WGS Statistics
Organism WGS Record. Vs Total IGHV IGLV IGKV TRAV TRBV TRGV TRDV
Ammotragus lervia NIVO00000000.1 (NIVO01) 199 2 13 7 84 55 7 31
Vgene Table
Organism Vgene Locus contig Contig Pos. AA sequence
Ammotragus lervia V16 trav NIVO01002559.1 21741 VSLGNKVEQSPSTLSVQEGNSSVITCTYTDGNSEYFPWYKQEPGKGPQLLIAIRSNKDKEEDQRLTVLLNKTAKRLSLHIANTEAGDSAVYFCAAS
Ammotragus lervia V28 trav NIVO01004474.1 1465879 SAGKGVEQPTELTAMEGASAQVNCTYQTYGFNGLFWYQQHDGGAPVFLSYNVLDGLETRGHFSSFLRRSDAHSYLLLKELHMKDFASYLCAVI
Ammotragus lervia V29 trav NIVO01004474.1 1537702 GLRAQSVTQPEDVVPVAEGDPVTVKCTYSVSGSPYLSWYVQHRNQGLQFLLKYITGDPLVKSNYGFEAEFNKSQTSFHLKKPSVLRSDSAVYFCAVS
Ammotragus lervia V30 trav NIVO01004474.1 1547474 TLSLAKTSQPIIIDSYEGQEVNIPCNHTTIAISEYIFWYRQFPNQGPQFIIQGYTTTVENEVASVLIPSDRKFSTLSLPRASLGDAAVYYCIVRD
Ammotragus lervia V31 trav NIVO01004474.1 1558666 GVRGVKVEQSPSVLSLQEGANSTLWCNSSDIVSSVQWFQQNPEGSLISLFFIASGMKQNERLSSTVNSKERYSTLHITASQLEDAATYLCAME
Ammotragus lervia V32 trav NIVO01004474.1 1569009 KSRGEKVEQYPSFQSVQEGDNCVINCTYTDSASAYFVWYKQEPGKGLQLLIHTLSNVDKKEGQGLIVLLNKKNKHLSLNITATHPGDSATYFCAAR
Ammotragus lervia V33 trav NIVO01004474.1 1606673 DSRGQSVTQPDDPVLVSEGTSLELKCNYSYGATPYLFWYVQYPRQRPQLLLKSFSGNTVVQGIRGFMAEFKSSDFSFNLRKFSAHWSDSAEYFCALS
Ammotragus lervia V34 trav NIVO01004474.1 1618083 GVKAVKVEQSPSVLNLQEGANCTLRCNFSATVKTLRWFQQNPGGSLISLFFIASGMKQNERLSSTVNSKEWYSTLHIRASQLEDAATYLCAVE
Ammotragus lervia V35 trav NIVO01004474.1 1624629 VSLGNKVEQSPSTLSVQEGNNCFITCTYTDVTSSYFPWYKQEPGKGPQLLIDIRSNMGKNEGQRLTVLLNKTAKHLSLHITTIEPGDSAVYFCAAS
Ammotragus lervia V36 trav NIVO01004474.1 1633550 SIIAQKVTQDPQPMLVQEKEAVTLDCTYDTSDSSYSLFWYKQPSSGAMIFLLSQDSYGKQNVTEGRYSLNFQRASKSITLVISASQLEDSAVYFCALRE
Ammotragus lervia V37 trav NIVO01004474.1 1642701 VSLGNKVEQSPSTLSVQEGNSSVITCTYTDGNSDYFPWYKQEPGKGPQLLIAIRSNKDKEEDQRLTVLLNKTAKRLSLHIATTEAGDSAVYFCAAR
Ammotragus lervia V38 trav NIVO01004474.1 1647844 SSIAQKVTQDQPPMSVQEKENVTLDCTYDISITTYSLCWYKQPSSGVMTFLIRQDSSNKPNATEGRFSLNFQKAGKFITLTVSASQLEDSAVYFCALSE
Ammotragus lervia V39 trav NIVO01004474.1 1655428 QTHGDSVSQMDGQVTLLEGATLTVNCTYSAMGYPTLFWYVQYAGEGPQLLLKATKANDKGTNKGFEATYDAKTTSFHLEKASVQESDSAVYHCALS
Ammotragus lervia V40 trav NIVO01004474.1 1663787 GVRGVKVEQRPSVLSLQEGANSTLWCNSSDTVKSVQWFQQNLGGSLTRLFFIASGTKQNERLSSTVNSKERYSTLHITASQLEDAATYLCAVE
Ammotragus lervia V43 trdv NIVO01004992.1 271231 KGVLCNQVIQSSPEQRVASGREVTLQCTFQTTYSNPDLYWYRKTPDAAFQFVLYRDNSRSRDADFARGRFTVRHSVRSKTFHLVISSVRPEDTATYYCALEL
Ammotragus lervia V51 trav NIVO01006704.1 384100 SRGQSGTQPDDPVLVSEGTSLELKCNYSYGATPYLFWYVQYPPQRPQLLLKHFSGNTVVQGIRGFVAEFESSDFSFNLRKFSAHWRDSAEYFCALS
Ammotragus lervia V77 iglv NIVO01012955.1 383 SWAQAVLTQPSSVSGSLGQRVSITCSGSNIGSSDVGWYQQLPGSGLRTVIYYSSNRPSGVPDRFSGSKSGNTATLTISSLQAEDEADYYCGSYDSSSYN
Ammotragus lervia V84 trgv NIVO01013639.1 22155 IQQEIRLTQRSVMVGSAGGAMTMPCQVSRSVDYVHWFRQLEGQAPERLLYLALSKRDVQWDSVLAGDKVSAARGGDGKSCTMSLRKLAKSDEGLYYCAAWD
Ammotragus lervia V94 trav NIVO01014837.1 367 GTRAQTVTQPESHIPVSEGDPVQVKCSYSYSGSPALFWYVQYPRQRLQLLLKDTSRESIQGFTAELSRAEASFHVKKPSTQEEDSAVYYCALG
Ammotragus lervia V95 trav NIVO01015128.1 143 GTSADSVTQTEGGVTLPETASLTLKCAYQSSYSVSLFWYVQYQNKELELLLKSSLGNQKVTSRGFEATHISSDSSFHLQKSSVKTSDSAVYYCALS
Ammotragus lervia V118 iglv NIVO01016471.1 6141 SWAQAVLTQPPSVSGSLGQTVTISCSGSSSNIGILGVSWYQQLPGSAPKTLISGRNKRPSGVPDRFSGTKSGNTGTLTITSLQAEDEADYYCASADLSLKS
Ammotragus lervia V124 trav NIVO01017350.1 378 GTSGDSVTQTERVVTLPETASLTLKCTYQSSYSVSLFWYVQYQNKELELLLKSSLGNQMVTSRGFEATHISSDSSFHLQKSSVKTSDSAVYYCALS
Ammotragus lervia V161 trav NIVO01023897.1 1454 VSSLLTVEQRPPLLWVQEGESTNFTCSFPSSSFYALHWYRWEPAKGPKNLFVISVNGDEKKQGRVRVTLNTKEGYSSMYIRGYQPEDSATYLCA
Ammotragus lervia V162 trdv NIVO01023897.1 11681 SCVAQKLTQNQPDISSQVGQSVTLNCRYETSWSYYYLVWYKQLPSGQMTYLIQQYSENSNTRNGRYSVNFQKADKSISLIISSLQLEDSAKYFCALCD
