WGS Statistics
Organism WGS Record. Vs Total IGHV IGLV IGKV TRAV TRBV TRGV TRDV
Cavia aperea AVPZ00000000.1 (AVPZ01) 186 61 32 18 50 10 7 8
Vgene Table
Organism Vgene Locus contig Contig Pos. AA sequence
Cavia aperea V524 igkv AVPZ01000311.1 355288 GTCDIQLTQSPSILYASPGDKITITCRASQGISSYLGWYQQKPGNAPKLLIYDSYNLYAGVPAKFSGSGFGTDFTLTISSLEREDSAIYYCQQ
Cavia aperea V74 igkv AVPZ01000073.1 1655560 STGDVVMTQTPLSLSITPGEPASISCRSSQSLLSSNGNTYLHWVVHKPGQAPHGVIYLVSYRYSGISDRFSGSGSGTDFVLKISKVEAEDAGVYYCVQS
Cavia aperea V101 trdv AVPZ01000111.1 28480320 ARTQVVQVNDSMYGFIGTDVVLHCSFANPVPSVKITQVTWQKSTNGSKQNVAIYNPAMGVSVLAPYRERVQFLRPSFTDGTIRLSRLELEDEGVYICEF
Cavia aperea V131 igkv AVPZ01000167.1 10514011 GRCDIQLTQSPSVSASLGERVTITCQARQDISIFLHWYQQKHGKTPKLLIYGASNLQSGVPSRFSGSGSGTDFTLTISSVEPEDVATYYCQHNYGIP
Cavia aperea V148 iglv AVPZ01000200.1 17865253 RIPAEVTQESSLYISPGGTVTLTCASSTRAVTTSNCAAWVQQKPSEKPKGLIYATSNQNSGVPARFSGSLFGDKAAFTITGAQTEDEATYYCALWYSNH
Cavia aperea V175 igkv AVPZ01000311.1 377176 ARCDIQLTQPPSASASVGDTVKISCRASQSVGSYLNWYQQKPGQAPKPLIYRATNLQSGVPSRFSGSGSGTDFTLSVSGLQPEDFATYYCQQHNSLP
Cavia aperea V176 igkv AVPZ01000311.1 393842 ARCDIQLTQPPSASASVGDTVKISCRASQSVGSYLSWYQQKPGQATKPLIYYATSLASGVPSRFSGRGSGTDFTLSISGLQPEDFATYYCQQHKSLP
Cavia aperea V177 igkv AVPZ01000311.1 1055624 TSGSVALTQSPAFLSVTPGESVSITCRASASISDDLNWYQKKPGESPKILINDANNRYAGVSDRFIGIYSGTEFTFKISRVETGDAGTYYCQQDY
Cavia aperea V178 igkv AVPZ01000311.1 1322627 ARCDIQMTQSPSSVSVSLGDRITITCKASQNTHSSLVWYQQKPGKPPTLLIYGASRLASGVPSRFSGSGSGTDFTLAISGVKAEDVATYYCQQHSSSP
Cavia aperea V179 igkv AVPZ01000311.1 1744859 SRGQIVLTQSPASLAASPGEKVTITCTARSSVSTSYLHWYQQNPGSSPKLLIYETSKLASGVPARFSGSGSGTSYWLTISNVEAEDFATYYCQQSSS
Cavia aperea V180 igkv AVPZ01000311.1 2123110 VCSDIVMTQSPASLAVSPGESATIHCKSSQSLLSSGDNKNYLVWLQQKPGQSPKQLIYLASTRETGVPDRFSGSGSGTDFTLTISGVQAEDVADYYCMQDYSAP
Cavia aperea V181 igkv AVPZ01000311.1 2369933 VSGDNVVIQSPGSLVLSVGESATIHCKSSQSLFSSAYKVNYLSWYQQKPGQSPKLLIYYASTRASGVQDRFSGSGSGTDFTLTISSLQAEDAGSYYCQQNYDTL
Cavia aperea V182 igkv AVPZ01000311.1 3114103 STADVLMTQTPLSLIIAPGEPASMSCRSSQSLLHSDGKIYLSWVVHKPEQAPQGIIYQVSKHESWTPERFSGSGTGTDFTLDISTVEAEDAGVYYCLQG
Cavia aperea V183 igkv AVPZ01000311.1 3181025 SSGDVLMTQTPHSLSVTPGEPATISCRSSQSLLYSNGLTYFNWLVQKPGQVPRLIIYEVSKRDSWVSDRFSGSGSWTDFTLKISRVEAENAGVYYCQQG
Cavia aperea V184 igkv AVPZ01000311.1 3262819 STGDVVMTQTPLSLSIAPGEPASISCRASQSLLHSDGKTYLSWLVQKPGQAPRRMIYQVSKRDSWVSDRFIGSGSGTDFTLKISRVEAEDAGVYYCLQG
Cavia aperea V185 igkv AVPZ01000311.1 3329519 STGDVLLSQTPLSLSITPGEPASISCKSSQSLLQSDGNTYLHWVVHKPGQAPRGMIYWVSNRESGTPERFSGSGSGTDFTLKISKVEPEDSGIYYCYQG
Cavia aperea V207 iglv AVPZ01000445.1 19993079 YGTQPVLYQPPSASSPLGTAVRLTCTLRSDHNIGFYSIFWYQQRPGQPPRFLLRYFSYLDKHQGPKVPPRFSGSKDVSRNQGYLSISELQPEDEAIYYCAVG
Cavia aperea V243 igkv AVPZ01000663.1 18148 STGDVVMTQTPLSLSVSPREPASISCRSSQSLLYSDGDTYLHWLVHKPGQAPRAMIYEVSEKYSWTPERFTGSGSGTDFTLKISRMEAEDAGVYYCVQN
Cavia aperea V287 ighv AVPZ01001775.1 2972 VQAEVQLVESGGGLVQPEGSLRLSCVTSGFTFSNYYMHWIRQAPGKGLEWVGLIRNAAKSHTTEYAASVKGRFTISRDDSKSTLYLQMTKLKPEDTAVYYCAG
Cavia aperea V304 trbv AVPZ01000012.1 6598791 HMAPGVKQTPSHKITEVGLAVTLSCDPISGHQYISWYRQTAEKGMEFMVYLIDKNPTEMADFFTDRFSAEKVRSEFIMKIQPVQLEDSAVYLCASSE
Cavia aperea V305 trbv AVPZ01000012.1 6549383 YMAPGVKQTPSHKITEVGQPVTLRCDPIAGHPYVYWYRQTAEKGMEFVAYIYNEDDTEKADFFRDRFSVEKPEGSYSNLNIQPVQLGDSAIYLCASSL
Cavia aperea V306 trbv AVPZ01000012.1 6528165 HMAPGVKQTPSHKITEMGQPVTLWCDPISGHEDIYWYRQTAGKGMEFMLYLYRNSTMQKADFFKDRFSALKFASSFIMKIQPVHLGDSAMYFCASSS
