WGS Statistics
Organism WGS Record. Vs Total IGHV IGLV IGKV TRAV TRBV TRGV TRDV
Oncorhynchus mykiss MSJN00000000.1 (MSJN01) 303 55 2 90 119 27 7 3
Oncorhynchus mykiss CCAF00000000.1 (CCAF01) 74 21 1 25 20 5 1 1
Vgene Table
Organism Vgene Locus contig Contig Pos. AA sequence
Oncorhynchus mykiss V13 trdv MSJN01000097.1 3719824 AGQSSDIHLVTANVGETVTLHCFYKGNLALYFMWYKQKMGDNPQLLSTFYKYNKNATFYHEFKGNTRFSVQSGEGMNHLKISDMQLSDSATYYCG
Oncorhynchus mykiss V29 ighv MSJN01000233.1 59464 VHCGLELTQPSSLDVKPGESLSITCKVSGYSLTDSSNVYGIGWIRQPVGKALEWIWTIYYVGSSNSQSSLKDRFSVTRDTSSNTVFLKGQNLQTEDTAVYYCARW
Oncorhynchus mykiss V33 igkv MSJN01000291.1 4762520 SWGQYVLTQSAAQSVQPGQTVSIDCSTSSKVTQYSGSQYYLAWYHQTSGEAPKLLICYTSDRFTGVSTRFSGSGRGNGVDFTLTISDVQAEDTGVYYCQ
Oncorhynchus mykiss V34 igkv MSJN01000291.1 4775979 SWGQYVSTQSAAQSVQPGQTVSIDCSTSSKVTQYSGSQYYLAWYHQTSGEAPKLLICYTSDRFTGVSTRFSGSGRGNGVDFTLTISDVQAEDTGVYYCQSQWSC
Oncorhynchus mykiss V36 igkv MSJN01000305.1 548254 SAADIILTQSPKSQSVSPGEVVTISCTASSGTSNYLHWYLQKPGEAPKLLVYDATTRQSGIPGRFSGSGSGSPYTHYTLTISGVQAEDAGDYYCQQGL
Oncorhynchus mykiss V83 igkv MSJN01000596.1 494827 SRGQYVVTQTPAVKAVLPEQTVSLNCKTSSNVYSNNYLAWYQQKPGGAPKLLIYSATTLQSGTPSRFSGSGSGSDFTLTISGVQAEDAGDYYCQS
Oncorhynchus mykiss V84 igkv MSJN01000596.1 499157 SRGQYVVTQTPAVKAVVPGQTVSLNCKTSSNVYSNNRLAWYQQKPGGAPQLLIYLATTLQSGTPSRFSGSGSGSDFTLTISGVQAEDAGDYYCQS
Oncorhynchus mykiss V85 igkv MSJN01000596.1 512333 SRGQYVVTQTPAVKAVLPEQTVSLNCKTSSNVYSNNYLAWYQQKPGGAPKLLIYSATTLQSGTPSRFSGSGSGSDFTLTISGVQAEDAGDYYCQS
Oncorhynchus mykiss V86 igkv MSJN01000596.1 519976 SRGQYVVTQTPVVKAVVPEQTVSLNCKTSSNVYNNNLLAWYQQKPGGAPKLLIYSATTLQSGTPSRFSGSGSGSDFTLTISGVQAEDAGDYYCQS
Oncorhynchus mykiss V87 igkv MSJN01000596.1 523516 SRGQYVVTQTPAVKAVVPEQTVSLNCKTSSDVYNNNYLAWYQHKPGGAPKLLIYHATTLQSGTPSRFSGSGSGSDFTLTISGVQAEDAGDYYCQS
Oncorhynchus mykiss V88 igkv MSJN01000596.1 531431 SRGQYVVTQTPVVKAVLPEQTVSLNCKTSSDVYKNNYLAWYQHKPGGAPKLLIHSATTLQSGTPSRFSGSGSGIDFTLTISVVQAEDAGDYYCQS
Oncorhynchus mykiss V89 igkv MSJN01000596.1 536670 SRGQYVVTQTPVVKAILPGQTVSLNCKTSSNVYSNIHLAWYQQKPGGAPKLLIYLATTLQSGTPSRFSGSGSGSDFTLTISGVQAEDAGGYYCQS
Oncorhynchus mykiss V90 igkv MSJN01000596.1 543484 SKGQITVTQTPEMKAFQTGDAVTLRCRFNKPPACSPPCVAWYQQRPGGAPQLLIYLATTLQSGTPSRYSGSGSGSDFTLTISGVQAEDAGDYYCQS
Oncorhynchus mykiss V91 igkv MSJN01000596.1 547350 SRGQYVVTQTPAVKAVVPEQTVSLNCKTSSDVYNNNYLAWYQHKPGGAPKLLIYHATTLQSGTPSRFSGSGSGSDFTLTISGVQAEDAGDYYCQS
Oncorhynchus mykiss V92 igkv MSJN01000596.1 548389 SRGQYVVTQTPAVKAVVPEQTVSLNCKTSSDVYNNNYLAWYQHKPGGAPKLLIYHATTLQSGTPSRFSGSGSGSDFTLTISGVQAEDAGDYYCQS
Oncorhynchus mykiss V93 igkv MSJN01000596.1 576091 SRGQYVVTQTPVVKVVLPEQTVSLNCKTSSDVYSNNYLAWYQQKPGGAPKLLIYLATTLQSGTPSRFSGSGSGSDFTLTISGVQAEDAGDYYCQS
Oncorhynchus mykiss V94 igkv MSJN01000596.1 580152 SRGQYVVTQTPVVKAVVPEQTVSMNCKTSSNVYSNYLLAWYQQKPGGAPKLLIYYATTLQSGTPSRFSGSGSGSDFTLTISGVQAEDAGDYYCQS
Oncorhynchus mykiss V95 igkv MSJN01000596.1 587784 SRGQYTLTQTPAVKADGNGETVNIGCKLSSDIYSNYLHWYQQRPGEAPKLLIYQINNKFTGTPSRFSGSGSGTDFTLTISGVQAEDAGDYYCQS
Oncorhynchus mykiss V96 igkv MSJN01000596.1 592121 SRGQYVVTQTPVVKAVLPEQTVSLNCKTSSNVYSNNYLAWYQQKPGGAPKLLIYRATTLQSGTPSRFSGSGSGSDFTLTISGVQAEDAGDYYCQS
Oncorhynchus mykiss V97 igkv MSJN01000596.1 623744 SRGQYVVTQTPAVKAVLPEQTVSLNCKTSSNVYNNNFLAWYQQKPGGAPQLLIYYATTLQSGTPSRFSGSGSGSDFTLTISGVQAEDAGDYYCQS
Oncorhynchus mykiss V98 igkv MSJN01000596.1 627584 SRGQYVVTQTPVVKAVVPEQTFSMNCIISSNVYSNNYLAWYQQKPGGAPKLLIYYATRLQSGTPSRFSGSGSGSDFTLTISGVQAEDAGDYYCQS
Oncorhynchus mykiss V99 igkv MSJN01000596.1 636125 SRGQYVVTQTPVVKVVLPEQTVSLNCKTSSDVNNNNYLAWYQHKPGGAPKLLIYYATTLQSGTPSRFSGSGSGSDFTLTISGVKVEDAGDYYCQS
Oncorhynchus mykiss V100 igkv MSJN01000596.1 638002 SRGQYVVTQTPSVEAALPGQQISLNCKTSSNVYSNNYLAWYQQKPGGAPKLLIYSATTLQSGTPSRFSGSGSGSDFTLTISGVQAEDAGDYYCQS
Oncorhynchus mykiss V101 igkv MSJN01000596.1 668675 SRGQYVVTQTPVVKAVLPEQTVSLNCKTSSNVYSNNYLAWYQQKPGGAPKLLIYSATTLQSGTPSRFSGSGSGSDFTLTISGVQAEDTGDYYCQS
Oncorhynchus mykiss V102 igkv MSJN01000596.1 683146 SRGQYVVTQTPVVKAVLPEQTVSLNCKTSSDVHGGYYLAWYQQKPGGAPKLLIYRATTLQSGTPSRFSGSGSGSDFTLTISGVQAEDAGDYYCQS
Oncorhynchus mykiss V103 igkv MSJN01000596.1 691124 SRGQYVVTQTPTVKAALPGQNVFLNCKASSDVYSNIHLAWYQQKPGGAPKLLIYHATTLQSGTPSRFSGSGSGSDFTLTISGVQAEDAGDYYCQS
Oncorhynchus mykiss V104 igkv MSJN01000596.1 702987 SRGQYVVTQTPVVKAVLPEQTVSLNCKTSSNVFGNDRLAWYQQKPGGAPKLLIYYATTLQSGTPSRFSGSGSGSDFTLTISGVQAEDAGDYYCQS
Oncorhynchus mykiss V105 igkv MSJN01000596.1 712902 SRGQYVVTQTPAVKAVLPEQTVSLNCKTSSNVYSNNYLAWYQQKPGGAPQLLIYYATTLQSGTPSRFSGSGSGSDFTLTISGVQAEDAGDYYCQS
Oncorhynchus mykiss V118 trav MSJN01000675.1 208636 SSAHKVHQSPSALIKNHGSSVDQEIHCSHSITNYDRMLWYKQDINRTLKLLGYLNLNFAYSEEYVKGKIHIQGDGRSYGNFSISGLKQEDSAVYFCAVL
Oncorhynchus mykiss V120 trav MSJN01000675.1 219556 LVEGSGVTQTPTILWELKEIYAQMNCSHTKGSSYYQMYWYRQLPGEGMKQVVFITPSSQPDYSGEFSKDKFSARKAVAESGSFTVKKLETGDSGMYYCAVS
Oncorhynchus mykiss V121 trav MSJN01000675.1 224620 SSLSNQVHQIPAGLYKNQGELAKMECSHSISTYNRILWYKQSNYREFVFLGYMTAKTGFSEAGFDIEGDANAGGTSTLTINQLTPNSSAVYYCAAS
Oncorhynchus mykiss V122 trbv MSJN01000675.1 226161 LSQTDKVHQTPTAILTGPEDKVNLTCSHTVSRYDTILWYQQSAQNTALKLIGYVRFTSPTVEDSFKGRFDVSGDAAANKMAYLHFPKVPEAEDSAVYFCAASE
Oncorhynchus mykiss V123 trav MSJN01000675.1 229766 LVEGSEVTQTPTILWGPKDSDAPMNCSHSKDSSYYQMYWYRQLPGEGMKLVVYTSTYNIPDYGAFSEDKYQNVKTTAKSGSFTVKKLETGDSGMYFCAVS
Oncorhynchus mykiss V124 trav MSJN01000675.1 230895 QLFSSMVHQRPVALTEGPGGNVQLTCSHTIPNYYVILWYKQSAGDTAMKLIGYAYTKSITMEKSFEKHFNVSGDGGKEAYLHLVSLRGPEHSAVYYCAAS
Oncorhynchus mykiss V127 trbv MSJN01000675.1 237416 LCLSVEVNQTPSAVFSRPGENVQLFCQHQKTDYTLMLWYQKPQGETALKLIGNLYHKNPTIESSYEKHFNMSGDLGGGGPKNASLNMFNLRRPQHSAVYFCAASY
Oncorhynchus mykiss V128 trav MSJN01000675.1 238221 VSLSKSVYQSPSTSLVKPNASVTLNCSHTIPSYDTVLWYKRSVEDTALNLIAYVYYKTPTVEPSYKGYFDVKGDGENDAFLHILKPRQAEDSGEYFCAVS
Oncorhynchus mykiss V129 trbv MSJN01000675.1 245591 LCLSVEVHQTPSAVYSRPGENVQLFCQHQKTDYRVMLWYQKPRGETALKLIGYLNFNSQTIESSHEKHFNMSGDLGGGGPKNASLNMFNLKRPQHSAVYFCAASK
Oncorhynchus mykiss V130 trav MSJN01000675.1 254328 LGLGTRVVQTPAALVMTPGDSADLHCSHTIKDYDVILWYRQTHSQDRQLQLLGYLYTDNKNPESRFKDKIKLRGNAEQYCDLSVSNLTQEDSAVYFCAAR
Oncorhynchus mykiss V131 trav MSJN01000675.1 264668 HVKCVAFSQSPSLTVKDGREAEIHCSHDDSNLLVMLWYQQRQASMTLIGYSYGTTEPNYEGLFEERFRQKREENLKGTLVISKLTVADSAVYFCAAS
Oncorhynchus mykiss V160 ighv MSJN01001004.1 781590 IYCDITLTQPGSMVVSPGESVTIPCKVAGYSVTSTCTNWIRHSEGKAMEWIGYLCSSSSSGTTDSLKSKISFTVDSSSSTVFLQGKNFQTEDTAVYYCARY
Oncorhynchus mykiss V161 ighv MSJN01001004.1 785306 VHGQIVLTQAESVQGTPAGSLKLTCACSGFTLSSTNMFWIRQAPGKGLEWIIYYYSDSDKSNAPVVQGRFTASKDSSNFYLHMSQLKPEDSAVYYCARD
Oncorhynchus mykiss V162 ighv MSJN01001004.1 797699 VQGQSLTSSEPVVKRPSESVTLSCAVSGFSMASYWTHWIRQKPGKGLEWIGLIDSGTGTIFAQSLQGQFTITKDSSKNQLYLEVKSLKTKDSAVYYCAR
Oncorhynchus mykiss V163 ighv MSJN01001004.1 804973 VQGQTLTESESVVKKPGESHKLTCTYSGFGGNNWNAWIRQAPGKGLEWVSAITSSDGGSTYYSQSVQGQFTISRDNSKQQVYLQMNSLKTEDSAVYYCAR
Oncorhynchus mykiss V164 ighv MSJN01001004.1 824025 VHCQVVLTQAEQSVQGTPAGSLKLTCACSGFTLSSTNMHWIRQAPGKGLEWIIYYYSDSYKSNAPVVQGRFTASKDSSNLYLHMSQLKPEDSAVYYCARD
Oncorhynchus mykiss V165 ighv MSJN01001004.1 827907 VQGQTLTESGPVVKHPGESHKLTCTGSGFTFSSYGMNWIRQAPGKGLEWIAYSYSTTADYSQSFQGRFTISRDGSSSKLYLQMNSLRSEDTAVYYCAR
Oncorhynchus mykiss V166 ighv MSJN01001004.1 832871 LNGQSMESIPSGPVLKKPGDTLSLSCKGDGFTFSSYGMHWIRQPAEKALDWMGLIYYDASKTIYSKNIEGRIEVTRDNSNSVVYLKLSGLRAEDSAVYYCARQ