Ammotragus lervia V163 trav NIVO01023897.1 16793 MNGQQIKHFPEFLLLQEGENFTMYCNSSSILSNLQWYKQRPGGSPVLLMILAKSGEVKTQQRRTGRFGESRQHSSLNLTAAQLSDAGTYFCAE
Ammotragus lervia V164 trdv NIVO01023897.1 23475 SGVAQKVTQDQSDVSSQLGQSVTLNCRYETSWSYYYLFWYKQLPSGQMTYVIRQGSQVTNARKDRYSVNFKKADKSISLTISALQLEDSAKYFCALSV
Ammotragus lervia V165 trav NIVO01023897.1 32069 TVINAKTTQPSSMDCAEGEDVNLPCNHSTIGANDYIHWYRQNPNQSPQYVIHGLRGTVNRSMASLHIASDRKSSTLVLPQVTLRDAAVYYCILRE
Ammotragus lervia V166 trdv NIVO01023897.1 41197 SGVAQKVTQDQPDITRQVEQSVTLNCQYEVSWYMDYYSIFWYKQLPRGQMTYLIRQYSEDGNARDGRYSVNFQKADKSISLTISTLQLEDTAKYFCALRE
Ammotragus lervia V167 trdv NIVO01023897.1 88419 SGVAQKVTQDQSDVSSQLGQSVTLNCRYETSWSAYYLYWYKQLPSGQMTYVIHQGSQVTNARKDRYSVNFRKADKSISLTISALQLEDSAKYFCALSV
Ammotragus lervia V204 iglv NIVO01029714.1 6159 SWAQAVLTQPSSASKSLGQSVSITCSGSSSNIGRGYGSWYQQVPGSAPKLLIYRATSRASGVPDRFSGSRSGNTATLTISSLQAEDEADYYCAAYDSSSNN
Ammotragus lervia V205 iglv NIVO01029714.1 16232 SWAQAVLTQPPSVSGSPGQRVSITCTGSSSNIGGGNYVSWFQQLPGSGLKTIIYSTSSRPSGVPDRFSGSRSGNTATLTISSLQAEDEADYYCATYESSSYN
Ammotragus lervia V220 trdv NIVO01032002.1 19309 SGVAQRVIQDQPDISGQLGQSVTLNCRYATTWSYYYVFWYKLLPSGEMIYLIHQVSSGQNARNGRYSVNIQKAQKSISLTISDLQLEDSAEYFCAFWE
Ammotragus lervia V221 trdv NIVO01032002.1 46721 YSVAQQVTQVQTAVPSQVGQTVTLNCRYEVSWTTGFYYIFWYKQLPRGEMTLLIRQYSEHGNTRNGRYSVNFQKAHKSISLIISALQLEDSAKYFCALWE
Ammotragus lervia V222 trdv NIVO01032002.1 49276 SSVAQQVTQVQTAVPSQVGQTVTLNCRYEVSWTMDYYYIFWYKQLPRGEMTLLIHQYSEYSNARNGRYSVNFQKAHKSISLIISALQLEDSAKYFCALWE
Ammotragus lervia V223 trav NIVO01032002.1 76189 IMVDAQITQLSSMDCAEGEDVNLLCNHSTIDALDYIHWYQQTPNRSPQYVIHGFQDTVNSSMSSLNIASDRKSSTLVLSQVTLRDTAVYYCILRE
Ammotragus lervia V224 trav NIVO01032002.1 92295 GLRAQSVTQPEDEVTVVEGDPVTVKCTYSVSGSPYLSWYVQHHNQRLQFLLKYISGDSLVKGNYGFEAEFNKSQTFFHLKKQSVLGNDSALYFCAVS
Ammotragus lervia V225 trav NIVO01032002.1 102148 TLSLAKTSQPIIIDSYEGQEVNIPCNHTTIARSEYIFWYRQFPNQGPQFIIQGYTTAVENEVASLLIPPDRKFSTLSLPRASLGDAAVYYCIVRD
Ammotragus lervia V226 trav NIVO01032002.1 113130 GVRGVKVEQSPSVLSLQEGANSTLWCNFSATVNSVQWFQQNPRGSLISLFFIASGMKQNERLSSTVNSKERYSTLHITASQLEDSATYLCAVE
Ammotragus lervia V232 iglv NIVO01032520.1 279 SWAQAVLTQPPSMSGSPGQRVSITCTGSSSNIGRYGVGWYQQLPGSAPKLLIYCTTSGASGSVDGFSCSMSGNTATLTISSLQAEDEADYYCATYDSSSYN
Ammotragus lervia V276 trav NIVO01040055.1 3296 LRGEDRVEQSPQTLRLQEGDSLSLNCSYTVSSFSGLQWYRQDPGKGPELLFLLYSVGDEKQEERLRATLLKKGSSLHIEAPKPEDSATYLCAVE
Ammotragus lervia V288 ighv NIVO01042278.1 520 VLSQVQLQESGPSLVKPSQTLSLTCTVSGFSLTSYGVGWVRQAPGKALEWVGIINSGGSTYYNPALKSRLSITRDTSKSQVSLSLRSVTTEDTAVYYCAR
Ammotragus lervia V296 trav NIVO01042888.1 4780 TVIDAKTTQPSSMDCAEEEDVTLPCNHSTISGNEYILWYRQNPNQSPQYVIHGLRGTVNSSMASLNIASDRKSSTLVLPQVTLRDAAVYYCIVRE
Ammotragus lervia V297 trdv NIVO01042888.1 20028 SSVAQRVTQDQPDISSQVGEVVTLSCRYETIQSRYNIFWYKQLPSGEMIYLIGQGSSSQNARYGCYSVNLQRSRKSISLTISDLELEDSAKYFCALWE
Ammotragus lervia V298 trdv NIVO01042888.1 32848 SGVAQKVTQDQPDISSQVGDSAAMNCQYETSRNSYNIFWYKQLPSGEMIYLIGQNSYSPNARDGRYSINFLRSLKAISLIISALKLEDSAKYFCALWE
Ammotragus lervia V299 trav NIVO01042888.1 50874 MNGQQIKHFPEFLLLQEGENFTTYCNSSSTFYNLQWYKQSPGGSPVLLMILAKAGEVKTEQRLTGRLRETRQHSSLHLAAAQLSDAGTYFCAE
Ammotragus lervia V300 trdv NIVO01042888.1 56822 SGVAQKVTQDQLDVSSQVGQSVTLNCRYETSWVGYYLYWYKQLPSGQMTYLIHQYSGYSNARNGRYSVNFQKADKSISLIISSLQLEDSSKYFCALHE
Ammotragus lervia V301 trav NIVO01042888.1 73303 GTGAQLVTQPDGHINVSEGNRLELRCNYSYGGSIYLFWYVQYPSQGLQFLLRYLSGPTQVKGIKGFEAEFKNDENSFHLMKASAHWSDSAKYFCALC
Ammotragus lervia V302 trdv NIVO01042888.1 90595 SGVAQRVIQDQPDISGQLGQSVTLNCRYGTTWSSYYLFWYKLLPSGEMIYLIHQVSSGQNARNGRYSVNFQKARKSISLTISDLQLEDSAEYFCALWE
Ammotragus lervia V303 trav NIVO01042896.1 310 VSSQQNTVEQSPASLPVPEGAVASLGCTYSDRASQYFTWYRQYPGKGPEFLLLVYPDKDKEEGKFTAQSNKTNKRVSLHIRDSEPSDSATYLCAV