Cavia aperea V307 trbv AVPZ01000012.1 6493614 HMETGVKQTPSHKITYWHVTLWCDPISGHPSICWYRQITEKDMAFMSYPFNKTAMDKADFLKDRFSAEKPEGSYSNLKVEPMQLGDSAMYLCASSQLQ
Cavia aperea V308 trbv AVPZ01000012.1 6164823 PGNAGITQIPVSQVLKTGQHMTLSCVQQLNHERMYWYRQDPGLGLRLIYYSYGTNITEKGEFSDGYSVSRPSRENFLLTVQSANPSQTSMYFCATSD
Cavia aperea V309 trbv AVPZ01000012.1 6054761 TVDSGITQIPKFRIIKKGQSVTLRCEQKLNHNAMYWYRQDAGQGLRLIYYSPITPDTQKEDVTESYSASREKKEIFLLTMESTQRNQAAVYLCASSR
Cavia aperea V310 trbv AVPZ01000012.1 6024384 SALGVLVLQHPSRVICHSGSSVKIECRFVDLQALTVIWYRQFPKQGFTRIAISTEGSGVAYEQDVTEAKFPISPPNQTYSSLTVTTTNPKDSSFYFCAAS
Cavia aperea V312 trbv AVPZ01000012.1 6011235 LSDNEVIQTPRHLIKWKGQRANMSCVPKKGHTAVYWYQQKQNKELNFLIYFLNSRDMNKMDRFEDQFSAECSQDSHCRLEIKSSEPEHSALYLCASSE
Cavia aperea V313 trbv AVPZ01000012.1 6007379 FSDDTVTQRPTHLIKWKGQKANMSCVPKKGHNAVYWYQQKQSNELKPLIRFQNREPLEEIDRFKDLFSATCPKDLPCSLEIKSSERNNSALYLCASSE
Cavia aperea V314 trbv AVPZ01000012.1 5964293 RTETQVIQTPRYLIIETGKNKMMTCFQNMSYDTMYWYRQDPGLGLKLIYFSLNVGVTEKGEVSDGYSIYRKDKQNFFLTVEKARTSQTSVYLCAGST
Cavia aperea V338 trav AVPZ01000045.1 20152385 TGSLAKTTQPFSMDSYEGQEVNLSCTHPDIATSDNIMWYRQVHHQGPQFVIQGYKTDVANEVASLFIPNDRKSSTLSLPRVALRDTAVYYCIVAE
Cavia aperea V339 trav AVPZ01000045.1 20102920 LKGETQVEQRPRTLEPQEGDIISMSCTYPVSIFKGLLWYRQDEGLGLQHLFSMYSAGDVKQKGRLRATLLKNGSSLSITASEPEDSATYFCAV
Cavia aperea V340 trav AVPZ01000045.1 20050651 TGSLAKTTQPFSMDSYEGQEVNLSCTHPDIATNEYIFWYRQIHLQGPQFVIQGYKTDVANGVASLFIPKDRKSSTLSLPRVALQDTAVYYCVVAD
Cavia aperea V341 trav AVPZ01000045.1 20033174 LSGGEQVEQHPSFKSVLEGDTSVINCTYTDSAFSYFYWYKQEPGAGLQMLINIFSNTASKQDGRFIVFLNKKDKHLSLNITAAHPGDSASYFCAA
Cavia aperea V342 trav AVPZ01000045.1 19991263 GRAEQLEQLPRTLRVQEGDTSVINCTYSDSGSSYFPWYKQEAGKGPQLVIDIRSNAVSVQKRRLLVSFSKTAKQVSLHITDIQPGDAAMYFCAAS
Cavia aperea V343 trav AVPZ01000045.1 19936210 GRAEQLEQLPRTLRVQEGDTSVINCTYSGSGSFYFLWYKQEAGKGPQLVIDIRSNAARAQKGRLLVSFSKTAKQVSLHITDTQPGDAAVYFCEAS
Cavia aperea V344 trav AVPZ01000045.1 19915645 TGSLAKTTQPISMDSYEGQEVNLSCTHPDIATNENIIWYRQVHLQGPQFVIQGYKTDVANEVASLFIPKDRKSSTLSLPRVALRDTAVYYCIVAE
Cavia aperea V345 trav AVPZ01000045.1 19898614 GRAEQVEQLPRTLRVQEGDTSVINCTYSDSASNYFPWYKQEAGKGPQLVIDIRSNAVSMQKRRLLVSFSKTAKQVSLHITDTQPGDAAMYFCAAS
Cavia aperea V346 trav AVPZ01000045.1 19845609 AVSGDSVTQTEDRMTLFERDSLTVNCSYDNTQYPNLFWYVQYPGEGLQLLLKARTANEQGRNKEFEATYDKATGSFHLEKASVKESDSAVYYCALR
Cavia aperea V347 trav AVPZ01000045.1 19834809 VSSQQKEVEQSPEFLRVPEGDSAHFNCTYSNSASQNFGWYRQYPGKGPELLISIYSSGDKKEGRFTAQLSTASRHFSLHIQSSQHPDSAAYFCAL
Cavia aperea V348 trav AVPZ01000045.1 19812567 VRGMQVEQSPPAQILQEGTSFTLSCNFSDTVTNVQWFRQDSEGHLVNLFYVPSGTKKNGRLQATTVPKERHSSLSIFSSQLTDSASYFCAAAH
Cavia aperea V349 trav AVPZ01000045.1 19789118 VSSQQKEVEQSPETLSVPEGDTASLNCTFRNSASTNFRWYRQYPGKRPELLISIFSDGDQEEGRFKAQLSRANRRVSLHIGASQSLDSATYFCAV
Cavia aperea V351 trav AVPZ01000045.1 19713644 SSIAQKVTQAQPPVSVEEAEAVILHCTYDTSESRYSLFWFKQPSSGEMVLLIRQNSYDTQNATEGRYSSHFQKAHKSIHLIISASQLEDSAVYFCALSE
Cavia aperea V353 trdv AVPZ01000045.1 19698558 NTLAQKVIQGQTTLSSSEGTAVVLVCSYETRVATYDLFWYKQLFSGEMVLLNQHSSSSNNSNTGRYSVNFRKEAKTISLTISPLQMEDFAKYFCSFWE
Cavia aperea V354 trav AVPZ01000045.1 19649549 GSGAQSVAQPDRHVTVAEGHALLLKCNYTYGATPSLFWYIQRPGQGLQLLLKYLGGSSVVTDNRGFKAEFKKSETSFHLQKSSAQGSDVAMYFCAMS
Cavia aperea V355 trdv AVPZ01000045.1 19639418 SSVAQKVTQVQPLTSRPEGEAVTLYCSYETTWNLYYLDWYKQLSSGEIVFIISQYSLDSNAKNGRYSVNFQSAAKSISLTISALQMEDSAKYFCA
Cavia aperea V356 trav AVPZ01000045.1 19597557 VSSQQKDVEQSPETLIVPEGDTADLNCTYRDSSSNNFRWYRQYPGKGPELLISIFSDGDQEEGRFKAQLNKANRRVSLHIGASLSLDSATYFCAVS
