAVVLVPQDQEKTVPVGKSVTLSCSMKGAMFISKHYIFWYRKTPGNTMTFIYREEGVYGPGFEDNFRGKIDNSTNQAMLEILKASERDEGFYYCASD
Capra aegagrus V478 trav CBYH010094252.1 2345 VSLGNQVEQSPSTLSVQEGNSSVITCTYTDGNSEYFPWYKQEPGKGPQLLIAIRSNKDKEEDQRLTVLLNKTAKRLSLHIANTEAGDSAVYFCAAG
Capra aegagrus V479 trav CBYH010094253.1 6024 QTRGDSVSQMDGQVTLLEGATLTVNCTYSATRYPTLFWYVQYPGEGPQLLLKATKASDKGTNKGFEATYNAKTTSFHLEKASVQESDSAVYHCALS
Capra aegagrus V480 trav CBYH010094254.1 1410 GVRGVKVEQSPSILSLQEGANSTLWCNFSDTVNNVQWFQQNPGGSLTRLFFIASGTKQNERLSSTVNSKEWYSTLHITASQLEDAATYLCAVE
Capra aegagrus V481 trav CBYH010094255.1 625 VSLGNKVEQSPSTLSVQEGNSSVITCTYTDTASDYFPWYKQEPGKGPQLLVAIHSNMGEKKDQRLTVLLNKTTKHLSLHIATIQPGDSAVYLCAAR
Capra aegagrus V484 trdv CBYH010095007.1 11950 SGVAQSVTQDQPDILSEVGKTVTLNCRYETSWNMLSYYIFWYKQLSSGQMTYLIRQYSDDGNARDGRYSVNFQEAHKAISLTIPALELEDSAMYFCVLRA
Capra aegagrus V485 trdv CBYH010095008.1 23478 SSVAQRVTQNQPDISTQVGEIVTLSCRYETVQSHETVQSHYHIFWYKQLPSGEMIYIIGHGSSSQNARYGRYSVNFQISRKFISLTISDLELEDSAKYFCTLWE
Capra aegagrus V486 trdv CBYH010095008.1 37817 SGVAQKVTQDQPDISSQVGELATMNCHYETSWSSYNIFWYKQLPRGEMIYLIGQNYSPNARDGHYSINFQRSRKAISLIISALKLEDSAKYFCALWE
Capra aegagrus V487 trav CBYH010095009.1 2989 VSSLLTVEQRPPLLWVQEGESTNFTCSFPSSSFYTLHWYRWEPAKGPKNLFVISVHGDEKKQGRVRVTLNTKEGYSSMYIRGSQPEDSATYLCA
Capra aegagrus V489 iglv CBYH010095954.1 3298 SWAQAVLTQPSSVSRSLGQRVSITCSGSSSNVGYGNYVSWYQQVPGSAPKLLIYGATSRASGVPDRFSSSKSGNTATLSISSLQAEDEADYYCSSYDSSSYN
Capra aegagrus V490 iglv CBYH010095954.1 12070 SWAQAVLTQPSSVSRSPGQRVFITCSGSSSNVGTGNYVGWYQQVPGSAPKLLIYGATSRASGVPDRFSGSRSGNTATLTISSLQAEDEADYYCSSYQSGYSY
Capra aegagrus V491 iglv CBYH010095954.1 19405 CWAQAVLTQPSSVSRSLGQSVSITCSGSSSNIGGGYYVGWYQQIPGSAPRTLIYQNSKRPTGVPNRFSGSKSGSTATLTISSLQAEDEADYYCSAYDSSISA
Capra aegagrus V492 iglv CBYH010095954.1 26498 SWAQAVLTQPSSVSGSLGQRVSITCSGSSSNIGRGYGSWYQQVPGSAPKLLIYGATSRASGVPDRFSGSRSGNTATLTISSLQAEDEADYYCAAYDSSSSN
Capra aegagrus V493 iglv CBYH010095954.1 30604 SLFQPVLTQPASLSASPVTSARLSCTLSSGYNVGDFSLSWFQQKPGSPPWYVVRVKSDSDKNQSSGVPSNFFGSKDASANAGLLLISGLQPEDEADYYCAVWHG
Capra aegagrus V494 iglv CBYH010095954.1 41420 SWAQAVLTQPPSVSGSPGQRVSITCTGSSSNIGGGNYVGWYQQLPGSGLRTIIYSTSSRPSGVPDRFSGSRSGNTATLTISSLQAEDEADYYCATGDSSSYN
Capra aegagrus V495 trav CBYH010096242.1 315 NVFDAKTTQPSSMDYPEGEDVSLPCNHSTISGNEYIHWYRQNPNQSPQYIIHGLRDTVNSSMASLHIASDRKSSTLVLPQVTLRDAAVYYCILRE