Oncorhynchus mykiss V167 ighv MSJN01001004.1 844089 VHSQILTESGPVVKKPGESHKLTCTTSGFTFSSYYMAWIRQAPGKGLEWIASSYSTATYYSQSVQGRFTISRDDSRSKLYLQMNILKSEDTAVYYCARE
Oncorhynchus mykiss V168 ighv MSJN01001004.1 855715 VQSYELTQPASLTVQPGQPMTISCKVSYSVTGYYTAWIRQPVGKTLEWIGNVYSGDTQYKDSLKNKFSLSVDSSSNVVFLKGQNLQTEDSAVYYCAY
Oncorhynchus mykiss V169 ighv MSJN01001004.1 860474 VHCSVEHNQPNSLSLKPGETLTISCAISGYSLTDNSYAVAWIRQSAGKPMECIFYIWGGGSFYLNNALKNKFSFRRDMSSSTSTLIGQNLQTEDTAVYYCARR
Oncorhynchus mykiss V170 ighv MSJN01001004.1 877961 VQSYELTQPASLTVQPGQPLTISCKVSYSVSSYYTAWIRQPAGKTLEWIGYISSGGGTAYKDSLKNKFSITRDTSSNTLFLKGQSLQTEDTAVYYCAR
Oncorhynchus mykiss V171 ighv MSJN01001004.1 886120 VHCQVVLTQAEQSVQGTPAGSLKLTCACSGFTLSSTNMHWIRQAPGKGLEWIIYYYSDSYKSNAPVVQGRFTASKDSSNLYLHMSQLKPEDSAVYYCARD
Oncorhynchus mykiss V172 ighv MSJN01001004.1 896534 LNGQSLESIPSNSVMKKPGETLSLSCKGSGYTFSSYNTHWIRQPAGKALEWMGYSGLGLGYHAKSFEGRMETTKDNSNSMMTLKLSGLRAEDSAVYYCAR
Oncorhynchus mykiss V173 ighv MSJN01001004.1 899773 IHSISLTSSPAQLKPPGDSVKLSCQVSGYVLTDYGTGWIRQQPGKTLEWIGIIWGGGSINSGASFKSRFTISRDSSNVLYLDISSLQAEDTAVYYCAKTG
Oncorhynchus mykiss V174 ighv MSJN01001004.1 915809 VQGQSLTSSESVVKSPGESVTLSCTVSGFSMDSYYMHWIRQKPGKGLEWIGLIDTGTGTVFAQSLQGQFTITKDNSKNQLYLEVKSLKTEDSAVYYCAR
Oncorhynchus mykiss V175 ighv MSJN01001004.1 918954 VHGQTLTESGPVVKITGEPHKVTCTASGFTFSNYWMAWIRQAPGKGLEWIAIIKYDSAEIYYSQSVQGRFTISRDNSKQQVYLQMNSLKTEDSAVYYCAR
Oncorhynchus mykiss V176 ighv MSJN01001004.1 925607 VFCQTELTQPGSLTLQPGQPLTLSCKVSGYSLTSTSYCTGWVRQPAGKALEWVGEMCGSGNIYYSDKLKNKFSISRDTSSSTVTLTGQSLQTEDTAVYYCARR
Oncorhynchus mykiss V177 ighv MSJN01001004.1 942761 ARCQVVLTQAEQSVQGTPAGSLKLTCACSGFTLSSSYMHWIRQAPGKGLEWIIYYYSDSNKSNAPVVQGRFTALKDSTNFYLHMNLLKPEDSAVYYCARD
Oncorhynchus mykiss V178 ighv MSJN01001004.1 952460 VHGQTLTESGPGIKTPGESNTLSCTTSGFTFSSYHMAWMKQAPGKGLEFVAFIHTGGSSPFYSQSIQGRFTISRDDSSSKLYLQMNSLKSEDTALYYCAR
Oncorhynchus mykiss V179 ighv MSJN01001004.1 988379 VYSQSLEDIPSSPVMKKPGELLSLSCKGSGFTFSSYNMAWIRQPEGRTLEWIGIIWNDASGTVYTKSVEGRIEVTRDNSNSMVYLKLSGLRAEDSAVYYCARE
Oncorhynchus mykiss V180 ighv MSJN01001004.1 994479 VQGQTLTESGPVVKNPGESHKLTCTGSGFTFSSYEMNWIRQAPGKGLEWIAYSYSTTTYYSQSVQGRFTISRDDSSSKLYLQMNSLRSEDTAVYYCARE
Oncorhynchus mykiss V181 ighv MSJN01001004.1 1001278 VQGQTLTESGPVVKKHQDSHKLTCTYNGFGGNIDAAWIRQAPGKGLEWVSYISSGSSYIYYSQSVQGRFTISRDNSKQQVYLQLNNLKTDDSAVYYCARQ
Oncorhynchus mykiss V182 ighv MSJN01001004.1 1008317 CNGQSLESIPSSPVQKNPGETLSLSCKISGFTFDSHNTHWIRQPAGKSLEWLGFSGLGLGYHAKRFEGRMETTKDTSNSMLTLMLSGLRTEDSAVYYCAR
Oncorhynchus mykiss V183 ighv MSJN01001004.1 1078254 VQGQTLTESGPVIKTPGESHTLICTGSGFTFKDYWMSWIRQAPGKELEWIGYIHGTTTYYSQSFQGRFTLSRDDSSSKLYLQMNSLKSEDTAVYYCAR
Oncorhynchus mykiss V186 ighv MSJN01001047.1 23245 LHGQSMESIPSSPVMKKPGETLNLSCKGSGYTFGNHAVHWVRQPKGKGLEWIGRVRTDTGEATYANSVSGRLEITKDNAQSMSFLKLSGVRAEDSAVYYCARQ
Oncorhynchus mykiss V187 ighv MSJN01001047.1 67514 VCCDEMDQSPSQVKRPGDTFKLSCKISGFDMTDYFMHWIRQKPGKALEWIGRINSGSRNAPVYSDSLKGQFTLTEDISTSTQFLEAKSLSSEDSAVYYCARE
Oncorhynchus mykiss V198 iglv MSJN01001179.1 474306 SKGQVTVTQPPVVTFSPGDPVTLTCTTNTKVYKWDDGNEGGYWYQQRPGEAPKLLIRNIKTRQDGIPARFSGSGSESDFTLTISGVQAEDAAVYYCKS
Oncorhynchus mykiss V272 igkv MSJN01001773.1 2053667 SSGQYTVTQTPAVKAVLAGQSVSLNCKTSSNVHGNNHLAWYQQKPGGAPQLLIYYATTLQSGTPSRFSGSGSGSDFTLTISGVQAEDAGDYYCQS
Oncorhynchus mykiss V273 igkv MSJN01001773.1 2059543 SRGQYTVTQTPLVKAVLPGQTVSLNCKTSSDVYPNCGSSLPCMAWYQQKPGSNPELLVYQGSTLNSGIPSRFSGSGSGSDFTLTISGVQAEDAGDYYCQS
Oncorhynchus mykiss V274 igkv MSJN01001773.1 2073257 SRGQYTLTQTPAVKAVLPGQSVSLNCKASSNVHGNKYLDWYQHKPGGAPKLLIYYTSTVQSGTPSRFSGSGSGSDFTLTISGVQAEDAGDYYCQS
Oncorhynchus mykiss V275 igkv MSJN01001773.1 2098509 SRGQHIVTQTPAVKAVLPGQSVSLNCKTSSNVHGNNHLAWYQHKPGGAPKLLIYYATTLQSGTPSRFSGSGSGSDFTLTISGVQAEDAGDYYCQS
Oncorhynchus mykiss V276 igkv MSJN01001773.1 2109269 SSGQYTVTQTPAVKAVLPGQSVSLNCKTSSNVNGNNYLAWYQHKPGGAPQLLIYYATTLQSGTPSRFSGSGTGSDFTLTISGVQAEDAGDYYCQS
Oncorhynchus mykiss V344 igkv MSJN01002405.1 474201 SRGQITVTQTPTMKAVLSGQLVSLNCRISSNVYGNCYNGQSWNHQCLSWYQQKPGEKPKLMMLPGNTLRSGTPSRFSGSGSGSDFTLTISGVQAEDAGDYYCQS
Oncorhynchus mykiss V345 igkv MSJN01002405.1 496462 SRGQVTVTQTPAVKTVLPEQTVIINCKTSADVADACPGDYTCMAWYHQKPGGAPKLLIYFAEELESGTPSRFSGSGSHSDFTLTISGVQAEDAGDYYCQS
Oncorhynchus mykiss V346 igkv MSJN01002405.1 509733 QYTVSQTPTVETVLLGKAVSLNCKTSSDVYRAGYSDARLAWYQQTAGGTHKLLIYHAKTLQSGTPSRFSGSGSHSDFTLTISGVQAEDAGYYYCQSYNSGPV
Oncorhynchus mykiss V347 igkv MSJN01002405.1 519603 SRGQYVVTQTPTVETVLPGQKVSMICKASSNVHSNCYNGQSWNHQCLSWYQQKPGEKPKLMMLPGNTLRSGTPSRFSGSGSHSDFTLTISGVQAEDAGDYYCQS
Oncorhynchus mykiss V348 igkv MSJN01002405.1 530853 QYVVTQTPAVKAVLPGQTVSLNCKTGSNVYPDCNGSGKPCLAWYQQKPGETPKLLVYHGSTLFSGTPSRFSGSGSGSDFTLTISGVQAEDAGDYYCQS
Oncorhynchus mykiss V349 igkv MSJN01002405.1 544644 SRGQITVTQTPTVKTVLPGEIVSLNCKASIDVQTNCWSSGKPCLAWYQQKPGGAPKLLIYYTTTLQSGTPSRFSGSGSGSDFTLIISGVQAEDAGDYYCQSY
Oncorhynchus mykiss V350 igkv MSJN01002405.1 549117 QYVVTQTPAVKTVLPGETVSLNCTTGSNVYPDCNRSGKPCLAWYQQKPGETPKLLVYHGSTLFSGTPSRFSGSGSGSDFTLTISGVQAEDAGDYYCQS
Oncorhynchus mykiss V351 igkv MSJN01002405.1 554756 ARGHVVTQTPAVKAVVPGQTVSLNCKTSSNVHGNNYLAWYQQKPGGAPKLLIYHAKTLQSGTPSRFSGSGSGSDFTLTISGVQAEDAGDYYCQS
Oncorhynchus mykiss V352 igkv MSJN01002405.1 567864 TRGQYTVTQTPAVKAVSEGLSLSLSCKTSSAVYSDFFGQRMAWYQQKPGGAPKLLIYYTTTLQSGTPSKFSGSGSGSDFTLTISGVQAEDAGDYYCQS
Oncorhynchus mykiss V353 igkv MSJN01002405.1 587755 SRGQYTVNQTPAVKAVSEGLSVSLSCKTSSAVHSDFFGQRMAWYQQKPGGAPKLLIYLAKTLQSGTPSRFVGSGSGSDFTLTISGVQAEDAGDYYCQS
Oncorhynchus mykiss V354 igkv MSJN01002405.1 603788 SRGQYTLTQTPVVKAVGTGEKVNIGCKLSSGIYGNYLAWYLQRSGEAPKLLIYQINNMLTGTPSRFSGSGSGSDFTLTISGVQAEDTGYYYCQS
Oncorhynchus mykiss V355 igkv MSJN01002405.1 614408 QYVVTQTPAVKTVLPGETVSLNCTTGSNVYPDCNRSGKPCLAWYQQKPGETPKLLVYHGSTLFSGTPSRFSGTGSGSDFTLTISGVQAEDAGDYYCQS
Oncorhynchus mykiss V356 igkv MSJN01002405.1 623050 ARGHVVTQTPAVKAVLPGQTVSLNCKTSSNVNGNDRLAWYQQKPGGAPKLLIYHAKTLQSGTPSRFSGSGSHSDFTLTISGVQAEDAGDYYCQS
Oncorhynchus mykiss V357 igkv MSJN01002405.1 634767 SRGQVTVTQTPAVKTVLPGQKVSMICKASSNVHSNCHNGQSWGHQCLSWYQQKPGEKPKLMMLPGNTLRSGTPSRFSGSGSGSDFTLTISGVQAEDAGDYYCQS
Oncorhynchus mykiss V358 igkv MSJN01002405.1 656386 SRGQITVTQTPTVKTVLPGQPVSMNCKASSDVYPDCWSSGKPCLAWYQQKPGGAPKLLVYYGSTLFSGTPSRFSGTGSGSDFTLTISGVQAEDAGYYYCQS
Oncorhynchus mykiss V364 ighv MSJN01002444.1 498112 VQGQSLTSSEPVVKKPRESVTLSCAVSGLSLSYLHWIRQKPGKGLEWIGRIDGGTGTVFAQSLQGQFTITKDGSKNQLYLEVKSLKTEDSAVYYCAR
Oncorhynchus mykiss V365 ighv MSJN01002444.1 725151 VHCGLELTQPSSLDVKPGESLSITCKVSGYSLTDSSNVYGIGWIRQPVGKALEWIWTIYYDGSSSSQSSLKDRFSVTRDTSSNTVFLTGQNLQTEDTAVYYCAR
Oncorhynchus mykiss V371 trgv MSJN01002490.1 14056071 AAEAVNLHQEQLTVTKSSGKSGVIECRATGFNTGNIHWYQQKDGEALKWILFMHKGGGKSTKDPDFEDYQAEKAENSDIFTLTIPTLKTDHVATYYCASFD
Oncorhynchus mykiss V397 igkv MSJN01003205.1 50714 SRGQVTVTQPPVVTFSPGDPVTLTCTTNPKVHRYSDGDEGAFWYQQRPGEAPKLLIRYAKKRLDGIPARFSGSGSERDFTLTISGVQAEDAAVYYCQS
Oncorhynchus mykiss V398 igkv MSJN01003205.1 51971 SRGQVTVTQPPVVTFSPGDPVTLTCTTNPKVHRYSDGDEGAFWYQQRPGEAPKLLIRYAKKRLDGIPARFSGSGSERDFTLTISGVQAEDAAVYYCQS
Oncorhynchus mykiss V399 igkv MSJN01003205.1 57939 SRGQVTVTQPPVVTFSPGDPVTLTCTTNPKVYRYSDGDEGAFWYQKRPGEAPKLLIRYAKKRLDGIPARFSGSGSERDFTLTISGVQAEDSAVYYCQS
Oncorhynchus mykiss V412 trav MSJN01005088.1 1573 LSQTDQVQQTPTAILKGPDDNVQLNCSHTVPNYNMILWYQQSEQDTALKLIGYVLLTNPAVEDSFKGRFTVSGDAATGKMAYLHIPKLRGTEDSAVYFCAASK