Cavia aperea V357 trav AVPZ01000045.1 19545019 VRGAQVEQSPSILSLQEGANITLRCNFSTTTNTVHWFRQNARGGLVTLFLMSPGTKQAGRLDLTFNFKERSSTLHITASKLGDSGFYLCAVEAQC
Cavia aperea V358 trav AVPZ01000045.1 19538468 SSIAQKVTQAQPPVSVEEMETVILQCTYDTSDTSYSLFWYKQPSSGEMVLLLRQNSYDTQNATAGRYSSHFQKAHKSIYLIISASQPEDSAVYFCALSD
Cavia aperea V359 trav AVPZ01000045.1 19525096 VSSQQKGVEQSPETISVSEGDSVDLNCTYSDRNFQTFIWYRQYPGKGPEFLMSLYSSGDRKEGRFTAQLSTASRHFSLHITDSQHHDSAAYFCAMS
Cavia aperea V360 trav AVPZ01000045.1 19511418 GSGAQSVAQPDRHVTVAEGHALLLKCNYTYGATPSLFWYIQRPGQGLQLLLKYLGGSSVVTGNRGFKAEFKKSETSFHLQKSSAQGSDAAMYFCAVS
Cavia aperea V361 trdv AVPZ01000045.1 19485428 PSVAQKVTQVQPVTSGRQGETATLDCEYETRWSSDTLWWYKQLPSGEMVLLIWSTSGQTKKAGRYSFKFPKANSMSFIISGLQMEDSAKYFCAIRR
Cavia aperea V362 trav AVPZ01000045.1 19422597 ISSQQKEVEQSPETLSVSEEHTASFNCTYRDSGSYAFRWYRQYPGKGPELLISIYSDGDQEEGRFKAQLNKANRRVSLHIGACQSLDSATYFCAV
Cavia aperea V363 trav AVPZ01000045.1 19372928 SVTQTQGQVTLSDRTALTVNCSYETKTTQYLVLSWYVQYPREGPQLLLKATKDKEKGSNKGFEATYDKETSSFHLKKASVQASDSAVYYCALS
Cavia aperea V364 trav AVPZ01000045.1 19346938 FSIAQKVTQAQPPVSVEEMEAVILHCTYDTSDTGYSLFWYKQPSSGEMVLLLRQNSYDTQNATAGRYSSHFQKAGKSIHLIISASQLEDSAVYFCALSD
Cavia aperea V365 trdv AVPZ01000045.1 19320158 HTVAQKVTQGQTALSRPEGTAVVLDCSYKMSVALYDLYWYKQLFSGEMVLLIHQSYTGNNPHTGRYSVNFQKEAKTISLTISPLQMEDFAKYFCAFRE
Cavia aperea V366 trav AVPZ01000045.1 19295001 FSIAQKVSQAQLPVSVEEMEAVILQCTYDTSYSDTSYSLFWYKQPSSGEMVLLLRQNSYDTQNATEGRYSSHFQKAHKSIYLIISASQPEDSAVYFCALSD
Cavia aperea V367 trav AVPZ01000045.1 19282480 GSRAQSVAQPDHHVTVAEGHALLLKCNYTYSATPYLFWYVQRPGQGLQLLLKYFGGSSVVTGNRGFKAEFKKSETSFHLQKSSAQGSDAAMYFCALS
Cavia aperea V368 trav AVPZ01000045.1 19273656 WSYGDSVTQTEGPVILPERAQLTLNCTYQTTYSVTFLYWYVQYSSTAPRLLLRSATDNQPAENRGFQATLAKSQRSFPLQKPSLQLSDSATYYCALG
Cavia aperea V369 trav AVPZ01000045.1 19244640 ISGQQVKQIPQFWRIWEGENFTAYCNSSGTFNTLLWYKQKPGGHPVLLVRLVKGGEVKEQDRLTTQFGERRQDGSLHITATRGSDVGTYFCAT
Cavia aperea V370 trav AVPZ01000045.1 19234716 GSGAQSVAQPDRHVTVAEGHALLLKCNYTYGGAPSLFWYVQRPGQGLQLLLKYLGGSSVVTGNRGFKAEFKKSETSFHLQKSSAQGSDAAMYFCALS
Cavia aperea V371 trav AVPZ01000045.1 19226255 DQQQVKQNPPYLTVQEGETSILNCTYENSAFNYFAWYRQLPRGKGLELLIAIRSVVNENEDGRFKVLLKKNDQELSLHIRTSQLGDSATYFCAAG
Cavia aperea V372 trdv AVPZ01000045.1 19209517 FSVAQKVTQVQSPTSRPEGETATLDCSYETTQDSYFLHWYKQLPSGEMVFLIMQYSSHSNAKSGRYSINFQSTAKFISLTISALQMEDSAKYFCAIEE
Cavia aperea V373 trav AVPZ01000045.1 19194317 VSSLHVLEQSPSFLRVQERTLAILNCTTEGRTYLTFHWFRQNPGKELVSLTSIQSGQKEQMDRYFKDQLRKSKAYSVLNLPSPQLGDSATYFCAL
Cavia aperea V374 trav AVPZ01000045.1 19124704 VRGEQVEQSPSTLSLQEGANITLRCNVSTTTNVMHWFRQNPRGGLVSLFFMSPGTKQAGRLQSTFNFKERSGTLHIAASKPGDSGFYLCAVDAQCSL
Cavia aperea V375 trav AVPZ01000045.1 19065997 RNHGDSVTQTEGPVTLTELETLILNCTYQTIYSGPVLFWYVKYMDKAPQLLLRSATETKTENHGFQATLIKSRSSFHLQKPSLELSDSAVYYCALG
Cavia aperea V376 trav AVPZ01000045.1 19047410 MRGQQVKQIPRFWHVWEGENFTAYCNSSGTLNSLQWYKQKPGGRPVLLVRLMTGGEVKEQDRLITRFGERRQDGSLHITATRGTDVGTYFCAA
Cavia aperea V377 trav AVPZ01000045.1 19034518 EGGAQSVAQPDRHVTVTEGHPLVLKCNYTYGATPYLFWYIQQPEKDLQLLLKYVPGSSVVISNRDFKAEFKKSETSFHLQKSSAQWSDAAMYFCALS
Cavia aperea V378 trav AVPZ01000045.1 19010055 TGSLAKTTQPFSVDSYEGQEVNLSCTHPDIATSEYIFWYRQVHHQGPQFIIQGYKTDVDNEVASLFIPKDRKSSTLSLPRVSLRDTAVYYCIVAE
Cavia aperea V379 trdv AVPZ01000045.1 18969088 SSAAQTVTQAQLALWRPEGEAVTLNCSYDTSQSSYSLYWYKQLPSGDMIFLILQNSFEQSTQSGRYSVNFQRKAKSMSLTISALQMGDSAKYFCALK
Cavia aperea V380 trav AVPZ01000045.1 18954804 VRGVQVEQSPSTLSLQEGARHALRCNFSTTMMTVQWFLQNQEGRLLNLFFLTSGTKKNGRLESTFNSKERFSTLQITASELGDAGSYFCAGEAQCSP
