WGS Statistics
Organism WGS Record. Vs Total IGHV IGLV IGKV TRAV TRBV TRGV TRDV
Apodemus speciosus BDUI00000000.1 (BDUI01) 97 18 7 37 19 8 3 5
Vgene Table
Organism Vgene Locus contig Contig Pos. AA sequence
Apodemus speciosus V70 ighv BDUI01003515.1 2757 VQSQVQLQQSGAELVKPGASVKISCKASGYTFTSYNIHWVKLRPGKGLEWIGGISPGSGSSAYSEKFKDKATLTADKASSTAYMQLSSLISEDSADYYCAR
Apodemus speciosus V71 ighv BDUI01003515.1 38819 VQSHIQLLQSGAELVRPGTSWKLSCKASAYTFSSYWMQWIKQRRGQSLEWIGEIYPGSGKTYYNEKFKGKATLTADTSSRTAYMQLSSLTSEDIAVYYCA
Apodemus speciosus V79 igkv BDUI01004333.1 16017 AQCDVQITQSPSYLAASTGESVSITCRASKSISKYLAWYQQKPGKVIKLLIYSGSTLQSGTPSRFSGSGSGTDFTLTIRSLEPEDFATYYCKQHYEL
Apodemus speciosus V80 igkv BDUI01004333.1 43518 SRCDIQMTQSPSSLSASLGDRVTISCRASENINKYLAWYQKKSDGIVKPLIYHTSTLQSGIPSRFSGSGSGTDYSLTISGLEPEDAATYYCQQGYSS
Apodemus speciosus V122 ighv BDUI01012194.1 42175 VNTEVQLQQSGLELVRPGASVKLSCKASGYTFTSEYMHWVKQNLGQGLEWIGRIDPEDGNTKYAQKFQGKATLTADTSSNTAYMQLSSLTSEDTAIYYCT
Apodemus speciosus V126 igkv BDUI01013075.1 16328 TCGDIVMTQSLSSLAVSAGDKVTMSCKSSQNLFWSVNQKNLLAWYQQKPGKSPKLLIYWASTRASGVPVRFTGSGSGTDFTLTISSVQAEDLAVYYCQQYYSYP
Apodemus speciosus V136 igkv BDUI01015545.1 15934 TKGDVVMTQTPLYLSVTIQQPASISCKSSQSLLYSAGKTYLHWVLQRPGQSPKHIIYLMFKVGPGVPDRFSGSGSETDFTLKISRVEPEDLGVYYCWQGTYI
Apodemus speciosus V138 igkv BDUI01016284.1 22115 ARCDIQITQSPASLSASVGESVTITCQASGNIYNNLAWYQQKPGKSPQLLIYNANRLADGVPSRFSGSGSGTQYSLNINSLQPDDVASYYCQHYYGYP
Apodemus speciosus V141 ighv BDUI01017387.1 26497 VWSQVQLKESGPGLVKPSQTLSITCTVSGFSLTDYGVHWVRQPPGKRLEWMGAIWSGGGTDYNSALKSRLSITRDTSKSQVFLKLNSLQTDDTAMYYCAK
Apodemus speciosus V142 ighv BDUI01017411.1 49412 VHSEVQLQQSGAELVKPGASVKLSCKASCYTFTSYYMSWVKQRPGQGLELIGWVYPGNGNAYSNEKFNGKAPLTADKSSSTAYMQLNSLTSEDSADYYCA
Apodemus speciosus V147 trbv BDUI01018120.1 8555 LVDMKVTQMPRYLIKGMGDNVLLECIQDMDHERMYWYRQDPDLGLQLIYISYDVDSNSEGDIPEGYRVSRKKREHFSLILESAKTNQTSLYFCASSL
Apodemus speciosus V151 iglv BDUI01019242.1 28869 SVTNYELIQPPTASVTLGQTVTITCSGDELPKKYAYWYQQKPGQTIMPVTYKDSERPSGISDRFSGSSSGKTDMLKISNAQAEDEADYYCSSVYSDADL