Oncorhynchus mykiss V413 trav MSJN01005088.1 6152 QSLSSKVHQTPIAILKGSKDNVQLTCNHAIQNYNTILWYQQSTGDTAMKLIGFAYYKTITMEKSFEKHFNVSGDGGKEAYLHLLSLRAPEDSAVYYCAAS
Oncorhynchus mykiss V414 trav MSJN01005111.1 1511 VSGVTVMTQKPPVVTVRKGETATMDCNLGTVQDNTRWYKQVPGGVPQYVLRWYHTGWSSVKYGSGFSSPKFTSNHQSKSDYRLIINTVEETDSAVYYCQAW
Oncorhynchus mykiss V429 trav MSJN01007267.1 832 QSLSSKVHQTPIAILKGSKDNVRITCNHTIQDYTMILWYQQSPGDTALKLIGYAQYKSITMEKSFEKHFNVSGDGRKEAYLQLLSLRAPEDSAVYYCAAS
Oncorhynchus mykiss V430 trav MSJN01007267.1 1891 QSLSSKVHQTPIAILKGSKDNVRITCNHTIQDYTMILWYQQSKGDTALKLIGYAQYKSITMEKSFEKHFNVSGDGRKEAYLQLLSLRAPEDSAVYYCAAS
Oncorhynchus mykiss V432 trav MSJN01007267.1 16445 QSLSTEVHQIPIAILKGSKDNVQLTCNHTNPSYYTILWYQHSTGDTTMKLIGYVYTKSITMEKSFEKHFNVSGDGRKEAYLHLLSLRAPEDSAVYYCAAS
Oncorhynchus mykiss V433 trav MSJN01007267.1 28093 QSLSSKVHQTPIAILKGSKDNVQLTCNHTIQNYITILWYQQSTGDPAMKLIGFAYYKTITMEKSFEKHFNVSGDGVKEAYLHLLSLRAPEDSAVYYCAAS
Oncorhynchus mykiss V434 trav MSJN01007267.1 31670 QSLSSKVHQTPIAILKGSNDNVQLTCNHTIQDYYTILWYQQSTGDPAMKLIGYVYTESITMEKSFEKHFNVSGDGSKEAYLHLVSLRSPEDSAGYYCAAS
Oncorhynchus mykiss V435 trav MSJN01007267.1 36274 CALGSKVLQVPSALLESPNVTVIIKCSHTISSYNNILWYQQSIADTNLKLIGFVFYKNPTIEDQFKEHFEIRGDGEIEASLQLLSDPENSAVYYCAAS
Oncorhynchus mykiss V436 trav MSJN01007267.1 37195 LSQTDQVQQTPTAILKGPGDNVQLNCSHTVPSYNMILWYQQSEQDTALKLIGYVFLTNPAVEDSFKGRFTVSGDAAAGKMAYLHIAKLRGTEDSAVYFCAATY
Oncorhynchus mykiss V437 trav MSJN01007267.1 42822 LSLSVEVHQTPSAVFSRPGENVQLFCHHNKSDYRVILWYQKLQGETALKLIGYLYYQNPTIESSYGKHFNMSGDLGGDRPKNVSLNIFNFQHPEHSAVYFCAASD
Oncorhynchus mykiss V438 trav MSJN01007267.1 53056 VSLSKVVYQSPSTLLVEPNASVSVPLSCSHKISNYDTILWYQRPVGDTALKLIAYVYFTGQTVEPSYKGYFDVKGDGRNEAFLHLLKLRQVEDSGEYFCAASY
Oncorhynchus mykiss V439 trbv MSJN01007267.1 55690 VLNSSRISQTPEAVIVRPKGSSSLSCSHNTSNVFYMYWYRRPAQSRALTLVGYLYSGTANLETDFTNDRFSLQGNAGSRGDLQISNPTTEDSGEYFCATRE
Oncorhynchus mykiss V449 trav MSJN01023277.1 1022 QSLSTEVHQTPIAILKGSKDNVQLTCNHTNPSYYTILWYQQSPGDTAMKLIGYAQYKSITMEKSFEKYFNMSGDGSKEAYLHLLSLRAPEDSAVYYCAAS
Oncorhynchus mykiss V455 ighv MSJN01032500.1 6236 VYGQTLTESGPVVKKPGESHKLTCTASGFTFSSYVMNWVRQAPGKGLEWIAYISTASTPIYYSQSVQGRFTIARDDSSSKLYLQMNSLKSEDTAVYYCAR
Oncorhynchus mykiss V457 trav MSJN01034600.1 461 QSLSTEVHQTPIAILKGSKDNVQLTCNHAIQNYNTILWYQQSTGDPAMKLIGYVYAESITMEKSFEKHFNVSGNGRKEAYLHLLSLRAPEDSAVYYCAAS
Oncorhynchus mykiss V458 trav MSJN01034600.1 4147 QSLSTEVHQIPIAILKGSKDNVQLTCNHTIKNYITILWYQQSTGDTTMKLIGYVYTKSITMEKSFEKHFNVSGDGRKEAYLQLLSLRAPEDSAVYYCAAS
Oncorhynchus mykiss V470 ighv MSJN01069676.1 785 LNGQSLESIPSSPVLKKPGETLSLSCKISGYTVNSHHTHWIRQPAGKSLEWMGYSGLGLGYHAKTFEGRMETTKDNSNSMLTLKLSGLRAEDSAVYYCARE
Oncorhynchus mykiss V472 trav MSJN01075580.1 15754 CRAEENVTQPTEDVMVVEGQPTTLTCLFYTTNQSPYLFWYKQLANGKPMFMLRKDKFGTGETATEFKDRFEACLNVTAKSASLTIQRLQLYDSAVYYCALR
Oncorhynchus mykiss V477 trbv MSJN01116425.1 131 VIQTVEVIQWPSSICSQPNTSMDMHCSQDAGYDYMYWYRHLQGEGPKLMCSLIGESASYEAEFKSGFRVWRTENPEGMSSVRQWSLTVQMVQRKDQAVYLCAAS
Oncorhynchus mykiss V517 ighv MSJN01000233.1 76760 VQSYELSQPASMTVLPGQPLTISCKVSYSVTNAWTAWIRKPAGKTLEWIGNVYSGDTEHKDSLKNKFSLSVDSSSNTVFLKGQNLQTEDSAVYYCAY
Oncorhynchus mykiss V518 ighv MSJN01000233.1 63419 VQGQTLTESESVVKKPGESHKLTCTYSGFGGNYWNAWIRQAPGKGLEWVATISDGGSTYYPQSVQGRVTISRDNSKQQVYLQMNSLKTEDSAVYYCAR
Oncorhynchus mykiss V519 ighv MSJN01000233.1 40009 VYGQTLTESGPVVKKPGESHKLTCTASGFTFSSYAMNWVRQAPGKGLEWIAYISTASTPIYYSQSVQGRFTISRDDSSSKLYLQMNSLKSEDTAVYYCAR
Oncorhynchus mykiss V520 ighv MSJN01000233.1 1382 VCCDEMDQSPSQVKRPGDKFKLSCKISGFDMTDYYMTWIRQKPGKALEWIGGIDSGSTNSPDYSDSLKGQFSLTEDVSTSTQFLEAKSLSSEDSAVYYCARQ
Oncorhynchus mykiss V526 igkv MSJN01000291.1 4732868 SWGQYVSTQSAAQSVQPGQTVSIDCSTSSKVTQYSGSQYYLAWYHQTSGEAPKLLICYTSDRFTGVSTRFSGSGRGNGVDFTLTISDVQAEDTGVYYCQ
Oncorhynchus mykiss V527 igkv MSJN01000291.1 4730307 SWGQYVSTQSAAQSVQPGQTVSIDCSTSSKVTQYSGSQYYLAWYHQTSGEAPKLLICYTSDRFTGVSTRFSGSGRGNGVDFTLTISDVQAEDTGVYYCQ
Oncorhynchus mykiss V529 igkv MSJN01000305.1 674426 SSADIILTQSPKSQSVSPGETVSISCTASSSTGNYLHWYLQKPGEAPKLLVYSGTNRQSGIPGRFSGGGSGSSYTHYTLTISGVQAEDAGDYYCQQSNSSP
Oncorhynchus mykiss V530 igkv MSJN01000305.1 671105 SAADITLTQSPKSQSVSPGETVSISCTASSSTGNNLHWYLQKPGEAPKLLVYTGTTRQSGIPGRFSGSGSGSPYTHYTLTISGVQAEDAADYYCQQGASFP
Oncorhynchus mykiss V531 igkv MSJN01000305.1 657193 SAADITLTQSPKSQSVSPGETVSISCTASSSTGNNLHWYLQKPGEAPKLLVYTGTTRQSGIPGRFSGSGSRFPYTHYTLTISGVQAEDAADYYCQQGASFP
Oncorhynchus mykiss V532 igkv MSJN01000305.1 650560 SSADIILTQSPKSQSVSPGETVSITCTASSSTGNNLQWYLQTPGEAPKLLVYHGTNRQSGIPGRFSGSGSGSSNTHYTLTISGVQAEDAGDYYCQQGSSYP
Oncorhynchus mykiss V533 igkv MSJN01000305.1 633226 SSADIILTQSPKSQSVSPGEVVSISCTASSSTSDYLHWYLQKPGEAPKLLVYSGTTRQSGIPGRFSGSGSGSSYTHYTLTISGVQAEDAGDYYCQQGQSFP
Oncorhynchus mykiss V534 igkv MSJN01000305.1 619444 SSADIILTQSPKSQSVSPGETVSISCTASSNTGNNLQWYLQTPGEAPKLLVYHGTNRQSGIPGRFSGSGSVSPYTHYTLTISGVQAEDAGDYYCQQGGSYP
Oncorhynchus mykiss V535 igkv MSJN01000305.1 614366 SAADIILTQSPKSQSVRPGETVSISCTASSNTGNVLSWYLQKPGEAPKLLVHSATTRHSGIPGRFSGSGSGSSYTHYTLTISGVQAEDAGDYYCQQGL
Oncorhynchus mykiss V536 igkv MSJN01000305.1 589242 SSADIILTQSPKSQSVSPGEVVSLSCTASSNTGNYLQWYLQKPGEAPKLLVYTGTNRQSGIPGRFSGSGSGSPYTHYTLTISGVQAEDAGDYYCQQGQSFP
Oncorhynchus mykiss V537 igkv MSJN01000305.1 581646 SSADITLTQSPKSQSVSPGETVSISCTASSRTSDYLHWYLQKPGEAPKLLVYDATTRQSGIPGRFSGSGSGSPYTHYTLTISGVQAEDAGDYYCQQSNSFP
Oncorhynchus mykiss V564 igkv MSJN01000483.1 7500 SSAGVVTQSPTVKSVRLGETVYLSCTASKGVDDDLSWYLQKPGQSPQLLFYKISQRHSETPGHFSSSGSQPDFTLTISVVQAEDVGDYYCMGL
Oncorhynchus mykiss V583 trav MSJN01000675.1 120728 SSPSNQVYQSPASLYKKQGKSAKMVCSHSISGYDRVLWYKQSNYTEFVYLGYMLLKSGYPEAGFDIEGDANAGGTSTLTIKQLTPNSSAVYYCAAS
Oncorhynchus mykiss V584 trbv MSJN01000675.1 115640 LVEGSGVTQTPTILWELKESDALMNCSHTKDSSYYQMYWYRQLPGEGMKQVVFITPSSQPDYSGEFSKDKFSARKAVAESGSFTVKKLETGDSGMYFCAVS
Oncorhynchus mykiss V585 trav MSJN01000675.1 114140 QLFSSMVHQRPVALTEDPGGDVQLTCSHTIPNYYVILWYKQSAGDTAMKLIGYANYKSITMEKSFEKHFNVSGDGGKEAYLHLVSLRGPEHSAVYYCAAS
Oncorhynchus mykiss V586 trbv MSJN01000675.1 112938 LSQTDKDHQTPTAILKGPEDKVNLTCSHTVSNYDMILWYQQSAQNTALKLIGYVRYTSPTVEDSFKGRFDVSGDAAANKMAYLHFPKVPEAEDSAVYFCAASE
Oncorhynchus mykiss V587 trav MSJN01000675.1 109736 SSPGNQVHQGPADLYKNQGELAKMECSHSISTYNVILWYKQSNYREFVFLGYMIGTSGSPDPGFDIEGDANAGGTSTLTIKQLTPNSSAVYYCAAS
Oncorhynchus mykiss V588 trbv MSJN01000675.1 105361 LVEGSGVTQTPTILWELKERDALMNCSHTKGSGYFQMYWYRQLPGEGMKQVVFITPSSQPDYSGEFSKDKFSASKAVAESGSFTVKKLETGDSGMYFCAVS
Oncorhynchus mykiss V589 trbv MSJN01000675.1 102979 LSQTDKVHQTPTAILKGPEDKVNLTCSHTVSSYNMILWYQQSSQNTALKLIGYVRFTSPTVEDSFKGRFDVSGDAAANKMAYLHFPKVPEAEDSAVYFCAASE
Oncorhynchus mykiss V590 trav MSJN01000675.1 99414 SSLSNQVHQTPAALYKNQGELAKMECSHSISNYNQILWYKQSNYRELVLIGYMVGTSGFPEVGFDIEGDANAGGTSTLTINQLTPNSSAVYYCAAS
Oncorhynchus mykiss V591 trav MSJN01000675.1 96774 LSQTDKVHQTPTAILKGPEDKVNLTCSHTVSSYDTILWYQQSAQNTALKLIGYVRYTSTTVEDSFKGRFDVSGDAAANKMAYLHFPKVPEAEDSAVYFCAASE
Oncorhynchus mykiss V592 trav MSJN01000675.1 86345 SSLSSKVLQVPSALLESPNVTVIIKCSHAISSYNTILWYQQSIADTNLKLIGFVFYKNPTIEDQFKQHFEIRGDGEIEASLQLLSDPENSAVYYCAA
Oncorhynchus mykiss V593 trav MSJN01000675.1 81607 SSPSNQVHQGPADLYKNQGELAKMECSHSISTYNVILWYKQSNYREFVFLGYMIGTSGSPEAGFDIEGDANAGGTSTLTINQLTPNSSAVYYCAAS
Oncorhynchus mykiss V594 trbv MSJN01000675.1 76491 LVEGSGVTQTPTILWELKEIDAQMNCSHTKGSSYYQMYWYRQLPGEGMKQVVFITPSSQPDYSGEFSKDKFSARKAVAESGSFTVKKLETGDSGMYFCAVS