Cavia aperea V381 trav AVPZ01000045.1 18949625 RICGQSVTQMGGQVTTTEETLLTINCTYTASDYFEFLWHVQYPGKGPQLLLKAVKSNQREISKGFEAIYDKETNSFHLNKASVQESDLAVYYCALS
Cavia aperea V382 trav AVPZ01000045.1 18946004 GSEEESVTQTQGQVTLSDRTALTVNCSYETAVYPGLFWYVQYPGEGPQLLLKATKDKEKGSNKGFEATYDRETGSFHLKKASVQASDSAVYYCALS
Cavia aperea V383 trav AVPZ01000045.1 18932831 VRGAQVEQSPSTLSLQEGANITLRCTASTTQNTVHWFLQNPRGGLVSLFVMSPGTKQAGRLQSTFNFKERSSTLHMTAAEPGDSGFYLCAVEAQC
Cavia aperea V384 trav AVPZ01000045.1 18926086 FSIAQKVTQAQPPVSAEEMEAVILHCTYDTSEPSYSLFWYKQPSSGEMVLLIRQNSYDTQNATAGRYSLGFQKAGKSIHLIISASQLEDSAVYFCALRE
Cavia aperea V385 trav AVPZ01000045.1 18884685 GSGAQSVAQPDHHVTVTEGHALLLKCNYTHSVTPYLLWYVQGPEKDLQLLLKYVPGSSVVIGNRGFKAEFKKSETSFHLQKSSAQWSDAAMYFCALS
Cavia aperea V386 trav AVPZ01000045.1 18876280 DQQQVKQNPPYLTVQEGDTSILNCTYENSAFDYFPWYRQLPGKGLELLIAIRSVLNEKEDGRFKVFLKKSGKELSLHIRTSQLGDSATYFCAAQ
Cavia aperea V387 trdv AVPZ01000045.1 18817515 SSAAQTVTQAQSALWRPEGEAVTLDCSYDTSQSSYSLYWYKQLPSGDMISLIRQNSFEQSTQSDRYSINFQRKAKSVSLTISALQMGDSAKYFCALK
Cavia aperea V388 trav AVPZ01000045.1 18797970 RTCGQSVTQMGGQVTTTEETFLTINCTYTASGYPELSWYVQYPGKGPQLLLKAVKANQREISKGFEAIYDKETKSFHLKKASVQASDSAVYYCALS
Cavia aperea V389 trav AVPZ01000045.1 18785923 VSSQQKEVEQSPETLSVPEGGNTSLNCTYRDSLSNTFGWYRQYPGKGPELLISMYSSGDKKEGRFTAQLSTASRHFSLHIQSSQHRDSAAYFCAV
Cavia aperea V390 trav AVPZ01000045.1 18737985 KTHGDSVTQMGGQVTLSERAFLTINCTYTISTYATLFWYVQYPGQGPQLLLKAVTANEQGRNKGFEATYDKGASSFHLEKASVEESDSAVYYCALS
Cavia aperea V391 trav AVPZ01000045.1 18730812 VSSQQKEVQQSPESHSVPAGATAFLNCTFRDSDSRNFAWYRQYPGKGPELLISIYSSGDKKEGRFTAQLSTASRHFSLHIQSSQHRDSATYFCAV
Cavia aperea V392 trav AVPZ01000045.1 18703387 VNSQQAETPRAQIIQEGENASVSCSYKSMNTNLQWYRQDSRGSLALLLLMRSNEREKYRGRLKATLDASTKTSSLFISAAQLVDAATYFCAT
Cavia aperea V394 trav AVPZ01000045.1 18640411 IKAQIKVEQSPQVQIIQEKRSSSLTCNYSTSISVQWFQQTPEGRLVSLFYIASGEQQKGRLKATVNFKERYSRLYIRDSQPGDSALYFCAMQAQCSP
Cavia aperea V395 trav AVPZ01000045.1 18520512 RGKTDSITSQKTEVSSTEKKTVSLLCNYEVSSTSSIIFFWFRQYPNQAPEYILHRGWQNSLKGDASFAMGRFYSKSTANSIELYIRDLILTDTAVYYCALR
Cavia aperea V396 trav AVPZ01000045.1 18495698 VNMAQKVTQSQPEISIPEAATATLDCTYDTSDSNYYLFWYKQPPSGQMIFIIRQEAYKQQNSTEAHFSVNFQKAAKSFSLKISDSDLGDTATYFCALW
Cavia aperea V397 trav AVPZ01000045.1 18477192 ISVAQKVTQSRPELSIPETATATLDCTYDTSETNYYLFWYKQPPSGQMIFIIRQEAYKQQNATEARFSVNFQKAAKSFSLKISDSNLGDAATYFCAFS
Cavia aperea V498 trgv AVPZ01000234.1 16366136 VSQTSSNMDMGIISITRTPGSIVTITCNLRIGKSYVHWYRFREGQVPQRLLYYDFTSSRAVLDSGVRSGKYSAHQATQDSNKIVVWNVEESDSAVYYCAVWA
Cavia aperea V499 trgv AVPZ01000234.1 16359809 GSQTSFNMDEGMTVMTRSRGSYVEITCSVDTGSRYTHWYQFREGQVPQRLLYYDFSRSKAVLDSGVSAGKYDAYSGSGKSNKFVVRNVEESDSAVYYCAAWT
Cavia aperea V500 trgv AVPZ01000234.1 16356661 GSQTSSNVESGMISLIRKPGSMLTIDCDVPAGKSHVHWYQFQEGQAPHRLLYYDSSSSKAVLDAGVRSGKYSAYQVTQHSSKFVVLDVEESDSAVYYCAVWA
Cavia aperea V501 trgv AVPZ01000234.1 16351691 GSQTSSNMEMGMISVTRTPGSHLTITCDLHTEKSYVHWYRFREGQAPQRLLYYDHSSSKVMLDSGFRPGKYNAYQATWKSNKFVVRNVEESDSGVYYCAIWA
Cavia aperea V502 trgv AVPZ01000234.1 16326355 GSQTSSNMDEGMTVMTRSRGSYVEITCIVDTGSSYVHWYQFREGQVPQRLLYYFSRSKAVLDLGVSSGKYNAYRGSGKSSKLVIQNVEESDSAVYYCAAWT
Cavia aperea V503 trgv AVPZ01000234.1 16284387 VLGQLKQPEVVISRATDKSADIPCKASFSGFDGTGIYWYRQKPNEGLQYLLNVKTSTTGVNFDGKKNKFEASKNSGASTSTLKINSLEAQDEAMYYCAYWASG
Cavia aperea V504 trgv AVPZ01000234.1 16238977 GLGQLEQPELSISRAPDESVYIPCKASISNFKNVAIHWYRQKSKQGFEHLMYVWMAFNQYPLGGVNKKLEASKNYDTSTSHLKINFLKKEDEATYYCTYWD