Capra aegagrus V496 trav CBYH010096245.1 1850 TVIDAKTTQPNSMDCAEGEDVNLPCNHSTIGGNDYIHWYRQNPNQSPQYLIHGFRDTVNGSMASLTIASDRKSSTLVLLQVTLRDAAVYYCALRE
Capra aegagrus V497 trav CBYH010096963.1 8337 VSSQQNTVEQSPASLPVPERAVASLGCTYSDSASQYFAWYRQYPGKGPEFLLLVYSDKDKEEGKFTAQSNKSNKHVSLHIRDSEPSDSATYLCAV
Capra aegagrus V498 trav CBYH010096964.1 2958 GTRAQTVTQPESHIPVSEGDPVQVKCSYSYSGSPVLFWYVQYPRQRLQLLLKDTSRESIQGFTAELSRAEASFHLKKPSAREEDSAVYYCALG
Capra aegagrus V499 trav CBYH010096964.1 7494 VNSQQGEQNLQTLSIQEGENVTMNCSYKSITITALQWYRQDSRRGFVHLILMRSNERQKHSGRLLFTLDSSIQSSSVSIAASQAEDTATYLCAP
Capra aegagrus V500 trav CBYH010096967.1 660 GTSADSVTQTEGVVTLPETASLTLKCTYQSSYSVSLFWYVQYQNKELELLLKSSLGNQKVTSRGFEATHISSDSSFHLQKSSVKTSDSAVYYCALS
Capra aegagrus V504 trbv CBYH010097367.1 914 LVESEVTQTPKYLIKSRKEQVTLRCSPKSGHRSVYWYQQALGQGPQFLVQYYDGEIYQKENISDRFSGKQFSDARSELSLTPLELTDSAVYLCASSQ
Capra aegagrus V505 trbv CBYH010097369.1 201 LVDSGVTQTPKYLIKSKKQQLTLRCSPEFGHRYVSWYQQALGQGPQFLIQYYNREVNEKGNIPDRFSENQFSDSRSELNLTSLELTDSAVYLCASSK
Capra aegagrus V506 trbv CBYH010097372.1 2673 AVHAGVTQDPRFQVVRTEQRATLKCTQDLGHDSMYWYRQDLGHGLRLIHYSAAYPSTEKGDVPEGYSVSRPSTENFPLTLKSANRSQTSVYFCASSY
Capra aegagrus V507 trbv CBYH010097372.1 4900 LVDSGVTQTPRYLIKARGQRGTLRCSPVSGHLSVYWYQQALGQGPQFLVQYYSQNVYGEAQLPDRFSGKQFSDSSSELNLTSLELTDSAVYLCASSQ
Capra aegagrus V508 trbv CBYH010097375.1 206 LIHAGVTQDPRFQVVRTGQSTTLKCTQDLDHNSMYWYRQDPGLGLRLIHYSAAYPSTEKGDVPEGYNVSRPSTEDFPLTLKSASRSQTSVYFCASSY
Capra aegagrus V509 trav CBYH010097914.1 239 QTHGNSVTQMDGQVSRSEGTSVTINCTYSAAGYPALFWYVQYPGEGPQLLLKAMKASDKGTNKGFEATYNTETTSFHLEKASVQESDSAVYYCALS
Capra aegagrus V510 trav CBYH010097915.1 1898 VSLGNKVEQNPSTLNVQEGNSSVITCTYTDGYSEYFPWYKQEPGKGPQLLIAIHSNKGKEEDQKLTVLLNKTAKSLSLHIATTEAGDSAVYFCAAR
Capra aegagrus V511 trav CBYH010097928.1 900 SIIAQKVTQAQPQVLGQEKEAVTLDCKYDTSDSRYSLLWYKQPSSGGMILLIRQDSYNQQNATEGCYSLNFQKARKSFTLVISASQLEDSAVYFCALSE
Capra aegagrus V512 trav CBYH010097978.1 1235 GTNGDSVSQTEGPVTVSEGALMTLNCTYQTADSNPYLYWYVQHLNKAPQLLLKGSARDPKPKSEGFQATLVQSDRSFHLQKRAVQASDSAVYYCALS
Capra aegagrus V513 trav CBYH010097981.1 6326 GTNGDSVNQTEGPVTVSEGALITLNCTYQATFSDSYLFWYVQHLNKAPELLLKGSMTNQRPEHEGFQATLVQSDRSFHLQKRAVQASDSAVYYCALS
Capra aegagrus V514 ighv CBYH010098464.1 2546 VLSQVQLQESGPSLVKPSQILSLTCTVSGFSLTSYGVGWVRQAPGKALEWVGGISSGGSTGYNPALKSRLSITRDTSKSQVSLSLSSVTTEDMALYYCAR
Capra aegagrus V515 trav CBYH010098822.1 7238 GTNGDSVTQTEGPVTVSEGTLMTLNCTYQTANPAPYLFWYIQRLNKAPQLLLKGSMSDLKPKSEGFQATLVKTDRSFHLQKQAVQASDSAVYYCALS