Ammotragus lervia V317 trav NIVO01045384.1 2163 MNGQQIKHFPEFLLLQEGENFTTYCNFSSTFYNLQWYKQRPGGSPVLLMILAKGGEVKTQQRLTVRFGESRQHSSLHLMATQPSDVGTYFCAT
Ammotragus lervia V321 trdv NIVO01045906.1 9111 SSVAQKVTQYQPDITSHVRNVVILNCRYETSWNVYTYRIFWYQQLPSGEMTYLIPQYSEDGNERDGHYSVNFQEAHKFISLTISSLKLEHSGKYFCALWE
Ammotragus lervia V322 trdv NIVO01045906.1 40088 SGVAQSVTQDQPDILSEVGKTVTLNCRYETSWDMLSYYIFWYKQLPSGQMTYLIRQYSDDGNARDGRYSVNFQKAHKSVSLTISALELEDSAMYFCVLRV
Ammotragus lervia V331 trav NIVO01047759.1 5448 QTHGNSVTQMDGQVSRSEGTSVTINCTYSASGYPALFWYVQYPGEGPQLLLKATKASDKGTNKGFEATYNTETTSFHLEKASVQESDSAVYYCALS
Ammotragus lervia V332 trav NIVO01047759.1 9661 VSLGNKVEQSPSTLNVQEGNSSVITCTYTDGYSEYFPWYKQEPGKGPQLLIAILSNKDKVEDQRLTVLLNKTAKRLSLHIATTEAGDSAVYFCAAR
Ammotragus lervia V333 trav NIVO01047759.1 17646 SSIAQKVTQDQPPMSVQEKETVTLDCTDDTSITTYSVSWYKQPSSGVMTFLIRQDSSNKPNATEGRYSLNFQKASKFITFTISASQLEDSAVYFCALSE
Ammotragus lervia V334 trav NIVO01047759.1 25606 QTHGDSVSQMDGQVTLLEGATLTVNCTYSAIGYPTLFWYVQYPGEGPQLLLKAMKANDKGTNKGFEATYDAKTTSFHLEKASVQESDSAVYHCALS
Ammotragus lervia V335 trav NIVO01047759.1 29620 GVRGVKVEQRPSVLSLQEGANSTLWCNFSDTVDSVQWFQRNPGGSLTRLFFIASGTKQNERLSSTVNSKERYSTLHITASQLEDAATYLCAVE
Ammotragus lervia V336 trav NIVO01047759.1 33714 VSLGNKVEQSPSTLSVQEGNSSVITCTYTDTASDYFPWSKQEPGKGPQLLVAIHSNMGEKKDQRLTVLLNKTAKHLSLHIATIQPGDSAVYFCAAR
Ammotragus lervia V337 trdv NIVO01047759.1 37534 SIIAQKVTQAQPQVLGQEKEAVTLDCKYDTSDSRYSLLWYKQPSSGGMILLIRQDSYNQQNATEGRYSLNFQKASKSITLDISASQLEDSAVYFCALSE
Ammotragus lervia V338 trav NIVO01047759.1 54604 VSGKNQVEQSPPSLAVLEGENCTFQCSYTVSPFNNLRWYTQDTGRGLVSLITMTYSDNKKSNGRYTATMDATAKHSSLHLTAAQLSDPAFYICVVG
Ammotragus lervia V339 trav NIVO01047759.1 69309 VSSQQNTVEQSPVSLPVPEGAVASLGCTYSDSNSQYFAWYRQYPGKGPEFLLNVYLDKDKEEGKFTAQSNKTNKHVSLRIRDSEPSDSATYLCAV
Ammotragus lervia V340 trav NIVO01047822.1 5869 GTNGDSVNQTEGPVTVSEGALTTLNCTYQTADSAPYLYWYVQHLNKAPQLLLKGSARDLKPKSEGFQATLVQSDRSFHLQKRAVQASDSAVYYCALS
Ammotragus lervia V341 trav NIVO01047822.1 17729 GTNGDSVNQTEGPVTVSEGALMTLNCTYQTADFSSYLYWYVQHLNKGPQLLLKGLTADKKVEHEGFQATLVKSDRSFHLQKRAVQASDSAVYYCALS
Ammotragus lervia V342 trav NIVO01047822.1 24409 GTNGDSVNQTEGPVTVSEGALMTLSCTYQTTYSNPYHYWYVQHLNKAPQLLLKGLTADKKVEHEGFQATLVKSDRSFHLQKRAVQASDSAVYYCALS
Ammotragus lervia V347 trav NIVO01049379.1 1595 LSVQMKVEQSPGVLTLQEGRNSSLICNYSISIRSVQWFQQNPDGRLISLFYIASGIQQKGRLKSTINSKERYSQLYIRDSQPGDSATYFCAVE
Ammotragus lervia V365 trav NIVO01052248.1 21873 TVIDAKTTQPNSMDCAEGEDVNLPCNHSTIRGDDYIHWYRQNPNQSPQYVIHGFQDTVNGSMASLTIASDRKSSTLVLPRVTLRDAAVYYCALRE
Ammotragus lervia V376 trav NIVO01055093.1 10278 GTSGDSVTQTEGVVILPEKASLTLKCTYQSSYSDFLFWYVQYKNKELELLLKSSLDNQKVTSRGFEATHISSDSSFHLQKSSVQTSDSAVYYCALS
Ammotragus lervia V377 trav NIVO01055093.1 14259 GTNGDSVNQTEGPVTVSEGALMTLNCTYQATYSIVYLFWYVQHLNKAPRLLLKGSMSDPKPKSEGFQATLVQSDRSFHLQKRAVQASDSAVYYCALS
Ammotragus lervia V378 trav NIVO01055093.1 25102 GTNGDSVTQTEGPVTVSEGAFMTLNCTYQATYSNVYLFWYIQHLNKAPQLLLKGSMTEQKPKREGFQATLVQSDRSFHLQKRAVQASDSAVYYCALS
Ammotragus lervia V379 trav NIVO01055093.1 32470 GTNGDSVTQTEGPVTVSEGAFMTLNCTYQATYSNVYLFWYIQHLNKAPQLLLKGSMTEQKPKREGFQATLVQSDRSFHLQKRAVQASDSAVYYCALS
Ammotragus lervia V397 trav NIVO01057852.1 95258 RTRAQTVTQPESHISVSKGDPVQVKCSYSYSGSPVLFWYVQYPRQHLQLLLKDTSRESIQGFIAELSRAEASFHLKKPSAQEEDSAVYYCALG
Ammotragus lervia V419 iglv NIVO01061362.1 1050 SLSQPLLTQPASLSASPGASARLTCTLSSGYNVGNYSIYWYQQKAGSPPRYLLRFKSDLDKHQGSGVPNRFSGSKDASTNTGLLLISEVQPEDEADYYCAVWHG
Ammotragus lervia V461 trbv NIVO01066312.1 4236 LVDSGVIQTPKYLIKSRKQQVTLRCSPESGHRYVSWYQQALGQGPQFLVQYFDREVNEKGNMPDRFSGEQFSDSRSQMNLSSLELTDSAMYLCASSQ
Ammotragus lervia V462 trbv NIVO01066312.1 6519 AVHAGVTQDPRFQVVRTGQNATLYCTQDLGHDRMYWYRQDLGHGLRLIHYSVAYPTTEKGDVPEGYSVSRSSKENFPLTLKSANRSQTSVYFCASSY