Cavia aperea V521 igkv AVPZ01000311.1 2886452 VCGDIVMTQSPASLVVSPGESATIRCKSSQSLLYSGNNKNILSWYQQKPGQSPKLLIYWASTRASGIPERFSGSGSGTDFTLTISGAQAEDVASYYCWQGISAP
Cavia aperea V522 igkv AVPZ01000311.1 2478784 FNGQIVLTQSPASLAASPGEKVTITCIVRSSVSINYLHWYQQKAGASPKLLIYEKSELASGVPARFSGSGSGTSFSLTISNVEAEDVATYYCQQYSSY
Cavia aperea V523 igkv AVPZ01000311.1 1428814 NKCDIQMTQSPSSISASIGERVTISCRASQGINKWLAWYQQKPGKAPKLLIYNANKLESGVPSRFSGSGAGTDFTLTISSLEPEDVATYYCQQYDSSP
Cavia aperea V552 iglv AVPZ01000445.1 10896577 SFSQPVLTQPPFLSPSSGASAVLTCTLSSGSVVSGYHISWYQRKSGNHPRYLLRYYSDSNQHQGSGVPSRFTGSKNPSANAGILLISELQYENEADYYCL
Cavia aperea V553 iglv AVPZ01000445.1 10706393 SESQAVVTQESSLSISPGGTVTLTCASSTGAVTTSNYAAWVQQKPSETPKGLIYGTSNRSPGVPARFTGSLLGNKAAFTITGAQTEDEATYYCALWYSNH
Cavia aperea V554 iglv AVPZ01000445.1 10612619 SVSQPVLTQLPSASASLGQTHKLTCTLSSGYSNYNVDWYQQSQGKSPRFVMRVGTSGIVGSKGSGIPDRFSGSGSGSERYLTIQNIQEEDENVYYCGA
Cavia aperea V555 iglv AVPZ01000445.1 10481745 SWAQSGLSQEASLSGSVGQRVTLSCTGSSSNVGSYSVGWYQQIPGAAPKTVMLGTTRPSGIPDRFSGSKSGNTATLSISNLQPEDDADYYCSSWDYSQNV
Cavia aperea V556 iglv AVPZ01000445.1 10337127 SFCQPVLKQSPSASASPGGSVKLTCTLSSEHSSYYIEWYQQHPGKSPGYVMQLKSDGSHSKGDGIPDRFTGSSSGADRYLTISNIQPEDEADYFCGVGYSGG
Cavia aperea V557 iglv AVPZ01000445.1 10167264 AESQAVVTQESSLYISPGGTVTLTCASSTGAVTTSNYAGWVQQKPYERPKGLIYHTSTRNSGVPARFTGFLLGDKAAFTITGAQTEDEATYYCALWYS
Cavia aperea V558 iglv AVPZ01000445.1 9980922 FVASYVLTQPSSMSVSLRETVSLTCEGNNIGGKVVHWYQQKLPQAPMLVMYDDNSRPSKIPERFSGANSGNTATLTITGAQEEDEADYYCQVWDSNS
Cavia aperea V559 iglv AVPZ01000445.1 9958493 SVASYVLTQPSSMSVSLRETVRLTCEGNNIGDKAVDWYQQKPPQAPMLVIYSDNNRASGIPDRFSGANSGNTATLTITGAQAEDEADYYCHVWDSSS
Cavia aperea V560 iglv AVPZ01000445.1 9897224 SVASYVLTQPSSMSVSLGETARLTCEGNNIGGRRVRWYQQKPPQVPMPVIYGNNNRPSGIPDRFSGANSGNPATLTITGAQDEDEADYYCQVWDSNS
Cavia aperea V561 iglv AVPZ01000445.1 9877771 SVASYVLTQPSSMSVSLRETVRLTCEGNNIGDKAVHWYQQKPPQSPMLVMYTDKNRPSGIPDRFSGANSGNTATLTITGAQAEDEADYYCQVYDGNS
Cavia aperea V562 iglv AVPZ01000445.1 9854324 SVASYVLTQPSSMSVSLGETARLTCEGNNIGGKNVYWYQQKPPKGPMLVMYNNNRPSGIPDRFSGAKSGNTATLTITGAQAEDEADYYCQVWDS
Cavia aperea V563 iglv AVPZ01000445.1 9832041 SVASYVLTQPSSMSVSLKETVRLTCEGNNIGDKAVHWYQQKPPQSPMLVMYTDKNRPSGIPDRFSGANSGNTATLTITGAQAEDEADYYCQVYDGNS
Cavia aperea V564 iglv AVPZ01000445.1 9809286 SVASYVLTQPSSMSVSLGETARLTCEGNNIGGKYVYWYQQKPPKAPMQVMYNDNNRPSGVPDRFSGAKSGNMATLTITGAQAEDEADYYCQVWDSNS
Cavia aperea V565 iglv AVPZ01000445.1 9757041 SVASYVLTQPSSMSVSLRETARLTCEGNNIGGKYVHWYQQKPPQAPMLVIYDNNNRPSGIPDRFSGATSGNTATLTITGAQAEDEADYYCQVWDS
Cavia aperea V566 iglv AVPZ01000445.1 9738513 SVASYVLTQPSSMSVSLGETASLTCEGDNIGIYYVYWYQQKPPKAPMLVMYSNNNRPPGIPDRFSSDNWGNTATLTITGVQAEDEADYYCQVSDGNML
Cavia aperea V567 iglv AVPZ01000445.1 9718030 SVVSYVLTQPPSVSVSLGQTASVTCSGNELPSRYACWFQQKPGQPPMQVIYKDSERSSGISERLSGSNSGTTATLTINGVQAEDEADYYCLSMDSMVTI
Cavia aperea V568 iglv AVPZ01000445.1 9713718 SIASYVLTQPPSVSVSPGQTATITCSGEALPKRYAQWFQQKPGQTPMSVIYKDSERPSGISDRFSGSSSGTTATLTISGVQAGDEADYYCQSWDSSGNL
Cavia aperea V569 iglv AVPZ01000445.1 9702251 SVASYVLTQPSSMSVSPGETAKLTCEGNNIGRKSVQWFQQKPPQAPMLVIYADNLRPSKIPNRFSGANSGNTATLTITGAKAEDEADYYCQVWDSNS
Cavia aperea V570 iglv AVPZ01000445.1 9683854 SIASYVLTQPPSVSVSLGQRASITCSGDALTKKYAHWFQQKPGQTPVRVIYKDSERPSGVSERFSGSKSGTTATLTISGVQAEDEADYYCLSTDSSGNY
Cavia aperea V571 iglv AVPZ01000445.1 9679555 SIASYVLTQPPSVSVSPGETVTITCSGDALPKNYAYWFQQKPGQTPVQVIYKDSERPSGVSERFSGSSSGTTATLTISGVQAEDEADYYCFSGEGDGK