Capra aegagrus V516 trav CBYH010098851.1 3788 VSLGNKVEQSPSTLSVQEGNSSVITCTYTDTASDYFPWYKQEPAKGPQLLIAIRSNMGEKKDQRLTVLLNKTAKHLSLHIATIQPGDSAVYLCAAR
Capra aegagrus V517 trav CBYH010098853.1 1980 VNSQQGEQNLQTLSIQEGESVTMNCSYKSITITALQWYRQDSRRGFVHLILMRSNERQKHSGRLHFTLDSSIQSSSMSIMASQAEDTATYLCAP
Capra aegagrus V519 trav CBYH010099449.1 5964 NVFDAKTTQPSSMDHPEGEDVNLHCNHSTISGDDYIHWFQQNPNQSPHYVIRGFRDTVNSSRASLHIASDRKSSTLVLPQVTLRDAAVYYCIVRE
Capra aegagrus V520 ighv CBYH010099591.1 950 VLSQVQLQESGPSLVKPSQTLSLTCTVSGFSLTSYGVGWVRQAPGKTPEWLGGISSGGSTGYNPALKSRLSITRDTSKSQVSLSLSSVTTEDTAVYYCAR
Capra aegagrus V521 trav CBYH010100199.1 84 GTNGDSVSQTEGPVTLSEGALMTLNCTYQTTYPDFYLFWYVQHLNKAPQFLLKGSTTNQRPEHEGFQATLVKSDSSFHLQKRAVQASDSAVYYCALS
Capra aegagrus V522 trav CBYH010100247.1 1153 VSSKQDVSQSPEALSVREGDSLVLNCSYTDSALYFLQWFRQDPGKGLTSLLSIQANQKEQASGRITVSLDKSSRHSALYIATSQHSDSTTYLCAV
Capra aegagrus V523 trav CBYH010100310.1 3203 SIVAQKVTQDPQPILVHEKEAVTLDCTYDTSDSSYSLFWYKQPSSGAMIFLLSQDSYGKQNASEGRYSLNFQKASKSITLVISASQLEDSAVYFCALRE
Capra aegagrus V524 iglv CBYH010100588.1 444 SWAQAVLTQPSSVSGSPGQRVSITCSGSNIGSSGVGWYQQLPGSGLKTVIYYNSNRPSGVPDRFSGSKSGNTATLTISSLQAEDEADYYCGSYDSSSYN
Capra aegagrus V525 trdv CBYH010100667.1 3536 SSVAQKVTQYQPDITSQVRNVVILNCRYETSWNVYTYWIFWYKQLPSGEMTYLIHQYSEDGNERDGHYSVNFQKAHKFISLTISSLKLEHSGKYFCALWE
Capra aegagrus V526 iglv CBYH010100671.1 5489 SRAQAVLTQPSSVSRSLGQRVTITCSGSSSNNGGNFVGWCQQLPGTAPKTPIYGDSNRPSGGPEWFSGSKSGNSASMTIASLQAEEEAGYYCLSWDDSLNG
Capra aegagrus V527 trav CBYH010100791.1 3771 GTICDSVNQTEGPVTVSEGALMTLNCTYQTTYLNSYLFWYVQHLNKAPQLLLKGLTADKKVEHEGFQATLVQSDRSFHLQKWAVQASDSAVYYCALS
Capra aegagrus V528 trav CBYH010100944.1 164 TVINAKTTQPNSLDCAEGENVYLPCNHSTIGGDDYIHWYRQNPNQSPQYLIHGLRGTVNSSMASLHIAPDRKSSTLVLPQVTLRDTAVYYCALRE
Capra aegagrus V529 trav CBYH010101256.1 553 VRGLDVEQSPPALSLQEGASHMLRCNFSASVTNVQWYLQNPSGRLIHLFNVPSGTKQDGRLKATTIPTERSSSLHVSSSQTTDSGTYFCAAQHSAPQ
Capra aegagrus V530 trav CBYH010101483.1 171 VRGVDVEQSPQGLSLHEGASYTLQCNFSTSSQSVNWYLQNSGGRLIHQFYIPSGTKRDGRLNATTVPKEGHSSLHISSSQTTDSGTYFCAAQHNAPQ
Capra aegagrus V531 trav CBYH010101831.1 1295 TVIDAKTTQPSSMDCAEEGVTLSCSHSTIGGNDYIHWYWQNPNQSPQYVIHGLRGTVNSSMASLTIDSDRKSSTLVLPQVTPRDTAVYYCILRE
Capra aegagrus V584 trav CBYH010004897.1 1234 AHAQMVQVNDSMYGFIGTDVVLHCSFANPLPGVKITQVTWQKATNGSKQNVAIYNPAMGVSVLAPYRERVEFLRPSFTDGTIRLSRLELEDEGVYICEF