Ammotragus lervia V463 trbv NIVO01066312.1 8717 LVDSGVTQTPRYLIKARGQRGTLRCSPVSGHLYVYWYQQALGQGPQFLIQYYSQDVWGETNLPDLFSGEQFSDSSSELNLTSLELRDSAVYLCASSQ
Ammotragus lervia V464 trbv NIVO01066312.1 19710 LVDSGVTQTPKYLIKSRKQQATLRCSPESGHRYVSWYQQALGQGPQFLVQYYDGKVRTKGNMPDQFSGEQFSDSHSQMNPSSLELTDSAVYLCASRQ
Ammotragus lervia V465 trbv NIVO01066312.1 22623 AVHAGVTQDPRFQVVRTGQSLTLKCTQDLNHDSMYWYRQDLGHGLRLIHYSSFTDATYKGDVPDGYNVSRSSTENFPLTLESASRSQTSVYFCASSY
Ammotragus lervia V466 trbv NIVO01066312.1 25474 HTGAGVVSQSPRHRVAGRGQNVTLRCDPISGHISLYWYRQTLGQGPEFLTYFQNKQELDKSGMPKNRFSAKRPQSTYSYLNIQPAEPGDSAVYLCASSP
Ammotragus lervia V467 trbv NIVO01066312.1 36677 PLEAEVTQTPRHLIKTKGQTATLRCSPMSGHSSVSWYQQARSQGPQFLFEFYETLQRDKGNFSNRFSAKQLRDFSSELNVNFLELTDSALYLCASSL
Ammotragus lervia V468 trbv NIVO01066312.1 41680 HTRAGVVSQSPGYRVAGRGQNVTLRCDPIPGHQVLYWYRQMLGQGPEYLTYFQGKEEPDKSGMPKNRFSAERLESTYSYLKIQPVEPKDSAVYLCASSP
Ammotragus lervia V469 trbv NIVO01066312.1 63955 TTDANLGVTQTPRHEVTEKGQAVTLSCEPIKSHTALYWYRQTSGRGLQLLTYFRNEAPVDESGMPKDRFSAKMPNSSFSTLKIQPTDPGDSATYLCASSK
Ammotragus lervia V470 trbv NIVO01066312.1 75931 PMDAGVTQTPRHEVTEKGQAVTLSCEPIKSHAALFWYRQTSVRGLELLIYFNNQSPVDESGMPKDRFSAKMPNASFSTLKIQPTEPGDSATYLCASSK
Ammotragus lervia V471 trbv NIVO01066312.1 78418 YISAEVAQSPSHRVIEKKQAVNLSCDPISGHNSLFWYYHAVGTEMKLLIYFLRESVQDNSGMPKGRFTAERTQGTSSTLRVHSAELGDSGVYFCASS
Ammotragus lervia V472 trbv NIVO01066312.1 80739 HVGAMVIQNPRYLVTGLGKPVTLSCSQNMNHDAMYWYQQKPSQAPKLLLYYYDKEITREKNTSENFQSSRPNTSLCSLDIRSAGLGDSAMYLCASSR
Ammotragus lervia V473 trbv NIVO01066312.1 85667 FLEAEVTQTPGHLVQGKGLEVEMYCVPKKGHIYVFWYQQILAKEFKFLISFQNDQVLDDKEMPKKRFSAKCPSNSPCSLKIQPAELQDSAMYFCASSD
Ammotragus lervia V474 trbv NIVO01066312.1 99440 TVAGEVTQTPKYLLKKEGGAVTLECEQDFDYDSMYWYQQDPGLGLRRIFFSKVVKDVQEEDIAKGYSASREKKQFFPLTVTSAQKNQMALYLCAASI
Ammotragus lervia V475 trbv NIVO01066312.1 104250 GSGLGAVVSQQPHRAVSKSGASVTIECRAVDFQATTVFWYRQFPKRGLVLMATSNAGTDATYEQGYNKDKLPISQPNLTFSSLMVTNVVPADSSLYFCSAR
Ammotragus lervia V476 trbv NIVO01066312.1 114787 SMDTEVTQNPSHLVKGKDQRAKMDCVPIKGHSNVYWYRKKLEAFEFLVYLWNGKVTEDTAMFKQRFSAECPQNSPCSLEIKSTEAPDSALYFCASS
Ammotragus lervia V477 trbv NIVO01066312.1 123806 SMDTEVTQSPSHLVKGKDQRAKMDCVPKKGHSYVYWYRRKLEEAFEFLVYLQDEKIIEDTDMFKQRFSAECPQTSPCSLGIKSTKASDSALYFCASSQ
Ammotragus lervia V478 trbv NIVO01066312.1 128639 SMDTEVIQSPGHLVKGKDQKAKMDCVPIKGHVHVYWYRKKPEGAFEFLVYLQNQDVVEDTEVFQQQFLAQWPQNSPCSLEIKSTKAADSALYFCASSQ
Ammotragus lervia V479 trbv NIVO01066312.1 132551 SVDTEVTQSPSHLVKGKGQKAKMDCVPIKGHINVYWYRRKLEEALEFLVYLQKQDIEEDTEVFKEQFSAQCPQNSPCSLEIKSTKAADSALYFCASSQ
Ammotragus lervia V480 trbv NIVO01066312.1 138887 SMDTEVTQRPSHLIKGKDQKAKMDCVPKEGHAYVYWYRKKPEGAFEFLVYLQNQDTMEETAEFKQRFSAECPQNSPCSLEIQSTKAADSALYFCASSQ
Ammotragus lervia V481 trbv NIVO01066312.1 143432 PMDAEIYQVRFLLAEAGQDVTLECKQNLGYSAMYWYRQDPGQGLKLIYYSTVEKDIQRGDLSEGYSVSREKRELFPLTVKSAHTKQTAVYLCSR
Ammotragus lervia V482 trbv NIVO01066312.1 150515 SMDTGVTQTPRNRIAITGKSTVLECSQTKGHESMYWYRQDPGRGLRLVYSSYDVNGINKGDVSAGYNVSRKEKAKFSLYLEPATPNQTAIYFCASSI
Ammotragus lervia V483 trbv NIVO01066312.1 156867 FTDADVYQTPRHCVTGTGRKITLECSQTMGHDNMYWYQQDPGMELQLIHYSYGVNTTEKGEHSSRSTVSRISKEHFPLTLETTSSSQTSSYFCASSD
Ammotragus lervia V484 trbv NIVO01066312.1 158799 LEDAAVIQFPRHRILKAEKEFTLQCSQKMNHYAMYWYRQDPGFGLQLIYYSTGPDTFKKGDVPEGYHVSRDELDHFPLTLKFASPNQTSVYFCASAE
Ammotragus lervia V485 trbv NIVO01066312.1 169656 PLEAGVTQSPRHRITETRKRVTLTCSQNMNHDVMYWYRQDPGLGPKLIYFSRNVGFVEKGDISDGYTASREEKPNFPLILELTSTNQTSLYLCASSE
Ammotragus lervia V486 trbv NIVO01066312.1 175755 LTDAQVIQTPRYLVKRRGEKVVIECIQNMDHERMFWYRQDPALGLRLLHFSIDVDVLEEGDVPYGYSVSRMKKNSFPLTLESATTNQTAMYLCASSE
Ammotragus lervia V487 trbv NIVO01066312.1 183581 SVFGALLSQKPSRAIRQRGTSMTIECQADSQLNFMYWYRQLPGQSLVLMATANQGSKATYESGFTEDKFPISRPNLAFSNLTVSNASSEDSSSYFCSAG