Cavia aperea V572 iglv AVPZ01000445.1 9669205 SIASYVLTQSPSVSVSPGQTATITCSGDELPSTFAHWYQKKPGQTPVNIIQKDSERPSGISERFSGSSSGTTATLTISRVQAEDEADYYCGSWDSSGNL
Cavia aperea V573 iglv AVPZ01000445.1 9645623 SVASYVLTQPSSMSVSLGETAILTCDGNNIGGRRVHWYQQKPPQTPMLVIYADNNRPSEIPNRFSGAKSGNTATLTITGAQAEDEADYYCHVWDSSIS
Cavia aperea V574 iglv AVPZ01000445.1 9634728 SMASYILTQPPSVSVSPGQTATITCSGEKLSERYAYWYQQKPSQAPALVIYNDSERPSEIPDRFSGSSSGNTATLTISGAQAADEADYYCLSSESDDA
Cavia aperea V575 iglv AVPZ01000445.1 9602314 SVASYVLTQPSSMSVSLGETVRLTCEGNNIGGKNVYWYQQKPPQAPMLVMYSDNTRPSGIPDRFSGAKSGNTATLTITGTQDEDDADYYCQVWDS
Cavia aperea V576 iglv AVPZ01000445.1 9574505 SVASYVLTQPSSMSVSLGGTVRLTCEGNNIGGKAVQWYQQKPPQAPMLVMYNGNSRPSEIPDRFSGANSGNTATLTISGAQDEDEASYYCQVYDSSS
Cavia aperea V577 iglv AVPZ01000445.1 9554441 SVASYVLTQPSSMSVSLGETARLTCEGNNIGGKYVHWYQQKPPQAPMLVIYSDNNRPSGIPDRFSGANSGNTATLTITGAQAEDEADYYCQVFDSNS
Cavia aperea V578 iglv AVPZ01000445.1 9534161 SIASYVLTQPPSVSVSLGQTASITCSGNELSSRYACWFQQKPGQPLVQVIYKDSERPSGISETLAGSNSGTTATLTINGVQAEDEADYYCFSNKGSVNY
Cavia aperea V579 iglv AVPZ01000445.1 9520457 SIASYVFTQPPSVSVSPGQTATITCSGDSLPSRYAHWYQQKPGQTPVNVICKDSERPSGISERFSGSRSGTKATLTISRVQAEDEADYYCGSWDNSANH
Cavia aperea V580 iglv AVPZ01000445.1 9498480 SVASYVLTQPSSMSVSLRETARLTCEGNNIGGKAVQWYQQKPAQAPMLVMYYDNERPSGIPDRFSGANSGNTATLTITGAQAEDEADYYCQVWDSNN
Cavia aperea V581 iglv AVPZ01000445.1 9426391 SMAFYKLTQPSSLSVTWGKTARITCQAYGLRSYAVNWYQQKPGQAPVLIIYYDDSKPAGIPNRFSGSNKGNTATLTISRALFEDEADYYCQVRDNSDG
Cavia aperea V586 ighv AVPZ01000500.1 12825911 VQPEEQLVESGGGLVQPRGSLRLSCVASGFTFSNYWMHWIRQAPGKGLEWISKINCDSSTINYVDSVKGRFTISRDNSKNTLYLQMSSLRSEDTAVYYCAT
Cavia aperea V587 ighv AVPZ01000500.1 12782099 VQAEVQLVESGGGLVQPGGSLRLSCLASGFTFSNSWMSWVRQVPGKALEWLANINGDSSNIKYADSVKGRFTISRDNGKNTLYLQMSSLRTEDTALYYCAA
Cavia aperea V588 ighv AVPZ01000500.1 12745468 VHAEVQLIESGGGLVQPGESLRLSCVASGLTLSNYWIDWVRQAPGKGLEWISAISNSGSTYYADSVKGRFTISRDNVKNTLYLQMSSLRPQDTAVYYCST
Cavia aperea V589 ighv AVPZ01000500.1 12663601 VQADVQLVESGGGLVQPGGSLRLSCVASGFTFSNYYMYWVRQAPGKGLEWLADISGGSSDIKYADSVKGRFTISRDNSKNTLYLQMSSLRTEDTAVYYCTR
Cavia aperea V590 ighv AVPZ01000500.1 12637483 VQAEVQLVESGGGLVQPGGSLRLSCLASGFTFSNYGMSWIRQAPGKGLEWISAISDSGASTYYADSVKGRFTISRDNGKNLLYLQMSSLRPEDTAVYYCAR
Cavia aperea V591 ighv AVPZ01000500.1 12426217 VLSQVQLQESGPGLVKPSETLSLTCTVSGFSLTSADVNWVRQAPGKGLEWIGAIWSGGSTDYNSALKSRVGISRDTSKSQVSLTLRSVSPEDTAIYYCA
Cavia aperea V592 ighv AVPZ01000500.1 12310084 VQAEVQLMESGGGLVQPGGSLRLSCVASGFTFSNYWMSWIRQAPGKGLEWISEIKGDSSTINYIDSVKGRFTISRDNSKNTLYLQMSSLRTEDTAVYYCTT
Cavia aperea V594 ighv AVPZ01000500.1 12093058 VQAELQLVEYGGSLVPPGGSLTLSCVTLEFPFSSYAMGWIRQPPGQGLEWLSLIYHDSSKINYANSVKGRFTISRDNGRNTLYLQMNSLRTEDTALYYCAA
Cavia aperea V595 ighv AVPZ01000500.1 11964466 VQGEPQLVESGGGLVQPGGSLKLSCVASGFTFSNAAMSWIRQAPGKGLEWISVISYDSSYIKYSDSVKGRFTISRDNGKNMLYLQMSSLRPEDTAVYYCA
Cavia aperea V596 ighv AVPZ01000500.1 11896287 VQGEPQLVESGGGLVQPGGSLRLSCVASGFTFSNSWMDWIRQAPGKGLEWISEIKGDSSTINYIDSVKGRFTISRDNGKNTLYLQMSSLRPEDTAVYYCG
Cavia aperea V597 ighv AVPZ01000500.1 11799845 VQGEPQLVESGGGLVQPGGSLKLSCVASGFTFSNAGMNWIRQAPGKGLEWISVIWYDGSKMYYADSVKGRFTISRDNSKNTLYLQMSSLRPEDTAVYYCA
Cavia aperea V598 ighv AVPZ01000500.1 11735712 VQGAEQLVESRGDLVQPGSSLRLSCMASGFTFSNYDMHWIRQSPGKELEWISVIWYDGSKMYYADSVRGQFTISRDNSKNTLYLQVSSLRPEDMAMHYYCAA
Cavia aperea V599 ighv AVPZ01000500.1 11662176 VLCEEQLVESGGGLVQPGSSLRLSCVASGFTFSSYSMHWIRQAPGKGLEWISYISSSSSNIKYADSVKGRFTISRDNGKNTVYLQMSSLRPDDTAMYYCAR
Cavia aperea V600 ighv AVPZ01000500.1 11659193 VQAEEQLVESGGGLVQPGGSLKLSCVASGFTFSSYDMNWIRQAPGKGLEWISLINSGGSMYYAGSVKGRFTISRDNGKNTLYLQMSSLRPEDTAVYYCAG