Capra aegagrus V589 iglv CBYH010005804.1 20868 SWAHAVLTQPPSVSGSLGQSVTISCSGSSNIGILGVSWYQQLQGSAPKTLIYGSNKRPSGVPDRFSGTKSGNTGTLTITSLQAEDEADYYCASADLILNS
Capra aegagrus V590 iglv CBYH010005804.1 18088 SLSQPLLTQPASLSASPGASARLTCTLSSGYNVGNYSIYWYQQKAGSPPRYLLRFKSDSDKHQGSGVPNRFSGSKDASTNAGLLLISEVQPEDEADYYCAVWHG
Capra aegagrus V591 iglv CBYH010005804.1 10565 SWAQAVLTQPPSVSGSLGQRVSIFCNGSSSNIGGGNYVGWYQLIPGSGLRTIIYGTTGRASGVLDRFSGSRSGNTATLTITSLQAEDEVDYYCATYDSSSYN
Capra aegagrus V666 igkv CBYH010015576.1 44967 AKCDIQVTQSPSSLSASLGDRVSITCQASQNIDTKLAWYQQKPRKAPKLLIYAISRSPSWFPSQFSGSGFGIDFTLTISSLKADDIATYYCQQ
Capra aegagrus V738 trav CBYH010024403.1 52159 SRGQSGTQPDDPVLVSEGTSLELKCNYSYGATPYLFWYVQYPPQRPQLLLKHFSGNTVVQGIRGFVAEFESSDFSFNLRKFSAHWSDSAEYFCALS
Capra aegagrus V901 iglv CBYH010057143.1 10622 SVVSYELTQPTSVSVVLGQTAKVTCSGDLLDEQYTQWHQQKPGQAPELVIYEDSKRRSGIPDRFSGSSSSKTAILTISGVRAEDEADYYCVSWDSGNYN
Capra aegagrus V902 iglv CBYH010057143.1 5863 HLASSQLTQPPAVSVSLGQTASITCQGDDLAFLSANWYQLKPGQAPVTVIYGGSDRASGIPDRFSGSKSDTTATLTIRGAQAEDEADYYCQSGGIDVD
Capra aegagrus V903 iglv CBYH010057144.1 21437 SVVSYELTQPTSVSVALGQTAKVTCQGDNLGSSYVQWHQQKPGQAPVTVIYQDSKRPSGIPDRFSGSNSGNTATLTISGARTEDEADYYCQSADSSNN
Capra aegagrus V904 iglv CBYH010057144.1 16606 SVVSYELTQPTSVSVALGQTAKVTCSGDLLDENFAHWYQQKPGQAPVLVIYLNSERASGIPDRFSGSSSGSTATLTISGVQAEDEADYFCQSYDSSNN
Capra aegagrus V905 iglv CBYH010057144.1 3466 SVISYELTQPTSVSVALGQTAKITCQGDLLDEKYTAWYQQKPGQAPVKVICKDSERPSGILDRFSGSSSGKTATLTISGARTEDEADYYCQSADSSNN
Capra aegagrus V906 iglv CBYH010057147.1 4152 SWAQSALTQPASVSGNPGQTVTISCTGTSSDIGSYNGVGWYQQLPGSAPKTLIYNVNKRPSGIPARFSGSKSGNTATLTISGLQAEDEADYYCSSATSG
Capra aegagrus V907 iglv CBYH010057151.1 3206 SWAQSALTQPASVSGNPGQTVTISCTGTSSDIGGYNYVGWYQQLPGSAPKTLIYNVNNRPSGIPARFSGSKSGNTATLTISELQAEDEADYYCSSARS
Capra aegagrus V908 iglv CBYH010057158.1 12654 SWAQAVLTQPPSVSRSLGQTVTISCSGSSSNIGILGVSWYQQLPGSAPRTLIYDSNKRPSGVPDRFSGTKSGNTGTLTITSLQAEDEADYYCASADLILNS
Capra aegagrus V963 trbv CBYH010073295.1 3882 SVFGALLSQKPSRAIRQRGTSMTIECQVDSQLTFMYWYRQLPGQSLVLMATANQGSKATYESGFTEDKFPISRPNLAFSTLTVSNASSEDSSSYFCSAG
Capra aegagrus V964 trbv CBYH010073296.1 6839 PLEADVTQSPRHRITETRKRVTLTCSQNMNHDVLYWYRQDPGLGPKLIYFSRNVGFVEKGDISDGYTASREEKPNFPLILELTSTNQTSLYLCASSE
Capra aegagrus V965 trbv CBYH010073296.1 737 LMDAQVTQTPRYLVKRRGEKVVIECMQNMDHERMFWYRQDPALGLRLLHFSIDVDVLEEGDVPYGYSVSRTKKKSFPLTLESATTNQTAMYLCASSE