Apodemus speciosus V156 igkv BDUI01022313.1 7284 ARCDIQVTQSPSSMSASLGDRVSLTCRTSQGISNALNWYQQKPGESPKLLIYAATNRGDGVPSRFSGSGSGSDYSLTISSLEAEDMAIYHCQHSYQYP
Apodemus speciosus V161 igkv BDUI01025325.1 32748 MRCDTQMSQSPTILYASIGERVIINCHASENINAWLSWHQQKPGNAPQLLIYKASNLHTGVPSRFSGSGSGAGYSLIISSLQPEDIATYYCVQANSLP
Apodemus speciosus V163 igkv BDUI01026143.1 25781 SRGDVVMTQTPLSLPVSLGDQASISCRSSQSLLHTNGNTYLYWFLQKPGKPPQPLIYSISNRYSGVPDRFTGSGSEKDFTLKISRVEPEDLGVYYCFQA
Apodemus speciosus V169 trav BDUI01031735.1 8622 SWSLAKPTQPLAMDSYEGQEVNVSCSHTDIATSESIYWYRQIPHQGPQFIIQGYKDYAANEVASLFISADRKLSTLSLPWVSLRDSAVYYCIVA
Apodemus speciosus V170 trav BDUI01033575.1 279 GVRGMQVEQNPPALSLHEGAGSGLRCNFSTTMKSVQWFQQNHRGSFINLFYLAPGTKEIGRLKTTFNPKERHSTLHIRDAQLEDSGIYFCAAE
Apodemus speciosus V177 igkv BDUI01036373.1 1290 VDGNTVMTQSHKILSTSVGDRVIINCKASQNVGTAVAWYQQNLEQSTKLLICSGSTCFTGVSDRFTGSGSGMDFTLTISSVQAEDLAVYYCQQYYSSP
Apodemus speciosus V178 igkv BDUI01039089.1 22096 SICDIQMTQSPSSLSASLGDRVTISCRASENINKYLAWYQKKPDGIVKLLIYHTSTLQSGVPSRFSGSVSGTDYSLIISGLEPEDIATYYCQQGYNP
Apodemus speciosus V182 trav BDUI01041547.1 21564 VNGQANTVVQRPSILDVWEKETAVINCTYTNAAFNYFSWYKKEEQKSFTLLTDIRSNVHRRKKGRFEVILDTNVKLVSLHVTAAQTEDSALYLCAL
Apodemus speciosus V187 trdv BDUI01050690.1 2821 SNVAQKVTQVQSTVSRQEGEELTLECSYETSQIIYHLFWYKQHLNGEMVFLIRQISSSTAKESSGRYSVVFQKPFNFISLVISALQPEDSGKYFCALWEV
Apodemus speciosus V190 igkv BDUI01053020.1 19696 TYGDIVMTQSPASLAVSAGKKVSMSCKSSQSLLYSVNQKNYLAWYQQKPGQSPKLLIYWASDQYTGVPDRFTGRGSGTDFTLTISSVQAEDLAVYYCQQYYDTP
Apodemus speciosus V193 igkv BDUI01054597.1 8488 CRGNIMLTQSPAILPVTPGEKVTLSCKASQSIGTSLHWYQKKTNESPRLLIKYASQSISGIPSRFSGSGSGTEFTLSINSVEPDDISSYYCQQSNSWP
Apodemus speciosus V209 igkv BDUI01077232.1 817 VDGDIVMTQSQKSLSTSVGESITMNCKASQNVNSYVNWYQQKPGQSPKLLIYGASSRFTGVPDRLTGSGYGTDFTLTISSVQAEDLAVYYCQQDKSYP
Apodemus speciosus V210 igkv BDUI01077793.1 758 AHGSIVMTQSPESLPTSVGDRVTMTCKASQNVGTAVAWYQQKQGQSPKLLIYYASNRYTGVPDRFTGSGSGTDFTLTISSVQAEDQAVYYCQQHNNY
Apodemus speciosus V214 trbv BDUI01085155.1 1676 VHAQTIHQWPAAKVQALGSPLSLECTLKGKSNPNLYWYWQATGGTLQQLFYSINVGQVESVLSRNLSASRPKDGQFILSTEKLLLSHSGFYLCAWS