Ammotragus lervia V495 trdv NIVO01066605.1 26066 VCLDIILESETKTLTVLLGEPATFCCNVTGGNWKNYQMSWYKRNENNVLTLVYRLSNNSNENVRGNFKEKIDTSKNQYVLNIQKATIKDVGTYYCGSD
Ammotragus lervia V496 trdv NIVO01066605.1 50040 VMSAVVLVPQDQEKTVPVGKSVTLSCSMKGAMFISKHYIFWYRKTPGNTMTFIYREEGVYGPGFEDNFRGKIDNSTNQAMLEILKASERDEGFYYCASD
Ammotragus lervia V503 trav NIVO01068079.1 2636 MNGQQIKHFPEFLLLQEGENFTTYCNSSSLLSSLQWYKQRPGGSPVLLMILTKSGEVKTQQRWTGRFGESRQHSSLHLTAAQLSDAGTYFCAE
Ammotragus lervia V504 trdv NIVO01068079.1 9305 SGVAQKVTQDQSDVSSQVGQSVTLSCRYETSWSVYYLYWYKQLPSGQMTYVIRQGSEATNARKERYSVNFKKADKSIKLTISALQLEDSAKYFCALSL
Ammotragus lervia V505 trav NIVO01068079.1 17088 TVINAKTTQPSSMDCAEGEDVNLPCNHSTIGANDYIHWYRQNPNHSPQYVIHGLRGTVNGSMASLTIASDRKSSALVLPQVTLRDAAVYYCTLRE
Ammotragus lervia V506 trav NIVO01068079.1 20084 VGGVDVEQSPPALSLQEGASYTLQCNFSTSSQSVNWYLQNPGGHIIHLFYIPSGTKQDGRLKATTAPAERRSSLHISSSQPTDSGTYFCAAQHSAPQ
Ammotragus lervia V507 trav NIVO01068079.1 24534 TVINAKTTQPSFMDCAEGEDVTLTCNHSTIGGNDYIHWYRQNPNQSPQYVIHGFRDTVNRSMASLHIASDRKSSTLVLPQVTLRDAAVYYCVLRE
Ammotragus lervia V508 trdv NIVO01068079.1 40912 SSVGQKVAQYQPDITSQVRNVVILNCRYETNWNVYTYWIFWYKQLPSGEMTYLIHQYSEDRNERDGHYSVNFQKAHKFISLTISSLKLEHSGKYFCALWE
Ammotragus lervia V509 trdv NIVO01068079.1 53666 SGVAQSVTQDQPDILSEVGKTITLNCRYETSWNMLSYYIFWYKQLPSGQMTYLIRQYSEDGNTRDGRYSVNFQKAHKSISLTISALELEDSAKYFCVIRV
Ammotragus lervia V582 trdv NIVO01001281.1 3491 SSMADKVTQAQTTVTGQEGEAVTIGCTYETSQIYYTLFWYRQFPGGRMEFLIYQDSNKANARRDRYSVNFQKGKNIISLTISSLHLADSVKYFCALWE
Ammotragus lervia V588 trav NIVO01002475.1 22216 VLGDSKTTQPNSVEGAEEEPVHLPCNHSTISGSEYVYWYRQIPHQGPEYLIHGLNNNVTNRMASLSIAKDRKSSTLVLPQVTLRDTAVYYCILR
Ammotragus lervia V589 trav NIVO01002475.1 15055 LRVQMKVEQSPGVLTLQEGRNSSLICNYSISMTSVQWFQQNPDGRLISLFYIASGMQQKGRLKSTINSKERYSQLYIRDSQPGDSATYFCAVE
Ammotragus lervia V603 trav NIVO01004505.1 52182 TVIDAKTIQPSSMDCAEGEDVNLPCNHSTISGNEYIHWYRQNPNQSPQYVIHGLRGTVNSSMASLQIASDRKSSTLVLPQVILRDAAVYYCILRE
Ammotragus lervia V604 trdv NIVO01004505.1 34962 SSVAQRVTQNQPDISTQVGEIVTLSCRYETVQSYYHIFWYKQLPSGEMIYLIGHDSSSQNARYGRYSVNFKISCKFISLTISDLELEDSEKYFCALWE
Ammotragus lervia V605 trdv NIVO01004505.1 20640 SGVAQKVTQDQPDISSQVGELATMNCQYETSWSSYNIFWYKQLPRGEMIYLIGQNSYSPNARDGRYSINFQRSLKAISLIISALKLEDSAKYFCALWE
Ammotragus lervia V606 trav NIVO01004505.1 9231 MNGQQIKHFPEFLLLQEGENFTTYCNSSSTFYSLQWYKQSPGGSPVFLMILTKPGEAKMEQRLTGQLRETRQHSFLHLAAAQLSDAGTYFCAE
Ammotragus lervia V607 trdv NIVO01004505.1 6415 SGVAQKITQDQPDVSSQMGQSVTLNCRYETSWSYYYLVWYKQLPSGQMTYLIQQYSGNSNARNGRYSVNFQKADKSISLIISPLQLEDSAKYFCALCD
Ammotragus lervia V681 trdv NIVO01016960.1 1290 SGVAQKVIQDQQDISSQLGQSVTLNCRYATTWSYLFWYKLLPNGEMIYLISQVSSGQNARNGRYSVNFQKARKSVSLTISDLQLEDSAEYFCALWE
Ammotragus lervia V686 trav NIVO01017843.1 3946 VSLGNKVEQSPSTLSVQEGNSSVITCTYTDTASAYFPWYKQEPGKGPQLLIAIRSNKDKEEDQRLTVLLNKTAKRLSLHIATTEAGDSAVYFCAAR
Ammotragus lervia V811 trdv NIVO01034763.1 1251 SSVAQKVTQYQPDITSHVRNVVILNCRYETSWNVYTYRIFWYQQLPSGEMTYLIPQYSEDGNERDGHYSVNFQEAHKFISLTISSLKLEHSGKYFCALWE
Ammotragus lervia V842 trav NIVO01038789.1 69750 RSVAQTVTQPQPEESVQEADTVTLDCTYTTSESDYYLFWYKQPPSGEMVFIIHQYAYEQQNATNDRYSVNFQKEAKAFSLRISDSQLEDAAMYFCAYSG
Ammotragus lervia V843 trav NIVO01038789.1 66839 PSVAQTVTQPQPEESVQETGTVTLDCTYTTSESNYYLFWYKQPPSGEMVFIIRQNAYEQQNATNDRYSVNFQKEAKAFSLKISDSQLEDAAMYFCAYSG
Ammotragus lervia V844 trav NIVO01038789.1 33560 VSGKNGVEQSPRYLSSQEGDLITINCNYLEGMTTLQWLQQNPGGSIISLLTLSLEMKRKGRVSATINRREHYSSLNITASQPTDSAIYFCALE
Ammotragus lervia V845 trdv NIVO01038789.1 3935 SNNVESADVPTVYKKEGESVTVECKFSVSYTYYMMYWYRQPSSGEMIYMINIYSQSKHSREGRYSVEFYKPNQMLKLTISALTLSDSAVYFCAVRE
Ammotragus lervia V897 trbv NIVO01047699.1 552171 TWGTGVFQTPKYLLTQMGTKTSLECEQKLNHDNMYWYKQDSKKLLKAMFHYNNKELVENETVPSRFSPESPDKAHLNLHIDSLEPGDSAVYFCASS