Capra aegagrus V966 trbv CBYH010073297.1 21590 SMDTEVTQRPSHLIKGKDQKAKMDCVPKEGHPYVYWYRKKLEGAFEFLVYFQNQDTMEDTVEFKQRFSAECPQNSPCSLEIKSTEAADSALYFCASSQ
Capra aegagrus V967 trbv CBYH010073297.1 17141 PMDAEIYQIGFLLAEAGQDVTLECKRNLGYSAMYWYQQDPGQGLKLTYYSTLETDIQRGDLSEGYSVSREKKELFPLTVKSAHTKQTAVYLCSG
Capra aegagrus V968 trbv CBYH010073297.1 11605 SMDTGVTQTPRNRIAVTGKSTVLECSQTKGHESMYWYRQDPGRGLRLVYSSYDINGINKGDVSAGYNVSRKEKAKFSLYLEPATPNQTAIYFCASSI
Capra aegagrus V969 trbv CBYH010073297.1 5251 FTDADVYQTPRHCVTGTGRKITLECSQTMGHDNMYWYQQDPGMELQLIHYSYGVNTTEKGERSSRSTVSRISKEHFPLTLETASSSQTSSYFCASSD
Capra aegagrus V970 trbv CBYH010073297.1 3320 LEDAAVIQFPRHRILKAEKEFTLQCSQKMNHYAMYWYRQDPGFGLQLIYYSTGPDTFKKGDVPEGYHVSRDELDHFPLTLKSASPNQTSVYFCA
Capra aegagrus V971 trbv CBYH010073298.1 6365 SMDTEVIQSPGHLVKGKDQKAKMDCVPIKGHVHVYWYRKKPEGAFEFLVYLQNQDIVEDTEVFQQQFLAQWPQNSPCSLEIKSTKAADSALYFCASSQ
Capra aegagrus V972 trbv CBYH010073298.1 2452 SMDTEVTQSPSHLVKGKGQKAKMDCVPIKGHINVYWYRRKLEEALEFLVYLQKQDIVEDTEVFKEQFSAQCPQNSPCSLEIKSTKAADSALYFCASSQ
Capra aegagrus V973 trbv CBYH010073299.1 923 SMDTEVTQSPSHLVKGKDQRAKMDCVPKKGHSYVYWYRRKLEEALEFLVYLQDEKIIEDTDMFKQRFSAECPQTSPCSLGIKSTKASDSALYFCASSQ
Capra aegagrus V974 trbv CBYH010073300.1 16170 GSGLGAVISQQPRRAVSKSGASVTIECRAVDFQATTVFWYRQFPKRGLVLMATSNAGTDATYEQGYNKDKLPISQPNQTFSSLMVMNVDPADSSLYFCGAR
Capra aegagrus V975 trbv CBYH010073300.1 9499 SMDTEVTQSPSHLVKGKDQKAKMDCVPIKGHSYVYWYRKKPEGAFEFLVYLQNQDVVEDTAMFKQQFSADCPPNSPCSLEIKSTKAADSALYFCASSQ
Capra aegagrus V976 trbv CBYH010073300.1 4168 SMDTEVTQNPSHLVKGKDQRAKMDCVPIKGHSNVYWYRKKLEAFEFLVYLWNGKITEDTAMFKQRFSAECPQNSPCSLEIKSTEAPDSALYFCASS
Capra aegagrus V977 trbv CBYH010073301.1 3105 TVAGEVTQTPKYLLKKEGGAVTLECEQDFDYDSMYWYRQDPGLGLRRIFFSQVVKDVQEEDIAKGYSASREKKPFFPLTVTSAQKNQTALYLCAASR
Capra aegagrus V978 trbv CBYH010073302.1 66900 HTGAGVVSQSPRHRVAGRGQNVTLRCDPISGHISLYWYRQTLGQGPEFLTYFQNEQELDKSGMPKNRFSAKRPQSTYSYLNIQPAEPGDSAVYLCASSP
Capra aegagrus V979 trbv CBYH010073302.1 54789 PLEAEVTQTPRHLIKTKGQTATLRCSPMSGHSSVSWYQQARSQGPQFLFEFYETLQRDKGNFSNRFSAKQFRDFSSELNVNFLELTDSALYLCASSL
Capra aegagrus V980 trbv CBYH010073302.1 49798 HTRAGVVSQSPGYRVTGRGQNVTLRCDPIPGHQVLYWYRQMLGQGPEYLTYFQGKEEPDKSGMPKNRFSAERPESTYSYLKIQPVEPKDSAVYLCASSP
Capra aegagrus V981 trbv CBYH010073302.1 27467 TTDANLGVTQTPRHEVTEKGQAVTLSCEPIKSHTALYWYRQTSVRGLELLIYFRSEAPVDESGMPKDRFSAKMPNASFSTLKIQPTDPGDSATYLCASSK