Apodemus speciosus V221 igkv BDUI01091888.1 2040 SNGDIVLTQSPASLAASLGQKATMSCRASQSVSTSSNSYMYWYQQKPGQSPKRLIYLASNLASGVPARFSGSGSGTDFTLTINPVEAEDAATYYCLQSKKLP
Apodemus speciosus V230 ighv BDUI01104821.1 1642 ILSQVKLQESGPSLVNPSQALSLTCSVTGYSITSGYDWIWIRQFPGNKMEWMGYINSAGGTGYNPSLKSRIAITRDSSQNQFFLQLNSVTTEDTATYYCAR
Apodemus speciosus V236 ighv BDUI01116155.1 705 VQSQVQLQQSGAELVRPGASVKLSCKASGYTFTSYWVQWVKQRPAYGFEWIGTIYPGTGATGYNQKFKGKATLTADTSSSTAYMQLSSLTSEDSAVYYCA
Apodemus speciosus V241 igkv BDUI01128336.1 302 SICDIQMTQSPSSLSASLGDRVTISCRASENINKYLAWYQKKPDGIVKLLIYHTSTLQSGVPSRFSGSVSGTDYSLIISGLEPEDIATYYCQQGYNP
Apodemus speciosus V250 ighv BDUI01151226.1 291 VHSQVLLQQSGAELVRPGASVKMSCKASGYTFASYNILWVKQRTGQGLELIGAIYPGNGDTSYNQKFKGKATLTADTSSSTAYMQLSSLTSEDSAVYYCT
Apodemus speciosus V255 trav BDUI01168909.1 603 GVRGDQVEQSPSALSLHEGTNSALRCKFSFATTAVQWFLQNPRGSIINLFYMAPGTKENGRLKSTFNSKERHSTLHIRDVQLEDSGTYLCAAE
Apodemus speciosus V256 ighv BDUI01171031.1 766 VWSQLQLKESGPGLVQPSQILSITCTVSGISLTNNDVQWVRQSPGKGLEWMGGIWNHGGTDYNSALKSRLSITRDTSKSQVFLKLNSLQTEDTAMYYCAK
Apodemus speciosus V259 ighv BDUI01178109.1 525 AMSQVQLKESGPDLVQPSQTLSLTCTISGFLLSSYGVHWFRKPPRKGLEWLGGVWPGGSTYYNSLFSSRLSISWDTYKSQVFFKMSSLQSEDTAMYFCAR
Apodemus speciosus V261 ighv BDUI01185081.1 27 VHCDVQLQQSGAELVRPGASVKMSCKASGYTFTSYWVNWVKQRPEYGLEWIGGIYPGNGNTDYNEKFKGKATLTADTSSSTVYMQLSSLTSEDSAVYYCA
Apodemus speciosus V262 trav BDUI01191533.1 368 VKGQQVQQSPVSLVLQEEEKAELQCNFSTTLRSMQWFYQCPGGSLISLFYNPSGTKQRGRLTSITVVSEHSSSLHISSSQTTDSGTYLCAMDPQRS
Apodemus speciosus V269 trgv BDUI01207289.1 160 GDSRISQDQLSFTRRPNKTVHISCKLSGVSFQNTIVHWYKLKEGEPLKRIFYGSAKTYKQDKPHSRLEIDEKDDGTFYLIINNVVTSDEATYYCACWD
Apodemus speciosus V273 igkv BDUI01215386.1 1223 ISCDIQMTQSPLLLSASLGDQLIINCRASKDIKKYFAWVQQKPGKAPRMLIHFASILLPGVPEKFSGSGSGKDFSLTIRNLESEDFAVYYCLQYS
Apodemus speciosus V274 trgv BDUI01216467.1 927 GDSRISQDQLSFTRRPNKTVHISCKLSGVSFQNTIVHWYKLKEGEPLKRIFYGSAKTYKQDKPHSRLEIDEKDDGTFYLIINNVVTSDEATYYCACWD
Apodemus speciosus V280 trav BDUI01269600.1 26 EAQAQSVTQPDAHVTVSEEASLQLKCKYSYTGTPYLFWYVQYPRQGLQLLLKYYSGDSVVQGMNGFKATFNKSDSSFNLQKASVHWHDTAMYFCAVS