Oncorhynchus mykiss V595 trav MSJN01000675.1 74141 QLFSSMVHQRPVALTEGPGGDFQLTCSHTIPNYYVILWYKQSAGDTAMKLIGYANYKSITMEKSFEKHFNVSGDGGKEAYLHLVSLRGPEHSAVYYCAAS
Oncorhynchus mykiss V596 trbv MSJN01000675.1 73078 LSQTDKVHQTPTAILKGPEDKVNLTCSHTDQRYDRILWYQQSAQNTALKLIGYVWNTSPTVEDSFKGRFDVSGDAAANKMAYLHFPKVPEAEDSAVYFCAASE
Oncorhynchus mykiss V597 trav MSJN01000675.1 70706 SSPSNQVHQGPADLYKNQGELAKMECSHSISTYNVILWYKQSNYRELVFLGYMQLKTGFPEAGFDIEGDANAGGTSTLTIKQLTPNSSAVYYCAAS
Oncorhynchus mykiss V598 trbv MSJN01000675.1 64088 LVEGSEVNQTPTILWGPKDSDAQINCSHTKGATYNQMYWYRQLPGEGMKQVVYTSSYSDPEYGDFREDKYPTVKAVAESGSFTVKKLETGDSGMYFCAVS
Oncorhynchus mykiss V599 trbv MSJN01000675.1 60048 LSQTDKVHQTPTAILKGPEDKVNLSCSHTDSNYYRILWYQQSSQNTALKLIGYVRYTSPMVEDSFKGRFDVSGDAAANKMAYLHFPKVTEAEDSAVYFCAASE
Oncorhynchus mykiss V600 trav MSJN01000675.1 56767 SSLSNQVHQTPAALYKKQGELSKMECSHSISTYNVILWYKQSNYRELVLLGYLFGKDGYPEAGFDIEGDANAGGTSTLTIKQLTPNSSAVYYCAAS
Oncorhynchus mykiss V601 trbv MSJN01000675.1 52160 LCLSVEVHQTPSAVFSRPGENVQLFCQHQKTDYRVMLWYQKSQGETALKLIGNLYHKNPTIESSYEKHFNMSGDLGGGGPKNASLNMFNLRRPQHSAVYFCAASY
Oncorhynchus mykiss V602 trbv MSJN01000675.1 46434 LCLSVEVHQTPSAVYSRPGENVQLFCQHQKTDYTLMLWYQKPQGETALKLIGYLNFNSQTIESSHEKHFNMSGDLGGGGPKNASLNMFNLKRPQHSAVYFCAASY
Oncorhynchus mykiss V603 trbv MSJN01000675.1 39894 LGLGTRVVQTPADLVTTPGDSADLHCSHTIKDYDVILWYRQTHSQDRKLQLLGYLYRDNKNPESSFKDKIKLRGNAEQYCDLSVSNLTQEDSAVYFCAAR
Oncorhynchus mykiss V604 trgv MSJN01000675.1 33911 SCVSLSVQQSPRHLTKRPGNTLKMTCSHHDRNYDKIYWYRQTDGQKLQLIGFLSFKQALDVAENFNISGDAEDEGFLGSLAVRVEDTGLYYCAVSK
Oncorhynchus mykiss V605 trgv MSJN01000675.1 28628 FCDGITVKQSPVLSVCRKGDASVTLQCYHDDSSYYYMFWYRQRDNNMEMLTYSQGQGLWEIQPPFEKDVHYTMSRPELTRSTLEIKNLEVGDRAVYYCASST
Oncorhynchus mykiss V610 trav MSJN01000710.1 88140 CKGEEGVEQQSGHVTALEGGLVTLSCNYTTSSPSSNLFWYVQLPRDSPQYVLRRDRYSGGSNSDEFKKRFDSRLNFTSSSVPLTIQRLQVSDSALYFCALR
Oncorhynchus mykiss V613 trav MSJN01000710.1 65045 CKGEEAVDQQSGHVTALEGGLVTLSCNYTTSSPSSNLFWYVQLPRDSPQYVLRRDRYSEGSNSDEFKKRFDSRLNFTSSSVPLMIQRLQLSDSAVYYCALR
Oncorhynchus mykiss V614 trav MSJN01000710.1 60465 EDSVLQPPGDVIATEGEQVTLDCQFDTLDTNPYLFWYKQGANDFPKYMLRRATFGSDNAIEFLGRFDAHLNLTTLKSASKSFPLTIQRLQLSDSAVYYCALR
Oncorhynchus mykiss V616 trav MSJN01000710.1 50689 CRGEDSVIQPPGDVITTEGEQITLDCQFESDDTRNLNLFWYKHELNGFPEFMLGRFPFGSKNATEFKDRFDAHLDADSKSVPLTIQRVQLSDSAVYYCALR
Oncorhynchus mykiss V617 trav MSJN01000710.1 42784 CTGDHVQQQPEGVIATEGGLVKLSCQYNTSANNDVYLFWFKPEANDFPKQMLSRYSFGSGDNAAGFKERFNASLNAKTQSVPLMIQRLQLSDSAVYYCALR
Oncorhynchus mykiss V618 trav MSJN01000710.1 40038 LVGYTLEDDITPTSPEEYYLEGSRVKISCNYTVKADNLQWYRQYPGSAPQFLLLLTHTATPLVVEATPPYPRMTAKLNDERTRVDLEISSADVTDSALYYCALQ
Oncorhynchus mykiss V619 trav MSJN01000710.1 37755 LSSEQVLSPYTDVEVASERDRVTLSCNYSSGVSSGVTLQWYRQYPQSAPLLLVMEHMTAKTPGFLLNHDKKAKRVDLEISSAQVTDSALYYCAIE
Oncorhynchus mykiss V620 trdv MSJN01000710.1 13309 CRAEENVTQPTEDVMVVEGQPTKLSCLFVTTDQSPYLFWYKQLANGKPMLMLRRERFGVGETATEFKNRFDAHLNVTARSVPLIQSVQLSDSAEYYCALR
Oncorhynchus mykiss V621 trav MSJN01000710.1 2225 CRGDRVLQTKGVVTATEGVQITLVCHYETDDPGPYLFWYKQGANDYLKYMLMRHKFGTGDNATEFKERFHADLDANSKSVPLTIQRVQLSDSAVYYCALK
Oncorhynchus mykiss V644 ighv MSJN01001004.1 1062952 VHCEELTQPASMTVQSGQPLTISCKVSYSVGSYYTAWIRQPAGKTLEWIGMKYTGGTHHKDSLKNKFSLTVDSSSNTVTLTGQSLQTEDTAVYYCAR
Oncorhynchus mykiss V645 ighv MSJN01001004.1 1058766 VHCQVVLTQAEQSVQGTPAGSLKLTCACSGITLSSSYMHWVRQAPGKGLEWIIYYYSDSDKSNAPVVQGRFTASKDSTNFYLHMSQLKSEDSAMYYCARD
Oncorhynchus mykiss V646 ighv MSJN01001004.1 974637 VQGQSLTSSEPVVKRPSESVTLSCTVSGFSMGSYWMQWIRQKPGKGLEWIGFIDTGTTAYYAQSLQGQFTITKDTSKNQLYLEMKSLKTEDSAVYYCAR
Oncorhynchus mykiss V650 ighv MSJN01001047.1 2797 VHCGLELTQPSSLDVKPGESLSITCKVSGYSLTDSSNVYGIGWIRQPVGKALEWIWTIYYDGSSNSQSSLKDRFSVTRDTSSNTVFLKGQNLQTEDTAVYYCAR
Oncorhynchus mykiss V750 trav MSJN01001962.1 9738132 CKGEDSVIQPPGDVITTEGEQVTLGCQFDAVNINNLNLFWYKHELNGFPEFMLGRFSFGSKNATEFKDRFDANLDAGSKSVPLTIQRVQLSDSAVYYCALR
Oncorhynchus mykiss V751 trav MSJN01001962.1 9737425 CRGDRVLQPKGVETAAEGGQITLVCHYETDDSGPYLFWYKQGANDFPKYMLMRFKFGTGDNATEFKKRFHADLDASSKSVPLTIQRVQLSDSAVYYCALT
Oncorhynchus mykiss V752 trav MSJN01001962.1 9729655 DTSEQTIEPNQHEGYAEVGSNVLLSCNYSSADSLLWYKQSPGSAPQYLLLIPHYSGIGQRADSLDSRFSGKLNKEKTRVDLDISSVEETDSAMYYCALR
Oncorhynchus mykiss V753 trav MSJN01001962.1 9720729 CRGEDSVIKPPEDVIATEGEQVILDCQFDAVNMNDIYLFWYKLEVNDFPKFMLGRFPFGSKNATEFKDRFDAHLDADSKSVPLTIQRVQLSDSAVYYCALR
Oncorhynchus mykiss V754 trav MSJN01001962.1 9720023 CRGDRVLQTKGVETAAEGGQITLVCHYETDDPSPYLFWYKQGANDFPKYMLLRFKFGTGDNATEFKERFHADLDANSKSVPLTIQRVQLSDSARYYCALK
Oncorhynchus mykiss V755 trav MSJN01001962.1 9708779 VSFEDDINPTRRMVDGVEGDTITLSCSYTGSVNNLQWYRQYLRSKPEFLILITKSGYVQKPVPPRMSAQVQTDRTDLEISSAEVTDSALYYCALE
Oncorhynchus mykiss V757 trav MSJN01001962.1 9693540 CRGDRVLQPKGVEMAAEGGQITLVCHYETDDPSPYLFWYKQGANDFPKYMLLRQKFGTGDNSTEFKERFHADLDANSKSVPLTIQSVQLFDSAVYYCALR
Oncorhynchus mykiss V758 trav MSJN01001962.1 9687722 QIAGDHINPVNNEVISTEGELVTLSCSYDTSGEYPLLYWYRHYSNQAPQFLLYKGARSWSSEEHIPDKRYTSTTSRTSTELVITSLTLADTALYYCAL
Oncorhynchus mykiss V760 trav MSJN01001962.1 9682091 MVCGDSVTPDKEEYTPTEGSSVTLRCTYETISDYTSLYWYRHYPNQAPQFLLYKGARSRSREHIPDKRYKSTTSQTSTELVITSLTLADTALYYCAL
Oncorhynchus mykiss V763 trav MSJN01001962.1 9649640 GSYEQTIEPNQHEVYAEVGSNVLLSCNYSSAESLLWYKQSPGSAPQYLLLIPHYSGAGQRADSLDSRFSGKLNKEKTRVDLEISSAEETDSAMYYCALK
Oncorhynchus mykiss V767 trav MSJN01001962.1 9626205 LSSEQVLTPYSDVEVASERERVTLSCNYSSGVSSGVTLQWYRQYPQSAPLLLVMEHMLAKTPGFLLNHDKKAKRVDLEISSADVTDSALYYCALQ
Oncorhynchus mykiss V769 trav MSJN01001962.1 9613458 GSYEQTIEPNQHEVYAEVGSNVLLSCNYSSADSLLWYKQSPGSAPQYLLLIPHYSGIEQRADSLDSRFSGKLKKEKTRVDLEISSAEETDSAMYYCALK
Oncorhynchus mykiss V771 trgv MSJN01001962.1 9605426 MVCGDSVTPDKEEYTPTERSSVSLRCTYETSSEYVHLYWYRHYCNQAPQFLLYKGARSWSSEEHIPDKRYKSTTSRTSSELVISSLTLADTALYYCALREY
Oncorhynchus mykiss V773 trav MSJN01001962.1 9586431 CRGEENVRQPTEDVMVVEGHPTTLTCLFDTSQSPYLFWYKQLANGKPIFMLRRDAFSPGESSTEFKDRFDAHLNVSGKSVPLTIQRVQLSDSAVYYCALR
Oncorhynchus mykiss V776 trav MSJN01001962.1 9558017 CRAEESVIQATEDVMVVEGQPTTLTCLFDTTDQSPYLFWYKLANGIPIFMLRRDTFSPGESATEFKDRFDAHLNVSGKSVPLTIQRVQLSDSAVYYCALR
Oncorhynchus mykiss V777 trav MSJN01001962.1 9555665 CRAEENVRQPKEDLMVVEGHPTTLTCLFDTTSQSQYLFWYKQLANGKPIFMLRRDPFSPGESASEFKDRFDAHLNVTAKSVPLMIQRVQLSDSAVYYCALR
Oncorhynchus mykiss V778 trav MSJN01001962.1 9550613 DTYEQTTEPSQHDVYAEPGNNVLLSCNYSSADSLLWYKQSPGSAPQYLLLILDSTGTEHRADSLDSRFSGKLNKEKTRVDLENSSAQVTDSALYYCSLR
Oncorhynchus mykiss V779 trav MSJN01001962.1 9536110 GSYEQTIEPNQHEVYAEIGSNILLSCNYSSADSLLWYKQSPGSAPQYLLLIQHYTGTEHRADSLDSRFSGKLNKEKTRVDLKISSAEVTDSALYYCALR
Oncorhynchus mykiss V782 trav MSJN01001962.1 9515945 CIGDNVQQQPGSVIATEGGLVTLSCQYNTSATNFAYLYWYKQEANDFPKQMLSRFSTGSGDNAAGFKERFNASLNAKTQSVPLTIQRLQLSDSAVYYCALR
Oncorhynchus mykiss V783 trav MSJN01001962.1 9514102 DSNGQTIEPIREEVYAPAGSNITLSCTYSSAVSLQWYLQNPGSAPQYILLILHGVGSPSRAPGLDPRLSVKLNNEKNRVDLEISSAKEEDSAMYYCALK
Oncorhynchus mykiss V784 trav MSJN01001962.1 9510287 MVYGDSVTPDKKEYTPTERSSVSLSCTYETSSEFIYLYWYRHYPNQAPQFLLYKGARSWSSDEHIPDKRYTSTTSRTSTELVITNLTLADTALYYCALREY
Oncorhynchus mykiss V785 trav MSJN01001962.1 9490022 DTYEQTIEPNQHEVYAEVGSNVLVSCNYSSANILLWYKQSPGSAPQYLLLIPHYSGIGQGADSLDSRFSGKLNEEKTRVDLEISSAEVTDSALYYCALR
Oncorhynchus mykiss V787 trav MSJN01001962.1 9475545 MVSGDGVTPDKEEYTPTEGSSVSLRCTYETSSSNIYLYWYRHYPNQAPQFLLYKSARSLSGEHIPDKRYQSTTSWTSTELVITSVTLADTALYYCALREY