Cavia aperea V601 ighv AVPZ01000500.1 11639526 VQAEEQLVESGGGLVQPGGSLKLSCMASGFTFSSYAMNWIRQAPGKGLEWISAIDGSGASTYYAGSVKGRFTISRDNGKNTLYLQMSSLRPEDTAVYYCAR
Cavia aperea V602 ighv AVPZ01000500.1 11171267 VQAEEKLVESGGGLVPPGGSLKLSCVASGFTFSSYGMSWIRQAPGKGLEWITSVGTKGNTYYAESLKDRFTISRDNGKNTLYLQMSRLIPEDLAVYYCAR
Cavia aperea V603 ighv AVPZ01000500.1 11030895 IFCQVQLQESGPDLVKPSQTLSLTCTVSGYSITSDYYWAWIRQPPGKGLQWMGYISYSGSTEYNPSLQSRLSISRDTGKNQFSLQLKSVTAEDTATYYCAR
Cavia aperea V604 ighv AVPZ01000500.1 10991918 VLSQVQLQESGPDLVKPYQTLSLTCSVSGYSITSGYSWNWIRQPPGKSLEWMGYISSNGGTGYNPSLQSRISISRDTGKNQFSLQLKSITAEDTATYYCAR
Cavia aperea V605 ighv AVPZ01000500.1 10926719 ATGGVQGRLAAVRRSLKFSCVTSGFIFSSYVMSWVFQASVKGLEWISDLSTGGNTYYADSVKGRFTISRDNRKDTLYLQMNSLKTEDTAMYYCGREAVRKH
Cavia aperea V606 ighv AVPZ01000500.1 10896652 VQSEEQLVESGGGLVQPGGSLKLSCVASGFTFSNYWMSWIRQAPGKGLEWLTYINPDGGSTYYADSVKGRFTISRDNSKNMLYLQMSSLKPEDTAVYYCAR
Cavia aperea V607 ighv AVPZ01000500.1 10723139 VLSQMQLQESGPGLVKPSQTLFLTCSVSGFSITTSGYGWSWIRQPRGKTLEVMGAINYNGGTGYNPSIKSRISISRDTGKNQFSLQLNSVTEEDTATYYCAR
Cavia aperea V608 ighv AVPZ01000500.1 10580958 VQSEEQLVESGGGLVQPGGSLKLSCVASGFTFSNYWMSWIRQAPGKGLEWLTYINYDGDSTYYADSVKGRFTISRDNSKNMLYLQMSSLKPEDTAVYYCAR
Cavia aperea V609 ighv AVPZ01000500.1 10371857 VLSQVQLQESGSGLVKPSQTLSLTCSVSGFSITTGSYEWSWIRQTPGKSLEWMGYISSNGGTSYNPSFKNRISISRDTGKNQFSLQLNSVNTEDTATYYCAR
Cavia aperea V610 ighv AVPZ01000500.1 10332514 VLSQVQLQESDSGLVKPTQTLSLTCSVSGISITTSYYCWNWMRQPPGKSLEWMGYICYSGSTGYNPSLQSRISVSRDTGKNQFSLKLNSVTTEDTAIYYCAR
Cavia aperea V611 ighv AVPZ01000500.1 10296397 VLSQVQLQESGPGLVKPSQSLSITCTVSGFSITTTNYWWHWIRQPPGKSLEWLGEISYDGNTKYNPSVKSRLSIARDTGKNQFSLQLTSVTTEDTATYYCAR
Cavia aperea V612 ighv AVPZ01000500.1 10120132 VQAEVQLVESGGGLVQPEGSLRLSCVTSGFTFSNYYMHWIRQAPGKGLEWVGLIRNAAKSHTTEYAASVKGRFTLSRDDSKSTLYLQMTKLKPEDTAVYYCAG
Cavia aperea V613 ighv AVPZ01000500.1 10048307 VQAEVQLVESGGGLVQPEGSLRLSCVTSGFTFSDYYMYWIRQAPGKGLEWVGLIRNAANSHTTEYAASVKGRFTISRDDSKSTLYLQMTKLKPEDTAVYYCAR
Cavia aperea V614 ighv AVPZ01000500.1 9971756 VQAEVQLVESGGGLVQPEGSLRLSCVTSGFTFSDYYMYWIRQAPGKGLEWLALIRDADNSHTTEYAASVKGRFTISRDDSKSTLYLQMTKLKPEDTAVYYCAR
Cavia aperea V615 ighv AVPZ01000500.1 9936429 VQAEVQLVESGGGLVQPEGSLRLSCVTSGFTFSDYYMHWIRQAPGKDLEWVGFIRNAANSHTTEYAASVKGRFTISRDDSKSTLYLQMTKLKPEDTAVYYCGR
Cavia aperea V653 ighv AVPZ01000733.1 2147108 VLCEEQLVESGGGLIQPGGSLRLSCVASGFTFSNYGMSWIRQAPGKGLEWIAGISSSSSYIYYADSVKGRFTISRDNGKNTLYLQMSSLRAEDTAMYYCAR
Cavia aperea V654 ighv AVPZ01000733.1 2129602 VLSQVQLQESGPGLVKPSETLSLTCTVSGFSLTDYSVSWVRQAPGKGLEWIGRMWNGGSTDYNSAFKSRVGISRDTSKSQVSLTLSSLSPEDTAMYYCA
Cavia aperea V655 ighv AVPZ01000733.1 2079378 VLCQEQLVESGGGLVQPGGSLRLSCMASGFTFSSYNMSWIRQAPGKGLEWVAWIRNDGGSTNYADSVKGRFTISRDNGKNTLYLQMNSLRPEDTAVYYCV
Cavia aperea V656 ighv AVPZ01000733.1 2025481 VLSQVQLQESGPGLVKPSETLSLTCTVSGFSLTSYSVYWVRQAPGKGLEWIGTIWSDGSTDYNSALKSRVGISRDTSKSQVSLTLSSLSPEDTAVYYCAR
Cavia aperea V657 ighv AVPZ01000733.1 1813264 VLSQVQLQESGPGLVKPSETLSLTCKVSGFSLTGYSVSWVRQAPEKGLEWIGAIWSFGSTDYNSAFKSRVGISRDTSKSQVSLTLSSLSPEDTAVYYCA
Cavia aperea V659 ighv AVPZ01000733.1 1769677 SGGGLVQPGGSLRLSCVASGFTFSSYHMCWIRQAPGKGLEWVAWIRNDGGSTDYADSVKGRFTISRDNGKNTLYLQMNSLRAEDTAVYYCAR
Cavia aperea V660 ighv AVPZ01000733.1 1652749 VLCEEQLVESGGGLVQPGGSLRLSCVASGFTFSDYYMSWIRQSPGKGLEWIADISDDSSDTQYANSVKGRFTISRDNGKNTLYLQMSGLRPEDTAVYYCA
Cavia aperea V661 ighv AVPZ01000733.1 1645127 VLCEEQLVESGGGLVQPGGSLRLSCVASGFTFSDYYMSWIRQAPGKGLEWIAGISSSSSYIDYADSVKGRFTISRDNGKNTLYLQMSSLRTEDTAMYYCAR