Capra aegagrus V982 trbv CBYH010073302.1 12007 PTDAGVTQTPRHEVTEKGQAVTLSCEPIKSHAALFWYRQTSVRGLELLIYFNNQSPVDESGMPKDRFSAKMPNASFSTLKIQPTEPGDSATYLCASSK
Capra aegagrus V983 trbv CBYH010073302.1 9518 CISAEVAQSPSHRVIEKKQAVNLSCDPVSGHNSLFWYYHAVGTEMKLLIYFLRESVQDNSGMPKGRFTAERTQGTSSTLRVHSAELGDSGVYFCASSR
Capra aegagrus V984 trbv CBYH010073302.1 7184 HVGAMVIQNPRYLVTGLGKPVTLSCSQDMKHDVMYWYQQKPSQAPKLLLYYYDKEITREKNTSENFQSSRPNTSFCSLDIRSAGLGDSAVYLCASSR
Capra aegagrus V985 trbv CBYH010073302.1 2116 FLEAEVTQTPGHLVQGKGLEVEMYCVPKKGHIYVFWYQQILAKEFKFLISFQNDKVLDDKEMPKKRFSAKCPSNSPCSLKIQPAEPQDSAMYFCASSD
Capra aegagrus V986 trbv CBYH010073303.1 1265 LVDSGVTQIPKYLIKSRKQQVTLRCSPESGHRYVSWYQQALGKSPQFLVQYYDGKVRTKGNMPDRFSGEQFSDSRSQMNLSALELTDSAMYLCASRQ
Capra aegagrus V997 igkv CBYH010079481.1 1590 SSGDVVLTQTPLSLSVIPGGTVSISCKSSQSLKYSDGKTYLYWFQHKPGQSPQQLIYQVSNHNTGVPDRFTGSGAETDFTLTISSVQAEDAGVYYCFQATYIDP
Capra aegagrus V998 igkv CBYH010079482.1 3934 SNGAIVLTQTPRSLSVIPGETASISCRASQSVQNRYGDNFLHWYVQKPSQSPQLLIYAASNRASGVSDRFTGSGSGTDFTLKISRVEAEDAGVYYCQQSKETP
Capra aegagrus V1026 trav CBYH010092329.1 4291 IMVDVEITQLSSMDCAEGEDVNLPCNHSTIDALDYIHWYRQTPNQSPQYVIHGFRDTVNSSMSSLNIASDRKSSTLVLSQVTLRDTAVYYCVLRE
Capra aegagrus V1027 trav CBYH010092330.1 921 MNGQQIKHFPEFLLLQEGENFTTYCNFSSTFYNLQWYKQRPGGSPVLLMILAKGGEVKTQQRLTVRFGESRQHSSLHLMGTQPSDVGTYFCAA
Capra aegagrus V1028 trdv CBYH010092333.1 30083 SGVAQRVIQDQLDISGQLGQSVTLNCRYATTWSYYYVFWYKLLPSGEMIYLISQVSSGQNARNGRYSVNIQKAQKSISLTISDLQLEDSAEYFCAFWE
Capra aegagrus V1029 trav CBYH010092333.1 16362 VRGVDVEQSPPALTPQEGASSTLWCNFSTLADIVRWYLQKPGGRLIHLIYIPSGTRQEGRLNATAVPKERRSSLHISSLRTTDSGTYFCAVWHSAPQ
Capra aegagrus V1030 trdv CBYH010092333.1 3333 YSVAQQVTQVQTAVPSQVGQTVTLNCRYEVSWTTAFYYIFWYKQLPRGEMTLLIRQYSEHGNTRNGRYSVNLQKAHKSLSLIISALQLEDSAKYFCALWE
Capra aegagrus V1031 trav CBYH010092336.1 2909 GTGAQLVTQPDGHINVSEGNRLELRCNYSYGGSIYLFWYVQYPSQGLQFLLKYLSGPTRVKGIKGFEAEFRNDENSFHLMKASAHWSDSAKYFCALC
Capra aegagrus V1032 trav CBYH010092337.1 1627 NVIDAKTTQPSSMDYAEEEDVTLTCSHSTIGGNDYIHWFRQNPNQSPQYVIHGLRGTGNSSMASLTIDSDRKSSTLVLPQVTLRDATVYYCIVRE
Capra aegagrus V1033 trdv CBYH010092338.1 4526 SGVAQKVTQDQSDVSSQVGQSVTLNCRYETSWGAYYLFWYKQLPSGQMTYLIQQYSGYSNARNGRYSVNFQKADKSISLIISSLQLEDSAKYFCALSV
Capra aegagrus V1034 trdv CBYH010092341.1 607 SGVAQKVTQDQPDISSQVGELATMNCQYETSWSSYNIFWYKQLPRGEMIYLIGQNSYSPNARDGRYSINFQRSRKAISLIISALKLEDSAKYFCALWE
Capra aegagrus V1038 trav CBYH010094358.1 13485 ILGDSKTTQPNSVEGTEEDPVHLPCNHSTISGPEYIYWYRQIPRQGPEYLVHGLNNNVTNRMASLSIAKDRKSSTLVLPQVTLRDTAVYYCILRE