Oncorhynchus mykiss V788 trav MSJN01001962.1 9470473 DSMEQETISPVKPEVNALQGTDITLSCNYKGNIINLQWYRQSPGSRPECLLLIRQSGMYIQNTSITTTRHTGRLNEEKTRVDLMISSVELEDSALYHCALQ
Oncorhynchus mykiss V789 trgv MSJN01001962.1 9453667 QNYGDHITPVNNEVISTEGELVTLRCSYDTSYENIWLYWYWHYPKQAPQFLLYKGARSWSSEHISDKRYKPTTSRTSTELVITSLTLADTALYYCARRDD
Oncorhynchus mykiss V790 trav MSJN01001962.1 9429817 CRAEENVTQPTEDVMVVEGQRTKLSCTFDTTDLSPYLFWYKQQPNGNPMFLQSKYTFGVNEFKGRFHARLNVTAKSFPLTIQRLQLSDSAVYYCALK
Oncorhynchus mykiss V791 trav MSJN01001962.1 9428840 CAGDQVQQQPGGVIATEGGLVKLSCQYNTSANNNDAYLYWFKQEENDFPKHMLSRYSFGSGDNAAGFKERFNASLNSKTQSVPLMIQRLQLSDSAVYYCAL
Oncorhynchus mykiss V792 trav MSJN01001962.1 9420326 CKGEEAVDQQSGHVTALEGGLVTLSCNYTTSSLSPDLFWYIQLTRDTPQYVLRRYRYSGGSNSDEFKKRFDSGLNFTSSSVPLTIQRLQLSDSALYLCALR
Oncorhynchus mykiss V793 trav MSJN01001962.1 9419594 CRGEDTVIQPPGDVTATEGGQVTLDCQFDAVNTNNLYLFWYKHELHGFPKFMLGLFSFRSTNATGYEERFDAHLDKDSKSVPLTIQRVQLSDSAVYYCALK
Oncorhynchus mykiss V794 trav MSJN01001962.1 9417185 DTLEDDITPTSPEEYYLEGSRVKISCNYTVKSDSLLWYRQYSGSGLQFLYLVTTTNNPYDVRGDPQDFRLTVTQNKERTRVDLEISSVEETDSALYYCALR
Oncorhynchus mykiss V795 trav MSJN01001962.1 9406598 DSMEQETITPVKPEVNALQGTDITLSCNYKGNVNNLQWYRQYPGSRPECLLWILQSSMHVQKQSITTPRHTGRLNEEKTRVDLMISSVELEDSALYHCALQ
Oncorhynchus mykiss V796 trav MSJN01001962.1 9404063 CRGEEAVDQQSGHVTALEGGLVTLSCNYTTSSPSPDLFWYIQLTRDTPQYVLRRDRYSEGSNSDKFKKRFDSRMNFTSSSVPLTIQRLQLSDSAVYYCALR
Oncorhynchus mykiss V797 trav MSJN01001962.1 9402152 CTGADSITQSTREVTAYEGEDVSLNCEYNTSLSAPSLFWYIQYTNDYPEYVLQKDVIGPGDIDDRFKERFDAHLSSITKLVPLTIQRLQLSDSAVYYCALK
Oncorhynchus mykiss V798 trav MSJN01001962.1 9398804 CRAEESVIQPTEDVMVVEGQPTKLSCTFDTTNLSPYLFWYKQQANGKPMFMLREDKFGTGETATEFKERFHARLNVTAKSVPLTIQRLQLSDSAVYYCALK
Oncorhynchus mykiss V799 trav MSJN01001962.1 9389040 CRGADGVTQSTREVTAYEGEDVSLNCAYNTSLSAPSLFWYIQYTNDYPEYVLRKDVIGPGDIDDRFKERFDAHLSSITKLVPLTIQRVQLSDSAVYYCALK
Oncorhynchus mykiss V800 trav MSJN01001962.1 9385579 CRAEESVIQPTQDVMVVEGQPTQLSCTFDTTDLSPYLFWYKQQANGKPMFMLREDKFGTGETATEFKERFHARLNVTAKSVPLTIQRLQLSDSAVYYCALR
Oncorhynchus mykiss V801 trav MSJN01001962.1 9384572 CTADHVQQQPGGVIATEGGLVTLSCQYNTSANNAYLYWFKQEENDFPKYMLSRYSFGSGDNATGFKERFYARLDADSKSVPLTIQRVQLSDSAVYYCALQ
Oncorhynchus mykiss V802 trav MSJN01001962.1 9375375 EDSVIQSPGDLTATEGEQVTLGCQFDTVDGNPYLFWYKQRANDFPKYMLKRATFGSDNAIEFQRRFDAHLNLTTFKSESKSVPLTIQRLQLSDSAVYYCALR
Oncorhynchus mykiss V805 trav MSJN01001962.1 9345697 SSYEEEIISATTKERVFEGGGITLSCNYTGSYSSDSLLWYQQYPRSKPEFLLLITEAGLKIHNESIHPRLSVKLNEEKTHVDLEISSAEVTDSALYYCALR
Oncorhynchus mykiss V806 trav MSJN01001962.1 9343368 SSYEEEIISATTKERVFEGGGITLSCNYTGSYSSDSLLWYQQYPRSKPEFLLLITEAGLKIHNESIHPRLSVKLNEEKTHVDLEISSAEVTDSALYYCALR
Oncorhynchus mykiss V807 trav MSJN01001962.1 9338642 SSYEEEIISATTKERVFEGGGITLSCNYTGSYSSDSLLWYQQYPRSKPEFLLLITEAGLKIHNESIHPRLSVKLNEEKTHVDLEISSAEVTDSALYYCALR
Oncorhynchus mykiss V809 trav MSJN01001963.1 36041 GSYEQTIEPNQHEVYAEVGINVLLSCNYSSAYSLPWYKQSPGSAPQYLLLILDSTGTEHRADSLDSRFSGKLNKEKTCVDLEISSAEVTDSALYYCALR
Oncorhynchus mykiss V810 trav MSJN01001963.1 28912 CRAEENVTQPTEDVMVVEGQPTTLTCLFYTTNQSPYLFWYKQLANGKPMFMLRKDKFGTGETATEFKDRFEACLNVTAKSASLTIQRLQLYDSAVYYCALR
Oncorhynchus mykiss V871 ighv MSJN01002444.1 750885 VQSYELSQPASMTVLPGQPLTISCKVSYSVTNTWTSWIRKPAGKTLEWIGNVYSGDTQYKDSLKNKFSLSVDSSSNTVFLKGQNLQTEDSAVYYCAY
Oncorhynchus mykiss V872 ighv MSJN01002444.1 715542 VYGQTLTESGPVVKKPGESHKLTCTASGFTFSSYVMNWVRQAPGKGLEWIAYISTASTPIYYSQSVQGRFTISRDDSSSKLYLQMNSLKSEDTAVYYCAR
Oncorhynchus mykiss V873 ighv MSJN01002444.1 682929 SLTLQPGQPLTLSCKVSGYSLTSSSYCTGVNRQPTGKALEWIGYICYNGNTYDSDKLKNKFSISRDTSSSTVTLTGQSLQTEDTAVYYCARY
Oncorhynchus mykiss V875 ighv MSJN01002444.1 648880 VYCDIELIQSGPVVIEPGVSFSISCKFSGFSISSYCLGWIRQAEGKALEHVGVTCSSSTYTVDSLKSKITSRYDSSSSTVFLQGNNFQTEDTAVYYCARR
Oncorhynchus mykiss V876 ighv MSJN01002444.1 639608 VCCDIRLDQSPSQVKIPGHSVKVSCIISGYSMTSYDIHWIRQKPGKGLEWIGRMNTGSGTDVIYADSLKGQFYLTEDVSTSTQFLEAKSLSSEDSAVYYCARQ
Oncorhynchus mykiss V877 ighv MSJN01002444.1 626335 VCCDEMDQSPSQVKRPGDTFKLSCKISGFDMTDYFMHWIRQKPGKALEWIGGIYSGSTDAPVYSDSLKGQFILTEDISTSTQFLEAKSLSSEDSAVYYCARE
Oncorhynchus mykiss V878 ighv MSJN01002444.1 591343 VNSQTLTESGPVVKNPGETHKLTCTYDGMSNNNAHISWIRQAPGKGLEWVCHISAPSGADKYYSKSVQGRFTISRDNSKQQVYLQMNNLKTEDSAVYYCAR
Oncorhynchus mykiss V879 ighv MSJN01002444.1 583714 VQSQTLTESGPVVKKPLEAHKLTCTASNLDINGYWIAWIKQAPGKGLEFVAAHYNIRNIAYSQSVQGRFTISRDNSMKQVYLQMNSLKTEDSAVYYCAR
Oncorhynchus mykiss V880 ighv MSJN01002444.1 569249 VQGQRLIQSGPVVKKPEEPHKLTCTASDLDMNSYWMAWIRQAPGKGLEWVATITHNSRSTFYPQSVQGRFIISRDNSIKQVYLQMNSLKTEDSAVYYCAR
Oncorhynchus mykiss V881 ighv MSJN01002444.1 548193 LNGQSLESIPSSPVLKKPGETLSLSCKISGYTVDSHSTHWIQQPAGKSLEWMGYSGLGLGYHAKTFEGRMETTKDNSNSMLTLKLSGLRAEDSAAYYCARE
Oncorhynchus mykiss V882 ighv MSJN01002444.1 543985 VYCDIELIQSGPVVIEPGVSFSISCKFSGFSISSYCPHWIRQTEGKALEYVGYTCSSSTYTVDSLKSKITSRYDSSSSTVFLQGNNFQTEDTAVYYCARR
Oncorhynchus mykiss V883 ighv MSJN01002444.1 538952 VYCDIELIQSGPVVIEPGVSFSISCKFSGFSISSYCLGWIRQAEGKALEHVGYTCSSSTYTVDSLKSKITSRYDSSSSTVFLQGNNFQTKDTAVYYCARE
Oncorhynchus mykiss V884 ighv MSJN01002444.1 527518 VHCEELTQPASMTVQPGQPLTISCKVSYSVASYWTAWIRQPAGKGLEWIGQIYTGNTIYKDSLKNKFSLTLDSSNKIVTLTGQNLQTEDTAVYYCARD
Oncorhynchus mykiss V885 ighv MSJN01002444.1 507042 VQSQTLTESGPVVKKPLEAHKLTCTASNLDINGYWIAWIKQAPGKGLEFVAAHYDIRNIAYSQSFQGRFTISRDNSMKQVYLQMNSLKTEDSAVYYCAR
Oncorhynchus mykiss V886 igkv MSJN01002456.1 1726760 SRGQITVTQTPAVKAVSVGHSVIFSCKTSSAVHSNSNGHYLHWYQQKPGGAPKLLIYWAKTLQSGTPSRFSGSGSGSDFTLTISGVQAEDAGDYYCQS
Oncorhynchus mykiss V887 igkv MSJN01002456.1 1724187 SRGQVTVTQTPAVKAVSVGHSVSFSCKTSSAVYSDTHGQRLAWYQQKLGESPKLLTYFISTRNSGTPSRFSGSGSGSDFTLTISGVQTEDAGDYYCQS
Oncorhynchus mykiss V888 igkv MSJN01002456.1 1719961 SRGQVTVTQTPAVKAVSMGHSVSLSCKTSSAVYSDTHGQRLAWYQQKPGGAPKLLIYFAKTLQSGTPSRFSGSGSGSDFTLTISGVQAEDTGDYYCQS
Oncorhynchus mykiss V889 igkv MSJN01002456.1 1716870 SRGQVTVTQTPAVKAVSMGHSVSLSCKTSSAVYSDTHGQRLAWYQQKLGESPKLLTYFISTRNSGIPPRFSGSGSGSDFTLTISGVQAEDAGDYYCQS
Oncorhynchus mykiss V890 igkv MSJN01002456.1 1707548 SRGQVTVTQTPAVKAVSVGHSVIFSCKTSSAVHSNSNGHYLHWYQQKPGGAPKLLIYFAKTLQSGTPSRFSGSGSGSDFTLTISGVQTEDTGDYYCQS
Oncorhynchus mykiss V891 igkv MSJN01002456.1 1686967 SRGQVTVTQTPAVKAVSVGHSVSFSCKTSSAVHSDKHGQRLAWYQQKLGESPKLLTYFISTRNSGIPPRFSGSGSGSDFTLTISGVQAEDTGDYYCQG
Oncorhynchus mykiss V892 igkv MSJN01002456.1 1671257 SRGQVTVTQTPAVKAVSVGHSVSLSCKTSSAVYSDSSGHFLQWYQQKPGGAPKLLIYWAKTLQSGTPSRFSGSGSGSDFTLTISGVQAEDAGDYYCQS
Oncorhynchus mykiss V893 igkv MSJN01002456.1 1656432 SRGQVTVTQTPAVKAVSVGHSVSLSCKTSSAVYSNSNGHFLHWYQQKPGGAPKLLIYWAKTLQSGTPSRFSGSGSGSDFTLTISGVQSEDAGHYYCQSYQSGPV
Oncorhynchus mykiss V894 igkv MSJN01002456.1 1651533 SRGQVTVTQTPAVNAVSVGHSVSFSCKTSSAVYSDTHGQRLAWYQQKLGESPKLLTYFISTRNSGIPPRFSASGSGSDFTLTISGVQAEDAGDYYCQS
Oncorhynchus mykiss V895 igkv MSJN01002456.1 1647620 SRGQVTVTQTPAVNAVSVGHSVIFSCKTSSAVHSNSNGHYLHWYQQKPGGAPKLLIYYAKTLQSGTPSRFSGSGSGSDFTLTISGVQAEDAGDYYCQS
Oncorhynchus mykiss V896 igkv MSJN01002456.1 1622237 SRGQVTVTQTPAVKAVSVGHSVSLSCKTSSAVYSDTHGQRLAWYQQKLGESPKLLTYFISTRNSGIPSRFSGSGSGSDFTLTISGVQAEDTGDYYCQS
Oncorhynchus mykiss V897 igkv MSJN01002456.1 1607301 SRGQVTVTQTPAVKAVSVGHSVSLSCKTSSAVYSDSSGHFLQWYQQKPGGAPKLLIYWAKTLQSGTPSRFSGSGSGSDFTLTISGVQTEDAGDYYCQS
Oncorhynchus mykiss V898 igkv MSJN01002456.1 1594283 SRGQVTVTQTPAVKAVSVGHSVSLSCKTSSAVHSNSNGHYLHWYQQKPGGAPKLLIYWAKTLQSGTPSRFSGSGSGSDFTLTISGVQTEDAGDYYCQS