Ammotragus lervia V898 trbv NIVO01047699.1 547783 VSADPGITQIPKYLVMGTTDKKSLKCEQHLGHNAMYWYKQSAQKPPELMFIHNYMKLNGNESVPSRFWPECPDNSQCRLDLSAPKPQDSAVYLCASSR
Ammotragus lervia V899 trbv NIVO01047699.1 530254 LVDSEVTQTPKYLIKSRKEQATLRCSPESGHRSVNWYQQALGQGPRFLVQYYRGQPSGEENMPDRFSAKQFSDFRSELNLSSLELTDSAVYLCASSQ
Ammotragus lervia V900 trbv NIVO01047699.1 525396 AVHAGVTQDPRFQVVRRGQRVTLRCTQDLNYDYMYWYRQDPGHGLRLIHYSDGPHTTEKGDVPDGYNVSRPSTENFPLTLESASRSQTSVYFCASRY
Ammotragus lervia V901 trbv NIVO01047699.1 521553 LVDSEVTQTPKYLIKSRKQQATLRCSPESGHFSVYWYQQALGQGPQFLVQYYNQKVSGEAHLPDRFSGKQFSDSRSELNLSSLELMDSAMYLCASSQ
Ammotragus lervia V902 trbv NIVO01047699.1 517650 VVHAGVTQDPRFQVVKTGQRATLNCSQDLGHNYMYWYRQDPGHGLRLIHYSAGPPTTQQGDVPEGYSVSRSSTENFPLTLESANPSQTSVYFCASSY
Ammotragus lervia V903 trbv NIVO01047699.1 511841 LVDSEVTQTPKFLTKSRKQQVTLRCSPESGHRSVYWFQQALGQGPQFLIQYFDGEVYQRGNMSDRFSGQQSGLELNLTSLELMDSALYLCASSP
Ammotragus lervia V904 trbv NIVO01047699.1 510091 AVHAGVTQDPRFQVVRTGQRAILTCTQDLGHDRMYWYQQDLAHGLRLIHYSAGMHTSKPGGVPDGYSASRSNTENFSLTLESANHSQTSVYFCASSYSMA
Ammotragus lervia V905 trbv NIVO01047699.1 507864 LVDSGVTQTPKYLIKSRKQQGILRCSPESGHRYVSWYQQALGQGPQFLVQYYDGKVRTKGNMPDRFSGEQFSDSRSQMNLSSLELTDSAVYLCASSQ
Ammotragus lervia V906 trbv NIVO01047699.1 498048 LVDSGVTQTPKYLIKSRKQQAMLRCSPESGHLSVYWYQQALGQGLQFLIQYYNRAENEKGNIPDRFLGKQFSDSSSELNLTSLELTDSAVYLCASSK
Ammotragus lervia V907 trbv NIVO01047699.1 496244 SVHTGVTQDPRFQVVTTGQSTTLRCTQDLSFSYMYWYRQDPGHGLRLIHYSVIPTSTEKGAVPEGYSVSRPSTENFPLTLESANPSQTSVYFCSCGY
Ammotragus lervia V908 trbv NIVO01047699.1 493136 AVHAGVTQDPRFQVVRTGQRATVTCTQDLGHDYMYWYRQDLEHGLRLIHYSAGPPTTVQGDVPDRYSVSRSSKENFPLTLESANLSQTSVYFCASS
Ammotragus lervia V909 trbv NIVO01047699.1 490145 LVDSGVTQTPRYLIKARGQRGTLRCSPVSGHLSVYWYQQVLGQGPQFLVEYYSQDVRGETKLPDRFLGKQFSDSSSELNLTSLELMDSAVYLCASSQ
Ammotragus lervia V910 trbv NIVO01047699.1 485561 VVHAGVTQDPRFQVMTTGQSMTLKCTQDLGHDRMYWYQQDLGQGLRLIHYSDGLPTTELGDVPDGYRVSRSSKENFPLTLDSANLSQTPMYFCASSYSMALH
Ammotragus lervia V911 trbv NIVO01047699.1 481604 VVHAGVTQDPRFQVVRTGQRATVTCTQDLGHDRMYWNRRDLGHGLRLIHYSAGPPTTEKGDVPDGYRVSRSSKQNFPLTLESASYSQTSVYFCASSY
Ammotragus lervia V912 trbv NIVO01047699.1 471788 LVDSGVTQTPRYLIKARGQQETLRCSPVSGHLSVYWYQQALGQGPQFLVQYYRQQVWGEAQLPDRFSGEQFSDSSSELNLTSLELTDSAVYLCASSQ
Ammotragus lervia V913 trbv NIVO01047699.1 461369 LVDSGVTQTPKYLIRSRKQQATLRCSPESGHRYVSWYQQALGQGPQFLVQYYDGKVHTKGNMPDRFSGEQFSDSRSQMNLSSLELTDSAVYLCASRQ
Ammotragus lervia V914 trbv NIVO01047699.1 456410 LVDSEVTQTPKYLIKSRKEQVTLRCSPKSGHRSVYWYQHALGHGPQFLVQYYDGKVYQKENISDRFSGKQFSDARSELSLTPLELTDSAVYLCASSQ
Ammotragus lervia V915 trbv NIVO01047699.1 454749 AVHAGVYQDPRLQVVRTGQSVTLTCTQDLGHNSVYWYQLDPGHGLRLIHYSAAYPTTEKGDMPKGYSVSRPSTEDFPLTLKSANRSQTSVYFCDSSYSMV
Ammotragus lervia V916 trbv NIVO01047699.1 452490 LVDSGVTQTPRYLIKARGQRGTLRCSPVSGHLSVYWYQQVLGQGPQFLVEYYSQDVRGETKLPDRFLGKQFSDSSSELNLTSLELTDSAVYLCASSQ
Ammotragus lervia V917 trbv NIVO01047699.1 450682 AVHAGVTQDPRFQVVRTGQNVTLKCTQDLGHNSMYWYRQDPGHGLRLIHYSTGHPTTVKGDVPDGYSVSRSSKENFPLTLESANPSQTSVYFCASSY
Ammotragus lervia V918 trbv NIVO01047699.1 442521 AVHAGVTQEPRFQVMTTGQSTTLKCTQDLDHNSMYWYRQDPGHGLRLIHYSRGPPSTERGDVPNGYSVSRSSKEKFPLTLESANPSQTSVYFCASSYSMA
Ammotragus lervia V919 trbv NIVO01047699.1 439366 AVHAGVTQDPGFQVVSTGESATLRCTRDLSFSYMYWYRQDPGHGLRLIHYSVIPPATEKGAVPEGYSVSRPSTDNFPLTLESANPSQTSVYFCSCGY
Ammotragus lervia V920 trbv NIVO01047699.1 424482 LVDSGVTQTPKYLIRSRKQQATLRCSPESGHRYVSWYQQALGQGPQFLVQYYDGKVRTKGNMPDRFSGEQFSDSRSQMNPSSLELTDSAVYLCASRQ
Ammotragus lervia V921 trbv NIVO01047699.1 421717 AVHAGVTQDPRFQVMMTGQSMTLKCTQDLDHNSMYWYRQDPGHGLRLIHYSRGPPSTEREDVPNRYSVSRSSKGNFPLTLESANPSQTSVYFCASSYSMA
Ammotragus lervia V922 trbv NIVO01047699.1 418368 SVHAGVTQDPRFQVVRTGQSTTLKCTQNLGHNSMYWYRQDPGLGLRLIHYSATYPSTEKGDVPEGYNVSRPSTEDFPLRLKSANRSQTSVYFCASSY