Capra aegagrus V1039 trav CBYH010094358.1 5450 VSAQQLNQSPQSMSIQEGEDLSMNCNSSSTLNLLLWYKQDAGEGLILLIKLLKGGELARNGKLTAQFGGTRKDSLLNNSAFEPKDGGTYFCAG
Capra aegagrus V1040 trav CBYH010094360.1 22521 VLGDSKTTQPNSVEGTEEEPVHLPCNHSTISGSEYVYWYRQIPRQGPEYLVHGLNNNVTNRIASLSIAKDRKSSTLVLPQVTLRDTAVYYCILRE
Capra aegagrus V1041 trav CBYH010094360.1 15367 LRVQMKVEQSPRVLTLQEGRNSSLICNYSISMTSVQWFQQNPDGRLISLFYIASGMQQKGRLKSTINSKERYSQLYIRDSQPGDSATYFCAVE
Capra aegagrus V1042 trdv CBYH010094360.1 5387 SSMADKVTQAQTTVTGQEGEAATIGCTYETSRTYYTLFWYRQFPGGRMEFLIYQDSNQANARRDRYSVNFQKGKKTISLTISSLHLADSAKYFCALWE
Capra aegagrus V1043 trav CBYH010094361.1 16576 LSVQMKVEQSPGVLTLQEGRNSSLICNYSISIRSVQWFQQNPDGRLISLFYIASGMQQKGRLKSTINSKERYSQLYIRDSQPGDSATYFCAVE
Capra aegagrus V1044 trav CBYH010094362.1 4379 ESTQQLEQNPKFLRIQEGGNVTVYCNSSSTFTVFQWYRQKPEEGPVLLVTLTKPKEVKEQKRIRAEFGEARKDSSLLITAAQPGDAGTYLCAG
Capra aegagrus V1046 igkv CBYH010095149.1 17308 ARCDIQVTQSPSSLSASLTERVSITCRTSQSVSNYLNWYQQKPGQAPKLLIYYATRLHTDVPSRFSGSGSGTDYTLTISSLEADDAATYYCLQGYS
Capra aegagrus V1047 igkv CBYH010095149.1 1737 ASGEAVLYQTPAYIAVPLGESISITCRANQSISDYLSWHKQKPGQAPMILIYDADNRRNGVPERFTATQSGTDFVFTISQIEADDAAMYYCQQSYVFP
Capra aegagrus V1048 igkv CBYH010095152.1 9226 SSGDVVLTQTPLSLSVIPGETASISCKSSQSLVHSDGKTYLNWIKHKPGQSPEGLIYQVSNRYSGVSDRLTGSGSGTDFTFTISRVQAEDAGVYYCYQGTEAP
Capra aegagrus V1049 igkv CBYH010095154.1 497 SIGAMMQTQTLRSLSVIHGEKASISCRASQSIQNRYGYNFLHWYVQKPSQSPQLLIYRASNWESGVPDRFTSSGLGADTILIVSRVEAEDAGVYYCQQSLQ
Capra aegagrus V1051 trdv CBYH010095416.1 5476 SSVSQKVTQYQPDITSQARNVVILNCRYETSWNVYTCWIFWYKQLPSGEMTYLIPQYSADGNERDGHYSVNFQKAHKFISLTISSLKLEHSGKYFCTLWE
Capra aegagrus V1052 trav CBYH010095419.1 4677 TVINAKTTQPSSMDCAEGEDVNLPCNHSTVGGNDYIHWYRQNPNQSPQYVIHGLRGTVNGSMASLPIALDRKSSTLVLPQVTLRDAAVYYCVLRE
Capra aegagrus V1053 trav CBYH010095419.1 1685 VRGVDVEQSPPALSLQEGASYTLQCNFSTFPQSVNWYLQNPGGRIIHLFYIPSGTKQDGRLNATTVPKDGHSSLHISSSQTTDSGTYFCAVQHSAP
Capra aegagrus V1054 trdv CBYH010095422.1 1000 SGVAQKVTQDQSDVSSQVGQSVTLRCWYETSWSVYYLYWYKQLPSGQMTYVIRQGSEVTNARKERYSVNFKKADKSISLTISALQLEDSAKYFCAVSV
Capra aegagrus V1057 trdv CBYH010096863.1 5002 SSVAQRVTQNQPDISTQVGEIVTLSCRYETIQSRYNIFWYKQLPSGEMIYLIGHDSSSQNARYGRYSVNFKISRKFISLTISDLQLVDSAKYFCTLWK
Capra aegagrus V1058 trdv CBYH010096865.1 4907 SGVAQSVTQDQPDILSEVGKTVTLNCQYEIRWDMFYYYIFWYKQLPSGQMTYLIRQYSDDGNARDGRYSVNFQKADKSISLTISALELEDSAVYFCALRV