Oncorhynchus mykiss V899 igkv MSJN01002456.1 1579487 SRGQVTVTQTPAVKAVSVGHSVSLSCKTSSAVYSNSNGHFLHWYQQKPGGAPKLLIYWAKTLQSGTPSRFSGSGSGSDFTLTISGVQAEDAGDYYCQS
Oncorhynchus mykiss V900 igkv MSJN01002456.1 1575786 SRGQVTVTQTPAVKAVSVGHSVSLSCKTSSAVYSDTHGQRLAWYQQKLGESPKLLTYFISTRNSGTPSRFSGSGSGSDFTLTISGVQAEDAGDYYCQS
Oncorhynchus mykiss V901 igkv MSJN01002456.1 1532992 SRGQVTVTQTPAVKAVSVGHSVSLSCKTSSAVHSNSNGHYLHWYQQKPGGAPKLLIYWAKTLQSGTPSRFSGSGSGSDFTLTISGVQTEDAGDYYCQS
Oncorhynchus mykiss V902 igkv MSJN01002456.1 1521283 SRGQVTVTQTPAVKAVSVGHSVSLSCKTSSAVYSDGNGHYLHWYQQKPGGAPKLLIYWAKTLQSGTPSRFSGSGSGSDFTLTISGVQAEDTGDYYCQS
Oncorhynchus mykiss V903 igkv MSJN01002456.1 1516958 SRGQVTVTQTPAVKAVSVGHSVSLSCKTSSAVYSDSNGHYLHWYQQKPGGAPKLLIYYAKTLQSGTPSRFSGSGSGSDFTLTISGVQTEDAGDYYCQS
Oncorhynchus mykiss V904 igkv MSJN01002456.1 1509807 SRGQIIVTQTPAVKAVLPGHSISLNCKASSNVYGDCHNGQSWGHQCLSWYQQKPGENPKLMMLPGNTLQSGTPSRFSGSGSGSDFTLTISRVQTEDAGDYYCQS
Oncorhynchus mykiss V905 igkv MSJN01002456.1 1494910 CAGDILLTQTPAVVVVQSGESATISCKASSAIDDDLAWYHQKPGEAPKFIIDFNTGLTSGRYQGTGYDMDFTLTISGVQAEDAGDYYCQQHEAAP
Oncorhynchus mykiss V908 trav MSJN01002490.1 12162800 SVAGQKLDNKMTLIRKQGQPVIFSCQNIDQNCNYVYWYQKKEGEPFILILRIQSGSCTVYSDYNHPQKGEFSAMRQSKNCNLKIQSVTVSHSATYFCACWDSS
Oncorhynchus mykiss V909 trav MSJN01002490.1 12121287 AVAGQILDQEISWTKKKGEAVSFSCEYNDQCGSYVFWYQKKDREPFTLILDIAKSNCAVDASYNHPQKDDFSSVRNNRCDLKIQFVKVSHSATYYCACYRSGS
Oncorhynchus mykiss V910 trdv MSJN01002490.1 12106821 SVAGQKLDQEMSWTRTQGQAVSFSCKDTYQCTTFVYWYQKKEGEPFTLILDIQKDNCAVDASYNHPQKDDFSATSMNNNCDLKIQSVKVSHSATYYCACWN
Oncorhynchus mykiss V911 trgv MSJN01002490.1 12082784 QRLQQDQISKTMREKQSVTFSCKVTGSCYGNTVHWYQKREGEPFTWILYFDFDYNSVSRDSTHHQRADFTVGRESDTSELKIQSVKVSHSATYYCACWDSS
Oncorhynchus mykiss V912 trgv MSJN01002490.1 12019366 AASGQRLQQDQISKTMREKQSVTFSCKVTGSCSGGTVHWYQKKEGVAFTWINADANSGSSVTTHPQGADFIVWRESASHPSELKIKLVKVSHSATYYCACWVSG
Oncorhynchus mykiss V944 trbv MSJN01003273.1 13037 LVEGSEVTQTPTILWELKDSDAQMNCSHTKGANYNQMYWYRQLPGEGMKQVVYTSSYSDPEYGDFSKDKYPTVKAVAESGSFTVKKLETGDSGMYFCAVS
Oncorhynchus mykiss V945 trav MSJN01003273.1 11351 QLFSSMVHQRPVALTEGPGGDVQLTCSHTIPNYYMVLWYKQSAGDTAMKLIGYAYTKSITMDKSFEKHFNVSGDGGKEAYLHLVSLRGPEHSAVYYCAAS
Oncorhynchus mykiss V946 trbv MSJN01003273.1 7859 LSQTDKVHQTPTAILKGPEDKVNLTCSHTDSDYIMILWYQQSAQNTGLKLIGYVRFTSPTVEDSFKGRFDVSGDAAANKMAYLHFPKVPEAEDSAVYFCAASE
Oncorhynchus mykiss V947 trav MSJN01003273.1 3935 SSLSNQVHQSPASLYKIQGKSAKMVCSHSISGYDRVLWYKQSNYRELVYLGYLNVKTGYPEAGFDIEGDANAGGTSTLTIKQLTPNSSAVYYCAAS
Oncorhynchus mykiss V948 trbv MSJN01003273.1 682 LVEGSEVTQIPTILWKLKDSDAQINCSHTKGATYTQMYWYRQLPGEGMKQVVYTSSYSDPEYGDFSKDKYPTVKAVAESGSFTVKKLETGDSGMYFCAVS
Oncorhynchus mykiss V950 trav MSJN01003496.1 55808 QLFSSIVHQRPVALTEGPGGDVQLTCSHTIPNYYVILWYKQSAGDTAMKLIGYAYTKSITMEKSFEKHFNVSGDGGKEAYLHLVSLRGPEHSAVYYCAAS
Oncorhynchus mykiss V951 trav MSJN01003496.1 51679 SSLSNQVHQSPASLYKIQGKSAKMVCSHSISGYDRVLWYKQSNYRELVYLGYLNVKTGYPEAGFDIEGDANAGGTSTLTIKQLTPNSSAVYYCAAS
Oncorhynchus mykiss V952 trbv MSJN01003496.1 48988 LVEGSEVTQTPTILWELKDSDAQMNCSHTKGSSYFQMYWYRQLPGEGMKQVVFIIPSSQPDYSGGFSKDKFSASKVVAESGSFTVKKLGTGDSGMYFCAVS
Oncorhynchus mykiss V953 trav MSJN01003496.1 47267 QLFSSMVHQRPVALTEGPGGNVQLTCSHTIPNYYVILWYKQSAGDTAVKLIGYVYTKSITMEKSFEKHFNVSGDGGKEAYLHLVSLRGPEHSAVYYCAAS
Oncorhynchus mykiss V954 trbv MSJN01003496.1 45971 LSQTDKVHQTPTVILKGPEDKVNLTCSHTVSSYYMILWYQQSAQNTALKLIGYVRYTSPTVEDSFKGRFDVSGDAAANKMAYLHFPKVPEAEDSAVYFCAASE
Oncorhynchus mykiss V955 trav MSJN01003496.1 36145 SSLSSKVLQVPSALLESPNVTVIIKCSHAISSYNTILWYQQSIADSNLKLIGFVFYKNPTIEDQFKQHFEIRGDGEIEASLQLLSDPENSAVYYCAA
Oncorhynchus mykiss V956 trbv MSJN01003496.1 35153 LSQTDKVHQTPTAILTGPEDKVNLTCSHTDPNYNMILWYQQSAQNTALKLIGYVRYTSPTVEDSFKGRFDVSGDAAANKMAYLHFPKVPEAEDSAVYFCAASE
Oncorhynchus mykiss V957 trav MSJN01003496.1 31502 SSLSNQVYQSPASLYKIQGKLAKMDCSHSISGYDRVLWYKQSNYRELVYLGYLNVKTGFPEAGFDIEGDANAGGTSTLTINQLTPNSSAVYYCAAS
Oncorhynchus mykiss V958 trbv MSJN01003496.1 24398 LVEGSEVTQTPTILWGPKDSDALMNCSHTKDSSYYQMYWYRQLPGEGMKQVVFITPSSQPDYSGEFSKDKFSASKAVAEIGSFTVKKLEAGDSGMYFCAVS
Oncorhynchus mykiss V959 trav MSJN01003496.1 22384 QLFSSMVHQRPVALTEGPGGDVQLTCSHTIPNYYLILWYKQSAGDTAMKLIGYAFTKSITMEKSFEKHFNVSGDGGKEAYLHLVSLRGPEHSAVYYCAAS
Oncorhynchus mykiss V960 trbv MSJN01003496.1 21321 LSQTDKVHQTPTAILKGPEDKVNLTCSHTNSRYDMILWYQQSAQNTALKLIGYVWNTSPTVEDSFKGRFDVSGDAAANKMAYLHFPKVPEAEDSAVYFCAASK
Oncorhynchus mykiss V962 trbv MSJN01003496.1 13401 LSQTDKVHQTPTAILTGPEDKVNLTCSHTVSSYNMILWYQQSAQNTALKLIGYVRYTSPTVEDSFKGRFDVSGDAAANKMAYLHFPKVPEAEDSAVYFCAASE
Oncorhynchus mykiss V964 trbv MSJN01003496.1 7518 FVEGSEVTQIPTILWKLKDSDAQMNCSHTKGSSYFQMYWYRQLPGEGMKQVVFITPSSQPDYSGEFSKDKYPTVKAVAESGSFTVKKLETGDSGMYFCAVS
Oncorhynchus mykiss V965 trbv MSJN01003496.1 4561 LSQTDKVHQTPTAKLKGPEDKVNLTCSHTVSNYNRILWYQQSAQNTALKLIGYVWNTSPTVEDSFKGRFDVSGDAAANKMAYLHFPKVTEAEDSAVYFCAASE
Oncorhynchus mykiss V970 trav MSJN01004069.1 237626 CRGDRVLQTKGVVTATEGVQITLVCHYETDDPGPYLFWYKQGANDYLKYMLMRHKFGTGDNATEFKERFHADLDANSKSVPLTIQRVQLSDSAVYYCALK
Oncorhynchus mykiss V971 trav MSJN01004069.1 232480 GSYEQTIEPNQHEVYAEVGINVLLSCNYSSAYSLLWYKQSPGSAPQYLLLILDSTGTEHRADSLDSRFSGKLNKEKTCVDLEISSAEVTDSALYYCALR
Oncorhynchus mykiss V972 trav MSJN01004069.1 224601 CRAEENVTQPTEDVMVVEGQPTTLTCLFYTTNQSPYLFWYKQLANGKPMFMLRKDKFGTGETATEFKDRFEACLNVTAKSASLTIQRLQLYDSAVYYCALR
Oncorhynchus mykiss V973 trav MSJN01004069.1 187136 CKGEDSVIQPPGDVITTEGEQVTLGCQFDAVNINNLNLFWYKHELNGFPEFMLGRFSFGSKNATEFKDRFDANLDADSKSVPLTIQRVQLSDSAVYYCALR
Oncorhynchus mykiss V974 trav MSJN01004069.1 178546 CTGDHVQQQPEGVIATEGGLVKLSCQYNTSANNDVYLFWFKQEANDFPKQMLSRYSFGSGDNAAGFKERFNASLNAKTQSVPLMIQRLQLSDSAVYYCALR
Oncorhynchus mykiss V975 trav MSJN01004069.1 175632 LVGYTLEDDITPTSPEEYYLEGSRVKISCNYTVKADNLQWYRQYPGSAPQFLLLLTHTATPLVVEATPPYPRMTAKLNDERTRVDLEISSAYVTDSALYYCALQ
Oncorhynchus mykiss V976 trav MSJN01004069.1 144043 CRAEENVTQPTEDVMVVEGQPTKLSCLFVTTDQSPYLFWYKQLANGKPMLMLRRERFGVGETATEFKNRFDAHLNVTAKSVPLIQSVQLSDSAEYYCALR
Oncorhynchus mykiss V992 igkv MSJN01006479.1 26934 SRGQVTVTQPPVVTFSPGDPVTLTCTTNPKVYKWSDGDEGAFWYQQRPGEAPKLLIRYAKKRLDGIPARFSVSGSERDFTLTISGVQAEDAAVYYCQS
Oncorhynchus mykiss V993 igkv MSJN01006479.1 14180 SRGQVTVTQPPVVTFSPGDPVTLTCTTNPKVHRYSDGDEGAFWYQQRPGEAPKLLIIYANQLLDGIPARFSGSGSERDFTLTISGVQAEDAAIYYCQS
Oncorhynchus mykiss V994 igkv MSJN01006479.1 4641 SSAGVVTQSPTVKSVRLGETVYLSCTASKGVDDDLSWYLQKPGQSPQLLFYKISRRHSETPGHFSSSGSQPDFTLTISVVQVEDVGDYYCMGS
Oncorhynchus mykiss V995 igkv MSJN01006479.1 1101 SRGQVTVTQPPVVTFSPGDPVTLTCTTNPKVHRYSDGDEGAFWYQQRPGEAPKLLIRYAKKRLDGIPARFSGSGSERDFTLTISGVQAEDAAVYYCQS
Oncorhynchus mykiss V1000 igkv MSJN01007111.1 31204 SRGQVTVTQPPVVTFSPGDPVTLTCTTNPKVYTDSDGDEGVFWYQQRPGEATKLLITYAKKRLDGIPARFSGSGSERDFTLTISGIQAEDSAVYYCQS
Oncorhynchus mykiss V1001 igkv MSJN01007111.1 22488 SRGQVTVTQPPVVTFSPGDPVTLTCTTNPKVYKWSDGNEGVFWYQQRPGEAPKLLIRYAKKRLDGIPARFSGSGSERDFTLTISGVQAEDAAVYYCQS
Oncorhynchus mykiss V1002 igkv MSJN01007111.1 14682 SRGQVTVTQPPVVTFSPGDPVTLTCTTNPKVYTDSDGDEAVSWYQQRPGEAPKLLIRYAKKRLDGIPARFSGSGSERDFTLTISGVQAEDAAVYYCQS
Oncorhynchus mykiss V1003 igkv MSJN01007111.1 13653 SRGQVTVTQPPVVTFSPGDPVTLTCTTNPKVYRYSDGDEGAFWYQQRPGEAPKLLIIYANQLLDGIPARFSGSGSERDFTLTISGVQAEDAAIYYCQ
Oncorhynchus mykiss V1014 trav MSJN01023532.1 73881 QSLSTEVHQTPIAILKGSKDNVQLTCNHAIQNYNTILWYQQSTGDPAMKLIGYAFAESITMEKSFEKHFNVSGNGRKEAYLHLLSLRSPEDSAVYYCAAS