Cavia aperea V662 ighv AVPZ01000733.1 1624328 VLSQVQLQESGPGLVKPSETLSLSCTVSGFSLTSYSVYWVRQAPGKGLEWIGAIWSGGSTDYNSALKSRVRISRDTSKSQVSLTLSSLSPEDTAVYYCA
Cavia aperea V663 ighv AVPZ01000733.1 1579572 VLCEEQLVESGGGLVQPGGSLRLSCVASGFTFSSYHMNWIRQAPGKGLEWVTWISNTGGSTDYADSVKGRFTISRDNGKNTLYLQMNSLRAEDTAVYYCAR
Cavia aperea V664 ighv AVPZ01000733.1 1555494 VLCEEQLVESGGGLVQPGGSLRLSCVASGFTFSDYYMSWIRQSPGKGLEWIAGINDDSSDTQYANSVKGRFTISRDNGKNTLYLQMSGLRPEDTAVYYCA
Cavia aperea V665 ighv AVPZ01000733.1 1403518 VLCEEQLVESGGGLVQPGGSLRLSCVASGFTFSDYYMSWIRQAPGKGLEWIAGISSSSRYIDYADSVKGRFTISRDNGKNTLYLQMSSLRTEDTAMYYCAR
Cavia aperea V666 ighv AVPZ01000733.1 1352234 VLCEEQLVESGGGLVQPGGSLRLSCVASGFTFSSYHMSWIRQAPGKGLEWITWIRNDGGSTGYADSVKGRFTISRDNGKNTLYLQMNSLRAEDTALYYCAR
Cavia aperea V667 ighv AVPZ01000733.1 1310376 VLSQVQLQESGPGLVKPSETLSLTCTVSGFSLISYSVHWVRQSPGKGLEWIGAIWSGGSTYYNSALKSRVGISRDTSKSQVSLTLSSLSPEDTAVYYCAR
Cavia aperea V668 ighv AVPZ01000733.1 1281157 VLCEEQLVESGGGLVQPGGSLRLSCVASGFTFSNYWMSWIRQAPGKGLEWIAGIDSSSSYIQYAYSVKGRFTISRDNGKNTLYLQMSGLRAEDSAVYYCAR
Cavia aperea V669 ighv AVPZ01000733.1 1231012 VLCEEQLVESGGGLVQPGGSLRLSCVASGFTFSSYHMNWIRQSPGKGLEWISYINSGSGGIYYADSVKGRFTISRDNSKNTLYLQMRSLRAEDTAVYYCAGE
Cavia aperea V670 ighv AVPZ01000733.1 1162682 VLSQGKLQESGPGLVKPSETLSLTCTVSGLSLTSYAFSWVRQAPGKGLEWIGVIRSGGSTDYNPALKSRVGISRDTSKSQVSLTLSSLSPEDTAMYYCA
Cavia aperea V671 ighv AVPZ01000733.1 1112483 VQAEVQLVESGGGLVQPGGSLRLSCVASGFTFDDYYMSWIRQAPGKGLEWISTIGYSGGSTYYADSVKGRFTISRDNGKNTLYLQMSSLRPEDTATYYCAR
Cavia aperea V673 ighv AVPZ01000733.1 1028493 VLSQGQLQESGPGLVKPSETLSLTCTVSGFSLTSNGFSWVRQAPGKGLEWIGVIANNGGTIYNSALQSRVGISRDTYKSQVSLTLRNLIPEDTAMYYCAR
Cavia aperea V674 ighv AVPZ01000733.1 991704 VQAEVQLVESGGGLVKPGESLRLSCVASGLTLSNYWMDWVRQAPGKGLEWISAISGGSTYYADSVKGRFTISIDNGKNTLHLQMSSLRPEDTALYYCAA
Cavia aperea V675 ighv AVPZ01000733.1 922306 VLCEEQLVESGGGLVQPGGSLRLSCVASGFTFSSYEMNWIRQSPGKGLEWISYISSGSGSIYYADSVKGRFTISRDNSKNTLYLQMSSLRAEDTAVYYCTR
Cavia aperea V677 ighv AVPZ01000733.1 684303 VLCEEQLVESGGGLVQPGGSLRLSCVASGFTFSSYYMNWIRQAPGKGLEWISRISNDGGSTKYADSVKGRFTISRDNGKNTLYLQMSSLRPEDTAVYYCAR
Cavia aperea V678 ighv AVPZ01000733.1 611147 VQSEVQLVESGGGLVKPGESLRLSCVASGITFSSYWMNWIRQAPGKGLEWISAIYNDGSSTYYADSVKGRFTISWDNGKNTLYLQMNSLRPEDTAMYYCTT
Cavia aperea V679 ighv AVPZ01000733.1 601479 VQAEVQLVESGGGLVKPGESLRLSCVASGFTFSSYWMNWIRQAPGKGLEWISAINSDGSSTYYADSVKGRFTISRDNGKNTLYLQMSSLRPEDTAMYYCAR
Cavia aperea V680 ighv AVPZ01000733.1 459874 VLCEEQLVESGGGLVQPGGSLRLSCVASGFSFSTYDMGWIRQAPEKGLEWISWIRYDGGSTDYADSVKDRFTISRDNGKNTLYLQMNSLRAEDTAVYYCAR
Cavia aperea V682 ighv AVPZ01000733.1 325088 VHAEVQLTQSGGGLVQPGESLRLSCVASGSTLSNYWMDWVRKAPGKGLEWISAISNSGSTYYADSVKGRFTISRDNGKNALYLQMSSLRPEDTAVYYCAN
Cavia aperea V683 ighv AVPZ01000733.1 242387 VQAEVQLVESGGGLVQPGGSLRLSCVASGFTFSSYYMHWIRQAPGKGLEWLAYISGDSSNIKYADSVKGRFTISRDNGKNTLYLQMSSLRTEDTAVYYCTT
Cavia aperea V684 ighv AVPZ01000733.1 167110 VHAEVQLTQSGGGLVQPGESLRLSCVASGSTLSNYWMDWVRKAPGKGLEWISAISNSGSTYYADSVKGRFTISRDNGKNALYLQMSSLRPEDTAVYYCAN
Cavia aperea V685 ighv AVPZ01000733.1 135320 GLVQPGRSLRLSGMASGFTFSNCMNWMCRALGKGLEWISEINGGSSTINYIVSVKGRFTASRDNSKNTLYLQMSSLKMEDTAGYYCATSSMRE
Cavia aperea V686 ighv AVPZ01000733.1 85737 VQAEVQLVESGGGLVQPGGSLRLSCVASGFTFSSNYMSWIRQAPGKGPEWLTYISGDSSDIKYADSVKGRFTTSRDNGKNTLYLQMSSLRTEDTAVYYCAR
Cavia aperea V687 ighv AVPZ01000733.1 5538 VHAEEQLVQSEGGLVQPGGSLKLSCMASGFTFSTYVMRWIRQPPGKGLEWISSISQTSKNINYADSVKGRFTISRDNDKNTLYLQMSNLKREDTAMYYCLR