Capra aegagrus V1059 trav CBYH010097794.1 5199 GTNGDSVTQTEGPVTVSEGALMTLNCTYQATYSNVYLFWYIQHLNKAPQLLLKGSMTEQKPKREGFQATLVQSDRSFHLQKRAVQASDSAVYYCALS
Capra aegagrus V1060 trav CBYH010097802.1 1282 GTSGDSVTQTEGVVILPEKASLTLKCTYQSSYSDILFWYVQYKNKQLELLLKSSLGDQKVTSRGFEATHISSDSSFHLQKSSVQTSDSAGYYCALS
Capra aegagrus V1062 trav CBYH010099246.1 13652 VKSDGDVMQSPSSLIVLEGSNATLSCSYKVTNFQSLHWYKQEEKVPTFLFALISTGIEKTSGRLRGTLDRKELLSTLHITVTKPGDSATYLCAVE
Capra aegagrus V1063 trav CBYH010099246.1 7476 LRRADWIRSQESEVSGAEGKTVSLFCNYYTSSRSFVSLFWYRQYPNQAPEYILYRQWGSSGKGYASFATERFYSDNTANTTNLYIRKVVPVDTALYLCALE
Capra aegagrus V1065 trdv CBYH010099823.1 1109 SGVAQRVIQDQPDISSQLGQSVTLNCRYGTTWSSYYLFWYKLLPSGEMIYLIHQVSSGQNARNGRYSVNFQKARKSISLTISDLQLEDSAEYFCALWE
Capra aegagrus V1066 trav CBYH010099857.1 2075 VNSQQGEQNLQTLSIQEGENITMNCSYKSITITALQWYRQDSRRGFVHLILMRSNERQKHSGRLLFTLDSSIQSSSMSIMASQAEDTATYFCAP
Capra aegagrus V1067 trav CBYH010099858.1 5449 RTRAQTVTQPESHISVSKGDPVQVKCSYSYSGSPVLFWYVQYSRQHLQLLLKHTSRENIQGFTAELSRAEASFHLKKPSAQEGDSAVYYCALG
Capra aegagrus V1068 iglv CBYH010100232.1 2737 SRAQAVLTQPSSVSRSLGQRVTITCSGSSSNTGGNFVGWCQQLPGMAPKTLIYGDSNRPSGVPGWFSGSKSGNSASMTIASLQAKEEAGYYCLSWDDSLNC
Capra aegagrus V1069 trdv CBYH010100360.1 756 SGVAQKVTQDQSDVSSQLGQSVTLNCRYETSWSTYYLYWYKQLPSGQMTYVIRQGSQVTNARKDRYSVNFKKADKSISLTISALQLEDSAKYFCALSV
Capra aegagrus V1070 trav CBYH010100370.1 589 LSGEDRVEQSPQTLRIQEGDSLSLNCSYTVSRFSGLQWYRQDPGKGPELLFLLYSVGDEKQEERLRATLLKKGSSLHIEAPKPEDSATYLCAVE
Capra aegagrus V1071 trav CBYH010100452.1 1694 MNGQQIKHFPEFLLLQEGENFTTYCNSSSLLSSLKWYKQRPGGSPVLLIILAKSGEVKTQQRWTGRFGESRPHSSLHLTAAQLSDAGTYFCAEA
Capra aegagrus V1072 trdv CBYH010100454.1 495 SCVAQKVTQNQPDISSQAGQSVTLNCRYETSWTYYYLVWYKQLPSGQMTYLIQQYSENSNTRNGRYSVNFQKADKSISLIISSLQLEDSAKYFCALCD
Capra aegagrus V1073 trav CBYH010100455.1 1526 MNGQQIKHFPEFLLLQEGENFTTYCNSSSTFYNLQWYKQSPGGSPVFLMILTKPGEAKTEQRLTGRLGETRQHSSLHLAATQLSDAGTYFCAEAQCSG
Capra aegagrus V1074 trdv CBYH010100481.1 2008 SCVAQKVTQEQSDIIRQVGQSVIFDCQYGIGWFTYYYSIYWYKQLPRGQMTLLIHQHSEHGNAANGHYSVNFQKAYKSISLTISALQLEDSAKYFCALRELSS
Capra aegagrus V1076 trav CBYH010101443.1 2040 TVIDAKTTQPNSMDCAEGENVYLPCNHSTIGGDEYVHWYQQNPNQSPQYVIHGLRGTVNGSMASLTIASDRKSSTLVLPQVTLRDAAVYYCILRE
Capra aegagrus V1080 trdv CBYH010103590.1 414 SGVAQKVTQDQSDVSSQVGQSVTLNCRYETSWSAYYLYWYKQLPSGQMTYVIHQGSEVINAREDRYSVNFKKADKSISLTISALQLEDSAKYFCALRN