Oncorhynchus mykiss V1015 trav MSJN01023532.1 71833 QSLSTEVHQTPIAILKGSKDNVQLTCNHAIQNYNTILWYQQSTGDPAMKLIGYVYAESITMEKSFEKHFNVSGNGRKEAYLHLLSLRAPEDSAVYYCAAS
Oncorhynchus mykiss V1016 trav MSJN01023532.1 62452 QSLSTEVHQTPIAILKGSKDNVQLTCNHAIQNYNTILWYQQSTGDPAMKLIGYAFAESITMEKSFEKHFNVSGNGRKEAYLHLLSLRSPEDSAVYYCAAS
Oncorhynchus mykiss V1017 trav MSJN01023532.1 59963 QSLSSKVHQTPIAILKRSKDNVQLTCNHTIQNYNTILWYQQSPGDTAMKLIGYVYTESITMEKSFEKHFNVSGDGRKEAYLHLLSLRAPEDSAVYYCAAS
Oncorhynchus mykiss V1018 trav MSJN01023532.1 55217 QSLSSKVHQIPIAILKGSKDNVQLTCNHAIQNYITILWYQQSTGDTAMKLIGFAFYKSITMEKSFEKHFNVSGDGSKEAYLHLLSLRAPEDSAVYYCAAS
Oncorhynchus mykiss V1020 trav MSJN01023532.1 48894 LSQTDQVQQTPTAILKGPDDNVQLNCSHTVPNYNMILWYQQSEQDTALKLIGYVLLTNPAVEDSFKGRFTVSGDAATGKMAYLHIPKLRGTEDSAVYFCAASK
Oncorhynchus mykiss V1021 trav MSJN01023532.1 47897 LSQTDQVQQTPTAILKGPDDNVQLNCSHTVPNYNMILWYQQSEQDTALKLIGYVLLTNPAVEDSFKGRFTVSGDAATGKMAYLHIPKLRGTEDSAVYFCAASK
Oncorhynchus mykiss V1022 trav MSJN01023532.1 43285 QSLSSKVHQTPIAILKGSKDNVRITCNHTIQDYYTILWYQQSTGDTAMKLIGYAQYKSITMEKSFEKHFNVSGDGVKEAYLHLLSLRAPEDSAVYYCAAS
Oncorhynchus mykiss V1023 trav MSJN01023532.1 40820 QTLSSKVHQTPIAILKGSEDNVRITCNHTIQDYTMILWYQQSPGDTALKLIGYAYTESITMEKSFEKHFNVSGNGRKEAYLHLLSLRAPEDSAVYYCAAS
Oncorhynchus mykiss V1025 trav MSJN01023532.1 27401 LSQTDQVQQTPTAILKGPDDNVQLNCSHTVPSYNMILWYQQSEQDTALKLIGYVFLTNPAVEDSFKGRFTVSGDAATGKMAYLHIPKLRGAEDSAVYFCAASK
Oncorhynchus mykiss V1026 trav MSJN01023532.1 26340 LSQTDQVQQTPTAILKGPDDNVQLNCSHTVPSYNMILWYQQSEQDTALKLIGYVFLTNPAVEDSFKGRFTVSGDAATGKMAYLHIPKLRGAEDSAVYFCAASK
Oncorhynchus mykiss V1027 trav MSJN01023532.1 21406 LSQTDQVQQTPTAILKGPDDNVQLNCSHTVPSYNMILWYQQSEQDTALKLIGYVFLTNPAVEDSFKGRFTVSGDAATGKMAYLHIPKLRGAEDSAVYFCAASK
Oncorhynchus mykiss V1028 trav MSJN01023532.1 8532 QSLSSKVHQTPIAILKGSEDNVQLTCNHTIQNYYTILWYQQSTGDTAMKLIGYAYYKTITMEKSFEKHFNVSGDGGKEAYLHLLSLRAPEDSAVYYCAAS
Oncorhynchus mykiss V1030 trav MSJN01027654.1 333 CRAEENVTQPTEDVMVVEGQPTTLTCLFYTTNQSPYLFWYKQLANGKPMFMLRKDKFGTGETATEFKDRFEACLNVTAKSASLTIQRLQLYDSAVYYCALR
Oncorhynchus mykiss V1032 trav MSJN01034781.1 3242 CRGDRVLQTKGVVTATEGVQITLVCHYETDDPGPYLFWYKQGANDYLKYMLMRHKFGTGDNATEFKERFHADLDANSKSVPLTIQRVQLSDSAVYYCALK
Oncorhynchus mykiss V1033 trav MSJN01034781.1 2225 CRGDRVLQTKGVVTATEGVQITLVCHYETDDPGPYLFWYKQGANDYLKYMLMRHKFGTGDNATEFKERFHADLDANSKSVPLTIQRVQLSDSAVYYCALK
Oncorhynchus mykiss V1035 igkv MSJN01045075.1 6851 SWGQYVLTQSAAQSVQPGQTVSIDCSTSSKVTQYSGSQYYLAWYHQTSGEAPKLLICYTSDRFTGVSTRFSGSGRGNGVDFTLTISDVQAEDTGVYYCQ
Oncorhynchus mykiss V1037 trav MSJN01048565.1 22977 QSLSSKVHQTPIAILKGSEDNVQLTCNHTIQNYNTILWYQQSTGDTAMKLIGFAYYKTITMEKSFEKHFNVSGDGGKEAYLHLLSLRAPEDSAVYYCAAS
Oncorhynchus mykiss V1038 trav MSJN01048565.1 13893 QSLSSKVHQTPIAILKGSKDNVQLTCNHTIQNYNTILWYQQSPGDPAMKLIGYAQYKSITMEKSFEKHFNVSGDGGKEAYLHLLSLRAPEDSAVYYCAAS
Oncorhynchus mykiss V1039 trav MSJN01048565.1 10769 QSLSTEVHQTPIAILKGSKDNVQLTCNPAIQNYNTILWYQQSTGDPAMKLIGYVYAESITMEKSFEKHFNVSGNGRKEAYLHLLSLRAPEDSAVYYCAAS
Oncorhynchus mykiss V1041 iglv MSJN01049195.1 1078 SRGQVTVTQPPVVTFSPGDPVTLTCTTNPKVSRYSDGDEGAFWYQQRPGEAPKLLIRNIKTRLDGIPARFSGSGSERDFTLTISGVQAEDAADYYCQ
Oncorhynchus mykiss V1044 ighv MSJN01063306.1 643 VQSYELTQPASLTVQPGQPLTISCKVSYSVSSYYTAWIRQPAGKTLEWIGYISSGGGTAYKDSLKNKFSITRDTSSNTLFLKGQSLQTEDTAVYYCAR
Oncorhynchus mykiss V1056 ighv MSJN01138313.1 324 VHIISLTSSPAQLETPGESGESVKLSCQVSGYVLIDYSTGWIRCQPGKTLEWIGIIWASGSIIFGASFKSRDSSNVLYLDITSMQAEDTAVYYCARW
Oncorhynchus mykiss V5 igkv CCAF010056347.1 5436 VLPGHSISLNCKASSNVYGDCHNGQSWGHQCLSWYQQKPGENPKLMMLPGNTLQSGTPSRFSGSGSGSDFTLTISRVQTEDAGDYYCQS
Oncorhynchus mykiss V0 igkv CCAF010037036.1 9340 QYTVTQTPLVKAVLPGQTVSLNCKTSSDVYPNCGSSLPCMAWYQQKPGSNPELLVYQGSTLNSGIPSRFSGSGSGSDFTLTISGVQAEDAGDYYCQS
Oncorhynchus mykiss V1 igkv CCAF010037038.1 2183 SRGQYTLTQTPAVKAVLPGQSVSLNCKASSNVHGNKYLDWYQHKPGGAPKLLIYYTSTVQSGTPSRFSGSGSGSDFTLTISGVQAEDAGDYYCQS
Oncorhynchus mykiss V2 igkv CCAF010037040.1 9930 SRGQHIVTQTPAVKAVLPGQSVSLNCKTSSNVHGNNHLAWYQHKPGGAPKLLIYYATTLQSGTPSRFSGSGSGSDFTLTISGVQAEDAGDYYCQS
Oncorhynchus mykiss V4 trav CCAF010052248.1 6792 AGQKLDNKMTLIRKQGQPVIFSCQNIDQNCNYVYWYQKKEGEPFILILRIQSGSCTVYSDYNHPQKGEFSAMRQSKNCNLKIQSVTVSHSATYFCACWDSS
Oncorhynchus mykiss V6 igkv CCAF010056349.1 924 CAGDILLTQTPAVVVVQSGESATISCKASSAIDDDLAWYHQKPGEAPKFIIDFNTGLTSGRYQGTGYDMDFTLTISGVQAEDAGDYYCQQHEAAP
Oncorhynchus mykiss V7 igkv CCAF010059075.1 4075 SSADIILTQSPKSQSVSPGEVVSISCTASSSTSDYLHWYLQKPGEAPKLLVYSGTTRQSGIPGRFSGSGSGSSYTHYTLTISGVQAEDAGDYYCQQGQSFP
Oncorhynchus mykiss V8 iglv CCAF010083598.1 8271 QVTVTQPPVVTFSPGDPVTLTCTTNTKVYKWDDGNEGGYWYQQRPGEAPKLLIRNIKTRQDGIPARFSGSGSESDFTLTISGVQAEDAAVYYCKS
Oncorhynchus mykiss V9 ighv CCAF010085527.1 3286 SLTLQPGQPLTLSCKVSGYSLTSSSYCTGVNRQPTGKALEWIGYICYNGNTYDSDKLKNKFSISRDTSSSTVTLTGQSLQTEDTAVYYCARY
Oncorhynchus mykiss V10 igkv CCAF010086222.1 729 QITVTQTPTMKAVLSGQLVSLNCRISSNVYGNCYNGQSWNHQCLSWYQQKPGEKPKLMMLPGNTLRSGTPSRFSGSGSGSDFTLTISGVQAEDAGDYYCQS
Oncorhynchus mykiss V11 igkv CCAF010086225.1 19682 ETVLPGQKVSMICKASSNVHSNCYNGQSWNHQCLSWYQQKPGEKPKLMMLPGNTLRSGTPSRFSGSGSHSDFTLTISGVQAEDAGDYYCQS
Oncorhynchus mykiss V12 ighv CCAF010089368.1 8073 VQSYELTQPASLTVQPGQPLTISCKVSYSVSSYYTAWIRQPAGKTLEWIGYISSGGGTAYKDSLKNKFSITRDTSSNTLFLKGQSLQTEDTAVYYCAR
Oncorhynchus mykiss V13 ighv CCAF010091857.1 8802 VFCQTELTQPGSLTLQPGQPLTLSCKVSGYSLTSTSYCTGWVRQPAGKALEWVGEMCGSGNIYYSDKLKNKFSISRDTSSSTVTLTGQSLQTEDTAVYYCARR
Oncorhynchus mykiss V14 ighv CCAF010091857.1 25451 ARCQVVLTQAEQSVQGTPAGSLKLTCACSGFTLSSSYMHWIRQAPGKGLEWIIYYYSDSNKSNAPVVQGRFTALKDSTNFYLHMNLLKPEDSAVYYCARD
Oncorhynchus mykiss V15 trbv CCAF010095791.1 286 VIQTVEVIQWPSSICSQPNTSMDMHCSQDAGYDYMYWYRHLQGEGPKLMCSLIGESASYEAEFKSGFRVWRTENPEGMSSVRQWSLTVQMVQRKDQAVYLCAAS
Oncorhynchus mykiss V16 igkv CCAF010102839.1 2549 QYVVTQTPVVKAVLPEQTVSLNCKTSSNVFGNDRLAWYQQKPGGAPKLLIYYATTLQSGTPSRFSGSGSGSDFTLTISGVQAEDAGDYYCQS
Oncorhynchus mykiss V17 trav CCAF010109108.1 1595 LSQTDQVQQTPTAILKGPGDNVQLNCSHTVPSYNMILWYQQSEQDTALKLIGYVFLTNPAVEDSFKGRFTVSGDAAAGKMAYLHIAKLRGTEDSAVYFCAATY
Oncorhynchus mykiss V18 trbv CCAF010117150.1 4361 LCLSVEVHQTPSAVFSRPGENVQLFCQHQKTDYRVMLWYQKSQGETALKLIGNLYHKNPTIESSYEKHFNMSGDLGGGGPKNASLNMFNLRRPQHSAVYFCAASY
Oncorhynchus mykiss V19 ighv CCAF010122148.1 5569 VQGQSLTSSEPVVKKPRESVTLSCAVSGLSLSYLHWIRQKPGKGLEWIGRIDGGTGTVFAQSLQGQFTITKDGSKNQLYLEVKSLKTEDSAVYYCARDTV
Oncorhynchus mykiss V21 igkv CCAF010128626.1 1351 QYVVTQTPAVKAVVPEQTVSLNCKTSSDVYNNNYLAWYQHKPGGAPKLLIYHATTLQSGTPSRFSGSGSGSDFTLTISGVQAEDAGDYYCQS
Oncorhynchus mykiss V22 igkv CCAF010133606.1 1417 QYVVTQTPVVKVVLPEQTVSLNCKTSSDVYSNNYLAWYQQKPGGAPKLLIYLATTLQSGTPSRFSGSGSGSDFTLTISGVQAEDAGDYYCQS
Oncorhynchus mykiss V23 igkv CCAF010138820.1 1011 QVTVTQTPAVKAVSVGHSVSLSCKTSSAVHSNSNGHYLHWYQQKPGGAPKLLIYWAKTLQSGTPSRFSGSGSGSDFTLTISGVQTEDAGDYYCQS
Oncorhynchus mykiss V24 igkv CCAF010153218.1 2279 SWGQYVSTQSAAQSVQPGQTVSIDCSTSSKVTQYSGSQYYLAWYHQTSGEAPKLLICYTSDRFTGVSTRFSGSGRGNGVDFTLTISDVQAEDTGVYYCQSQWSC
Oncorhynchus mykiss V25 igkv CCAF010165573.1 1735 QYVVTQTPVVKAVVPEQTVSMNCKTSSNVYSNYLLAWYQQKPGGAPKLLIYYATTLQSGTPSRFSGSGSGSDFTLTISGVQAEDAGDYYCQS
Oncorhynchus mykiss V26 trav CCAF010166529.1 117 QSLSSKVHQTPIAILKGSKDNVQLTCNHAIQNYNTILWYQQSTGDTAMKLIGFAYYKTITMEKSFEKHFNVSGDGGKEAYLHLLSLRAPEDSAVYYCAAS
Oncorhynchus mykiss V27 igkv CCAF010003531.1 4345 SWGQYVLTQSAAQSVQPGQTVSIDCSTSSKVTQYSGSQYYLAWYHQTSGEAPKLLICYTSDRFTGVSTRFSGSGRGNGVDFTLTISDVQAEDTGVYYCQ