Ammotragus lervia V923 trbv NIVO01047699.1 416140 LVDSGVTQTPRYLIKARGQQGTLRCSPVSGHLSVYWYQQALGQGPQFLVQYYSQNVYGEAQLPDRFSGEQFSDSSSELNLTSLELTDSAVYLCASSQ
Ammotragus lervia V934 trav NIVO01049042.1 1405 VSLGNKVEQSPSTLSVQEGNSSVITCTYTDTASDYFPWYKQEPGKGPQLLVAIHSNMGEKKDQRLTVLLNKTAKHLSLHIATIQPGDSAVYFCAAR
Ammotragus lervia V950 ighv NIVO01051093.1 9397 VLSQVQLQESGPSLVKPSQTLSLTCTVSGFSLTSKAVGWVRQAPGKAPEWLGGISSGGSTGYNPALKSRLSITRDTSKSQVSLSLRSVTTEDTAVYYCAR
Ammotragus lervia V975 trav NIVO01054983.1 503 VRGVDVEQSPPALTPQEGASSTLWCNFSTLADSVRWYLQTPGGHLIHLIYIPSGTRQEGRLNATAVPTERRSSLHISSLRTTDSGTYFCAVQHSAPQ
Ammotragus lervia V995 trav NIVO01057852.1 76925 GARAQTVTQPESHIPVSEGDPVQVKCSYSYSGSPVLFWYVQYPRQHLQLLLKHTSREGIQGFTAELSRAEASFHLKKPSAREEDSAVYYCALG
Ammotragus lervia V996 trav NIVO01057852.1 70617 VNSQQGEQNLQTLSIQEGENVTMNCSYKSITITALQWYRQDSRRGFVHLILIRSNERLKHSGRLLFTLDSSIQSSSVSITASQAEDTATYFCAP
Ammotragus lervia V997 trav NIVO01057852.1 37507 ENNGDSVNQTEGPVTVSEGALMTLNCTYQTANSAPFLFWYIQHLNKAPQLLLKGLTADKKVEHEGFQATLVQSDMSFHLQKRAVQASDSAVYYCALS
Ammotragus lervia V998 trav NIVO01057852.1 29011 GTNGDSVSQTEGPVTVSEGALMTLNCTYQTADSASYLYWYVQHLNKALQLLLKGSARDPKPKSEGFQATLVQSDMSFHLQKLGVQASDSAVYYCALS
Ammotragus lervia V999 trav NIVO01057852.1 18348 GTNGDSVSQTEGPVPVSEGALMTLNCTYQTAGFTPYLYWYVQHLNKAPQLLLKGLTADKKVEHEGFQATLVQSDRSFHLQKRAVQASDSAVYYCALS
Ammotragus lervia V1000 trav NIVO01057852.1 9901 ETNGDSVSQTEGPVTVSEGALMTLNCTYQTTYSDFYLFWYVQHLNKAPQFLLKGSMTNRRPEHEGFQATLVQSDSSFLLQKGAVQASDSAVYYCALS
Ammotragus lervia V1001 trav NIVO01057852.1 6137 GTNGGSVNQTEGPVTLSEGALMTLNCTYEATFSDSYLFWYVQHLNKAPQLLLKGSMTNQRPEHEGFQATLVQSDRSFHLQKWAVQASDSAVYYCALS
Ammotragus lervia V1002 trav NIVO01057852.1 3961 SITAQKVTQNRSEISVLEKEDVILNCAYEANSYTYYLFWYKQPPSGEMIFLIHQESYNELNTTKAQYFLNFQKAMSSISLTITDLQLEDSAVYFCALR
Ammotragus lervia V1015 iglv NIVO01060171.1 1295256 SWAQSALTQPASVSGNPGQTVTISCAGTSSDIGGYNYVGWYQQLPGSAPKTLIYEVSKRPSGIPARFSGSKSGNTATLTISGLQAEDEADYYCS
Ammotragus lervia V1016 iglv NIVO01060171.1 1291735 SWAQSALTQPASVSGNPGQTVTISCTGTSSDIGAYNGVSWYQQLPGSAPKTLIYNVNNRPSGIPARFSGSKSGNTATLTISGLQAEDEADYYCSSLKSG
Ammotragus lervia V1017 iglv NIVO01060171.1 1276783 SSAQSALTQPASVSGNPGQTVTISCAGTSSDIGGYNYVGWYQQLPGSSPKTLIYEVSKRPSGIPARFSGSKSGNTATLTISGLQAEDEADYYCS
Ammotragus lervia V1018 iglv NIVO01060171.1 1256762 HLASSQLTQPPAVSVSLGQTASITCQGDDIGSSYANWYQQKPGQAPVTVIYEFSERPSGISDRFSGSNSGNTATLTISGARTEDEADYYCLSYGSSYN
Ammotragus lervia V1019 iglv NIVO01060171.1 1249871 SVVSYELTQPTSVSVALGQTAKVTCQGDNLGSSYVQWYQQKPGQAPVTVIYQDSKRPSGIPDRFSGSSSGNTATLTISGARTEDEADYYCQSADSSYN
Ammotragus lervia V1020 iglv NIVO01060171.1 1245020 SVVSYELTQPTSVSVALGQTAKVTCSGDLLDENFAHWYQQKPGQAPVLVIYLNSERASGIPDRFSGSSSGSTATLTISGVQAEDEADYFCQSYDSSYN
Ammotragus lervia V1021 iglv NIVO01060171.1 1225630 SVVSYELTQPTSVSVVLGQTAKVTCSGDLLDEQYTQWHQQKPGQAPELVIYEDSKRRSGIPDRFSGSSSSKTAILTISGVRAEDEADYYCVSWDSGSYN
Ammotragus lervia V1033 igkv NIVO01061258.1 1112047 SNGAIVLTQTPRSLSVIPGEMASISCRASQSVQNRYGDNFLHWYVQKPSQSPQLLIYAASNRASGVSDRFTGSGSGTDFTLKISRVEAEDAGVYYCQQSKETP
Ammotragus lervia V1034 igkv NIVO01061258.1 1100419 SSGDVVLTQTPLSLSAIPGGTVSISCKSSQSLKYSDGNTYLYWFQHKPGQSPRRLIYLVSNRDTGVPDRFTGSGAETDFTLTISSVQAEDAGVYYCIQAINYP
Ammotragus lervia V1035 igkv NIVO01061258.1 1094523 SIGAMMQTQTLRSLSVIHGEKASISCRASQSIQNRYGYNFLHWYGQKPSQSPQLLIYRASNWESGVPDRFTSSGLGAGTILIVSRVEAEDAGVYYCQQSLQ
Ammotragus lervia V1036 igkv NIVO01061258.1 1085446 SSGDVVLTQTPLSLSVIPGETASISCKSSQSLVHSDGKTYLNWIQHKPGQSPQGLIYQVSSRYSGVSDRLTGSGSGTDFTLTISSVQAEDAGVYYCYQGTEAP
Ammotragus lervia V1037 igkv NIVO01061258.1 1055291 ARCDIQVTQSPSSLSASLTERVSITCRTSQSVSNYLNWYQQKPGQAPKLLIYYATRLHTDVPSRFSGSGSGTDYTLTISSLEADDAATYYCLQDYS
Ammotragus lervia V1038 igkv NIVO01061258.1 1041722 ASGEAVLYQTPAYIAVPLGESISITCRANQSISDYLSWHKQKPGQAPMILIYDADNRRNGVPERFTATQSGTEFVFTISQVEADDAAMYYCQQSYVLP