Oncorhynchus mykiss V28 igkv CCAF010003534.1 2710 SWGQYVSTQSAAQSVQPGQTVSIDCSTSSKVTQYSGSQYYLAWYHQTSGEAPKLLICYTSDRFTGVSTRFSGSGRGKGVDFTLTISDVQAEDTGVYYCQ
Oncorhynchus mykiss V31 igkv CCAF010039506.1 1394 SSADIILTQSPKSQSVSPGEVVSLSCTASSNTGNYLQWYLQKPGEAPKLLVYTGTNRQSGIPGRFSGSGSGSPYTHYTLTISGVQAEDAGDYYCQQGQSFP
Oncorhynchus mykiss V32 igkv CCAF010039508.1 6698 SSADIILTQSPKSQSVSPGETVSISCTASSNTGNNLQWYLQTPGEAPKLLVYHGTNRQSGIPGRFSGSGSVSPYTHYTLTISGVQAEDAGDYYCQQGGSYP
Oncorhynchus mykiss V33 igkv CCAF010039508.1 1620 SAADIILTQSPKSQSVRPGETVSISCTASSNTGNVLSWYLQKPGEAPKLLVHSATTRHSGIPGRFSGSGSGSSYTHYTLTISGVQAEDAGDYYCQQGLSTP
Oncorhynchus mykiss V34 trav CCAF010042945.1 875 LVGYTLEDDITPTSPEEYYLEGSRVKISCNYTVKADNLQWYRQYPGSAPQFLLLLTHTATPLVVEATPPYPRMTAKLNDERTRVDLEISSADVTDSALYYCALQ
Oncorhynchus mykiss V35 trav CCAF010042947.1 4590 EDSVLQPPGDVIATEGEQVTLDCQFDTLDTNPYLFWYKQGANDFPKYMLRRATFGSDNAIEFLGRFDAHLNLTTLKSASKSFPLTIQRLQLSDSAVYYCALR
Oncorhynchus mykiss V36 ighv CCAF010050975.1 3963 VQSYELSQPASMTVLPGQPLTISCKVSYSVTNAWTAWIRKPAGKTLEWIGNVYSGDTEHKDSLKNKFSLSVDSSSNTVFLKGQNLQTEDSAVYYCAY
Oncorhynchus mykiss V38 igkv CCAF010057017.1 616 SRGQYVVTQTPVVKAILPGQTVSLNCKTSSNVYSNIHLAWYQQKPGGAPKLLIYLATTLQSGTPSRFSGSGSGSDFTLTISGVQAEDAGGYYCQS
Oncorhynchus mykiss V39 trav CCAF010064121.1 2916 DSMEQETITPVKPEVNALQGTDITLSCNYKGNVNNLQWYRQYPGSRPECLLWILQSSMHVQKQSITTPRHTGRLNEEKTRVDLMISSVELEDSALYHCALQ
Oncorhynchus mykiss V40 trav CCAF010064122.1 209 CAGDQVQQQPGGVIATEGGLVKLSCQYNTSANNNDAYLYWFKQEENDFPKHMLSRYSFGSGDNAAGFKERFNASLNSKTQSVPLMIQRLQLSDSAVYYCAL
Oncorhynchus mykiss V41 trav CCAF010064123.1 1392 ISSEQVLTPYTDVEVSSERDSVTLSCNYTSSVNTLLWYRQYPKSAPQLLVKEYADITPGFTLNHDNNAKRMDLEISSAEVTDSALYYCALK
Oncorhynchus mykiss V42 trav CCAF010064124.1 27918 MVSGDGVTPDKEEYTPTEGSSVSLRCTYETSSSNIYLYWYRHYPNQAPQFLLYKSARSLSGEHIPDKRYQSTTSWTSTELVITSVTLADTALYYCALREY
Oncorhynchus mykiss V43 trdv CCAF010064124.1 25638 VSSEEELTPYTDVEVASERDRVTLSCNYTSSVNTLLWYRQYPKSAPQLLVMEYADITPGFILNHDKNAKRTDLKISSAEVTDSAMYFCALR
Oncorhynchus mykiss V44 trav CCAF010064124.1 22844 DSMEQETISPVKPEVNALQGTDITLSCNYKGNIINLQWYRQSPGSRPECLLLIRQSGMYIQNTSITTTRHTGRLNEEKTRVDLMISSVELEDSALYHCALQ
Oncorhynchus mykiss V45 trgv CCAF010064124.1 6041 QNYGDHITPVNNEVISTEGELVTLRCSYDTSYENIWLYWYWHYPKQAPQFLLYKGARSWSSEHISDKRYKPTTSRTSTELVITSLTLADTALYYCARRDD
Oncorhynchus mykiss V46 trav CCAF010064125.1 6288 DTYEQTIEPNQHEVYAEVGSNVLVSCNYSSANILLWYKQSPGSAPQYLLLIPHYSGIGQGADSLDSRFSGKLNEEKTRVDLEISSAEVTDSALYYCALR
Oncorhynchus mykiss V47 trav CCAF010064127.1 10699 DSNGQTIEPIREEVYAPAGSNITLSCTYSSAVSLQWYLQNPGSAPQYILLILHGVGSPSRAPGLDPRLSVKLNNEKNRVDLEISSAKEEDSAMYYCALK
Oncorhynchus mykiss V48 trav CCAF010064127.1 6878 MVYGDSVTPDKKEYTPTERSSVSLSCTYETSSEFIYLYWYRHYPNQAPQFLLYKGARSWSSDEHIPDKRYTSTTSRTSTELVITNLTLADTALYYCALREY
Oncorhynchus mykiss V49 trav CCAF010064128.1 1789 LSSEQVLTPYTDVEVASERERVQLSCNYTSGVTVQWYQQHPKSAPQLLVMEHMTAKTPGFSLNHDKKAKRVDLEISSAEVTDSALYYCALQ
Oncorhynchus mykiss V50 trav CCAF010064129.1 5202 GSYEQTIEPNQHEVYAEIGSNILLSCNYSSADSLLWYKQSPGSAPQYLLLIQHYTGTEHRADSLDSRFSGKLNKEKTRVDLKISSAEVTDSALYYCALR
Oncorhynchus mykiss V52 trav CCAF010064131.1 7608 DTYEQTTEPSQHDVYAEPGNNVLLSCNYSSADSLLWYKQSPGSAPQYLLLILDSTGTEHRADSLDSRFSGKLNKEKTRVDLENSSAQVTDSALYYCSLR
Oncorhynchus mykiss V54 ighv CCAF010071919.1 5208 VQGQTLTESGPVVKHPGESHKLTCTGSGFTFSSYGMNWIRQAPGKGLEWIAYSYSTTADYSQSFQGRFTISRDGSSSKLYLQMNSLRSEDTAVYYCAR
Oncorhynchus mykiss V55 ighv CCAF010071919.1 229 LNGQSMESIPSGPVLKKPGDTLSLSCKGDGFTFSSYGMHWIRQPAEKALDWMGLIYYDASKTIYSKNIEGRIEVTRDNSNSVVYLKLSGLRAEDSAVYYCARQ
Oncorhynchus mykiss V56 ighv CCAF010071921.1 8352 VQGQSLTSSEPVVKRPSESVTLSCAVSGFSMASYWTHWIRQKPGKGLEWIGLIDSGTGTIFAQSLQGQFTITKDSSKNQLYLEVKSLKTKDSAVYYCAR
Oncorhynchus mykiss V57 ighv CCAF010071921.1 1102 VQGQTLTESESVVKKPGESHKLTCTYSGFGGNNWNAWIRQAPGKGLEWVSAITSSDGGSTYYSQSVQGQFTISRDNSKQQVYLQMNSLKTEDSAVYYCAR
Oncorhynchus mykiss V58 ighv CCAF010071922.1 12630 VYSQSLEDIPSSPVMKKPGELLSLSCKGSGFTFSSYNMAWIRQPEGRTLEWIGIIWSDAGGTVYTKSVEGRIEVTRDNSNSMLYLKLSGLRAEDSAVYYCARE
Oncorhynchus mykiss V59 ighv CCAF010071922.1 6178 IYCDITLTQPGSMVVSPGESVTIPCKVAGYSVTSTCTNWIRHSEGKAMEWIGYLCSSSSSGTTDSLKSKISFTVDSSSSTVFLQGKNFQTEDTAVYYCARY
Oncorhynchus mykiss V60 ighv CCAF010071922.1 2470 VHGQIVLTQAESVQGTPAGSLKLTCACSGFTLSSTNMFWIRQAPGKGLEWIIYYYSDSDKSNAPVVQGRFTASKDSSNFYLHMSQLKPEDSAVYYCARD
Oncorhynchus mykiss V61 ighv CCAF010078636.1 8262 VQGQSLTSSEPVVKRPSESVTLSCTVSGFSMGSYWMQWIRQKPGKGLEWIGFIDTGTTAYYAQSLQGQFTITKDTSKNQLYLEMKSLKTEDSAVYYCARDTV
Oncorhynchus mykiss V62 ighv CCAF010080392.1 1597 VQGQRLIQSGPVVKKPEEPHKLTCTASDLDMNSYWMAWIRQAPGKGLEWVATITHNSRSTFYPQSVQGRFIISRDNSIKQVYLQMNSLKTEDSAVYYCARDTV
Oncorhynchus mykiss V63 ighv CCAF010080393.1 7575 VQRQTLTESGPLVKNSQDSHKLTCTCSGFGGNIYAAWIRQAPGKGLEWVSYISSYSGSTYYSQSVQGRFTISRDNSKQQVYLQMNRLKTEDSAVYCCARDS
Oncorhynchus mykiss V64 ighv CCAF010080393.1 4005 VNSQTLTESGPVVKNPGETHKLTCTYDGMSNNNAHISWIRQAPGKGLEWVCHISAPSGADKYYSKSVQGRFTISRDNSKQQVYLQMNNLKTEDSAVYYCARDTV
Oncorhynchus mykiss V65 ighv CCAF010085321.1 12718 VQGQTLTESGPVIKTPGESHTLICTGSGFTFKDYWMSWIRQAPGKELEWIGYIHGTTTYYSQSFQGRFTLSRDDSSSKLYLQMNSLKSEDTAVYYCAR
Oncorhynchus mykiss V66 ighv CCAF010102934.1 7211 VHIISLTSSPAQLETPGESGESVKLSCQVSGYVLIDYSTGWIRCQPGKTLEWIGIIWASGSIIFGASFKSRDSSNVLYLDITSMQAEDTAVYYCARWSQ
Oncorhynchus mykiss V67 ighv CCAF010102934.1 4597 VQSYELSQPASMTVLPGQPLTISCKVSYSVTNTWTSWIRKPAGKTLEWIGNVYSGDTQYKDSLKNKFSLSVDSSSNTVFLKGQNLQTEDSAVYYCAY
Oncorhynchus mykiss V68 igkv CCAF010121945.1 7672 TRGQYTVTQTPAVKAVSEGLSLSLSCKTSSAVYSDFFGQRMAWYQQKPGGAPKLLIYYTTTLQSGTPSKFSGSGSGSDFTLTISGVQAEDAGDYYCQS
Oncorhynchus mykiss V69 igkv CCAF010125327.1 507 QYVVTQTPVVKVVLPEQTVSLNCKTSSDVNNNNYLAWYQHKPGGAPKLLIYYATTLQSGTPSRFSGSGSGSDFTLTISGVKVEDAGDYYCQS
Oncorhynchus mykiss V70 trav CCAF010125458.1 2331 LVEGSEVTQTPTILWGPKDSDAPMNCSHSKDSSYYQMYWYRQLPGEGMKLVVYTSTYNIPDYGAFSEDKYQNVKTTAKSGSFTVKKLETGDSGMYFCAVS
Oncorhynchus mykiss V71 igkv CCAF010135158.1 4008 SRGQYVVTQTPAVKAVVPGQTVSLNCKTSSNVYSNNRLAWYQQKPGGAPQLLIYLATTLQSGTPSRFSGSGSGSDFTLTISGVQAEDAGDYYCQS
Oncorhynchus mykiss V72 trav CCAF010137554.1 1936 QSLSSKVHQTPIAILKGSEDNVQLTCNHTIQNYNTILWYQQSTGDTAMKLIGFAYYKTITMEKSFEKHFNVSGDGGKEAYLHLLSLRAPEDSAVYYCAAS
Oncorhynchus mykiss V73 ighv CCAF010146028.1 849 VCCDIRLDQSPSQVKIPGHSVKVSCIISGYSMTSYDIHWIRQKPGKGLEWIGRMNTGSGTDVIYADSLKGQFYLTEDVSTSTQFLEAKSLSSEDSAVYYCARQ
Oncorhynchus mykiss V74 trbv CCAF010147082.1 1183 LCLSVEVNQTPSAVFSRPGENVQLFCQHQKTDYTLMLWYQKPQGETALKLIGNLYHKNPTIESSYEKHFNMSGDLGGGGPKNASLNMFNLRRPQHSAVYFCAASY
Oncorhynchus mykiss V75 trav CCAF010165151.1 1730 HVKCVAFSQSPSLTVKDGREAEIHCSHDDSNLLVMLWYQQRQASMTLIGYSYGTTEPNYEGLFEERFRQKREENLKGTLVISKLTVADSAVYFCAAS
Oncorhynchus mykiss V76 trbv CCAF010167249.1 11 LVEGSEVTQIPTILWKLKDSDAQINCSHTKGATYTQMYWYRQLPGEGMKQVVYTSSYSDPEYGDFSKDKYPTVKAVAESGSFTVKKLETGDSGMYFCAVS
Oncorhynchus mykiss V77 igkv CCAF010177993.1 670 QYVVTQTPVVKAVVPEQTFSMNCIISSNVYSNNYLAWYQQKPGGAPKLLIYYATRLQSGTPSRFSGSGSGSDFTLTISGVQAEDAGDYYCQS
Oncorhynchus mykiss V78 trav CCAF010180035.1 418 LSQTDQVQQTPTAILKGPDDNVQLNCSHTVPSYNMILWYQQSEQDTALKLIGYVFLTNPAVEDSFKGRFTVSGDAATGKMAYLHIPKLRGAEDSAVYFCAASK
Oncorhynchus mykiss V79 igkv CCAF010182142.1 1444 SSADITLTQSPKSQSVSPGETVSISCTASSRTSDYLHWYLQKPGEAPKLLVYDATTRQSGIPGRFSGSGSGSPYTHYTLTISGVQAEDAGDYYCQQSNSFP
Oncorhynchus mykiss V80 trbv CCAF010188011.1 544 LSQTDKVHQTPTAILKGPEDKVNLTCSHTDQRYDRILWYQQSAQNTALKLIGYVWNTSPTVEDSFKGRFDVSGDAAANKMAYLHFPKVPEAEDSAVYFCAASE