Ammotragus lervia V1039 igkv NIVO01061258.1 1033280 AKCDIQVTQSPSSLSASLGDRVSITCQASQNIDTKLAWYQQKPRKAPKLLIYAVSRSPSWFPSQFSGSGFGIDFTLTISSLKADDIATYYCQQ
Ammotragus lervia V1054 trav NIVO01064088.1 5413 GTNCDSVNQTEGPVTVSEGALMTLNCTYQTTYLNSYLFWYVQHLNKAPQLLLKGLTADKKVEHEGFQATLVKSDRSFHLQKWAVQASDSAVYYCALS
Ammotragus lervia V1058 trav NIVO01065127.1 1682 GVRGVKVEQRPSVLSLQEGANSTLWCNFSDTVNRVQWFQQNPGGSLTRLFVIASGTKQNERLSSTLNSKERYSTLHITASQLEDAATYLCAME
Ammotragus lervia V1062 trgv NIVO01065774.1 1229634 GLGLSKVEQAQISLSTEVKKSIDIHCKIESTNFESEAVYWYRQKRNQALEHLVYVISTTTAARNQVDGKNKIEARKDARMFTSTLTVNFVGKEDVGIYYCAGWS
Ammotragus lervia V1063 trgv NIVO01065774.1 1218279 GLGQLTLEQPELSVTGTREKSIIMTCKVFSKDFSKDYIHWYRQKPDQGLEQLLYVSTTPAQNHLGGKKNKLEARKDAPSSTSTLKISFLEKEDEATYYCAGWS
Ammotragus lervia V1064 trgv NIVO01065774.1 1211542 GDIKMRISQHQLSSTRRPDRTVHISCKLSGVPLENAIVHWYQEKEGEPLKRILYGSANSYKLDKPNSRLEMDNKKNGIFYLIINNVVKSDEATYYCACWD
Ammotragus lervia V1065 trgv NIVO01065774.1 1176192 TQVSSNMGEDKLSVMRATGSSVVIDCDLTQNYIHWYKFQEGTVPRRLLYYDVYYSKVVLESGISEGKYHVYKGTGKSYTFVISNLQESDSGTYYCAVWE
Ammotragus lervia V1066 trgv NIVO01065774.1 1162272 MQVSSNMEGEKMSITKAAVPGAFVEIICDLITQTVKYIHWYKYQEGTAPRRLLYYDISYSKIVLESGISEGKYKVYKEKSYTFAISNLQESDSGMYYCAVWE
Ammotragus lervia V1067 trgv NIVO01065774.1 1135108 TQVSSNMEGYRMSITRALGSSAVIPCDLPTQNIKYIHWYKFQEGTIPRRLLYYDVSYSKVVLESGISPGKYHCYEGTDKIYKFVISSLQESDSGVYHCAVWE
Ammotragus lervia V1084 trav NIVO01067687.1 11142 VKSDDDVMQSPSSLIVLEGSNATLSCSYKVTNFQSLHWYKQEEKVPTFLFALISTGIEKTSGRLRGTLDRKELLSTLHITVTKPGDSATYLCAVE
Ammotragus lervia V1085 trav NIVO01067687.1 4937 PRKADWIRSQESEVSGAEGKTVSLFCNYYTSSRSFVSLFWYRQYPNQVPEYILYRQWGSSAKGYASFATERFYSDNTANTTNLYIKKVVPADTALYLCALE
Ammotragus lervia V1090 trav NIVO01068957.1 2347 GTNGDSVNQTEGPVTVSEGALMTLNCTYQTANRAPYLFWYIQHLNKAPQLLLKGSISDPKPKIEGFQATLVQSDRSFHLQKRAVQASDSAVYYCAVS
Ammotragus lervia V1101 trav NIVO01070918.1 801 TVIDAKTTQPNSMDCAEGENVNLPCNHSTIGDDYIHWYQQNPNQSPQYAIHGLRGTVNSSMASLTIAPDRKSSTLVLPQVTLRDAAVYYCALRE
Ammotragus lervia V1116 trdv NIVO01072847.1 1446738 AHAQMVQVNDSMYGFIGTDVVLHCSFANPLPGVKITQVTWQKATNGSKQNVAIYNPAMGVSVLAPYRERVEFLRPSFTDGTIRLSRLELEDEGVYICEF
Ammotragus lervia V1119 trav NIVO01074209.1 63586 ASSKQDVSQSPEALSVREGDGLVLNCSHTDSALYFLQWFRQDPGKGLTSLLSIQANQKEQARGRITVSLDKSSRHSALYIATSQHSDSTTYLCAV
Ammotragus lervia V1120 trav NIVO01074209.1 59190 GAGAQSVTQPDDHITVSEGARLELKCNYSSSVSPYLFWYVQCPNQGLQLLLKYESGDNLVSGIRAFEAELRRSEKSFHLRKIPAHWKDLAKYFCVLS
Ammotragus lervia V1121 trav NIVO01074209.1 55233 VRGMDVEQSPPVLSLQEGSSSTLRCNFSTLPNNVQWYLQNPGGRLIHLFYIPSGTKQDGRLKATTVPTERRSSLHISSSQTSDSGTYFCAEQHSAPQ
Ammotragus lervia V1122 trdv NIVO01074209.1 41612 FGVAQKVTQDQPYVTSQIGQSVILNCRYAVRWSGYTHYLFWYKQLPSGEMTLRIRQESSGLNARNGHYSVNFQRAQNTISLTISALQPEDSAKYFCVVWE
Ammotragus lervia V1123 trdv NIVO01074209.1 40101 FGVAQKVTQDQPYVTSQIGQSVILNCRYEVRWSGYTHYLFWYKQLPSGEMTFLIRQESSGLNARNGRYSVNFQRAQNSISLTISALQPEDSAMYFCAVRE
Ammotragus lervia V1124 trav NIVO01074209.1 35037 VNAQQISQIPQFLLLQEGENFTTYCNSSSTLTNLQWYKQRPGESPVLLMILAKAGEVKTEQRLTGRLGETRKHGSLHLAAAQLSDAGTYFCA
Ammotragus lervia V1125 trav NIVO01074209.1 33344 VNAQQISQIPQFLFLQEGENFTTYCNSSSTLTNLQWYKQRPVESPVLLMILAKAGEVKMEQRLTGRLGETRNHGSLHLVAAQLSDAGTYFCA
Ammotragus lervia V1126 trav NIVO01074209.1 19247 VRGVDVEQSPPALSLQEGASYTLQCNFSTSPQSVNWYLQNPGGHLIHLFYIPSGTKQDGRLKATTAPAERRSSLHISSSQTTDSGTYFCAAQHSAPQ
Ammotragus lervia V1127 trav NIVO01074209.1 18792 VRGVDVEQSPPALSLQEGASYTLQCNFSTSPQSVNWYLQNPGGHLIHLFYIPSGTKQDGRLKAATVPAERRSSLHISSSQTTDSGTYFCAAQHSAPQ
Ammotragus lervia V1128 trdv NIVO01074209.1 13035 SGAAQKVTQDQPDITSQVGQSVTLNCKYEVSWYKSSYSIFWYKQLPSGQMTYLIRQYSENGNARDGRYSVNFQKADKSISLTIPALQLKDTAKYFCA
Ammotragus lervia V1132 trbv NIVO01075409.1 14464 VRAQTIHQWPSTRVQPAGSPLSLECTVKGTSNPTLYWYRQEAGGSLQLLFYSIGVDQTEPREFQNFEASRPQDGQFTLSSKKLQLNNSGFYLCAWS