Apodemus speciosus V286 ighv BDUI01292704.1 464 VQSQVQLQQSGPELVRPGSSVKMSCKASGYTFTSYWMSWVKQRPGQGLEWIGNIYPGNGGTNINQKFKGKATLTADKSSSTAYMQLSSLASEDSAVYYCA
Apodemus speciosus V291 trav BDUI01309814.1 850 VKGQQVQQSPVSLVLEEGEKAELQCNFSTTLKSMQWFYQRPGGSLISLFYNPSGTKQRGRLTSITVVSERSSSLYISSSQTTDSGTYLCAMDPQRS
Apodemus speciosus V292 igkv BDUI01333989.1 257 SRGDVVMNQTPISLPVSLGNQASMSCRSSQSLVHNDGNTLLSWYLQKPGQPPQLLIYEVSTRFSGVPDRFSGSGSGTDFTLKISRIEPEDLGVYYCFQDTYLP
Apodemus speciosus V313 iglv BDUI01000141.1 293873 AISQAVVTQESSLTTSPGGTVILTCHSSTGAVTTSNYANWVQEKPDHLFTGIIGGTNYRAPGVPDRFSGSLIGDKAALTITGAQAEDEAMYFCALWY
Apodemus speciosus V314 iglv BDUI01000141.1 225139 AMSQTVVTQESSLTASPEETVTLTCGSSAGPVTTYNYAKWIQEKPLHVYSSLISDASNRVPGVPARFSGSLLKDKAALTIRGAQTEDEAVYYCALWYSNH
Apodemus speciosus V315 iglv BDUI01000141.1 64696 SVTNYELIQPPTASVTLGKTVTITCSGDELPKKYAYWYQQKPDQTIMQVIYKDSERPSGISDRFSGSSSGTTATLKISEAQADDEADYYCLSSYSDADL
Apodemus speciosus V316 iglv BDUI01000141.1 18976 SMASYILTQPPSVTVALGQKASIVCSGDKLSDKYVHWYQQKEGQAPLLVIYEDSKRPSGISDRFSGSNSGNKATLTISTAQAEEEADYYCQCWY
Apodemus speciosus V335 igkv BDUI01000669.1 229660 TSGDVVMTQTPLFLSVAIGQPASISCKSSQSLLHSNGNTYLHWLLQRPGHSPKLLIYLVSKLDSGIPDRFSGSGSDADFTLKISRVESEDLGVYYCWQA
Apodemus speciosus V351 igkv BDUI01001788.1 63504 VSGNIVIIQDELSNPVTAGESASISCRSSKNLLHTNGKTYLNWFLQRPGQSPQLLIEMMSNRISGVSDRFSVSGSGTDFSLKISRVEAEDVGVYYCQQVLEYP
Apodemus speciosus V360 trgv BDUI01003308.1 87492 GHGKLEQPEISITRAKDETAQISCKVFVESFKSVTIHWYRQKPNKGLEFLLYVLATPNHISIEKNKKMEASKNPSASTSTLTIYSLEEEDEAIYYCSYG
Apodemus speciosus V377 igkv BDUI01004766.1 105269 TSGDVVMTQTPLSLSVAIGQPASISCKSSQSLLHSNGNTYLNWLLQRPGQSPTLLIYQVSKQDTGVPDRFSGSGSDTDFTLKISRVESEDLGVYYCWQA
Apodemus speciosus V378 igkv BDUI01004766.1 70785 TSGDVVMTQTPLSLSVTIGQPASISCKSSQSLLYSDGKTYLNWLLQRPGQSPKRLIYQVSKLDTGVPDRFRGSGSETDFTLKISRVEPEDLGVYYCLQA
Apodemus speciosus V384 trbv BDUI01005755.1 88768 HMEAVVNQSPRNKLTVTGEKVTLSCHQTNNHNNMYWYRQDMGHGLRLIHYSYGANSTETGDVPDGFKASRPSREDFSLILESASLSQTSVYFCASSD
Apodemus speciosus V385 trbv BDUI01005755.1 81595 HMEAAVTQSPRNKLTVTGEKVTLSCHQTNNHDNMYWYRQDMGHGLRLIHYSYGANSTEKGDVPDGFKASRPSREDFSLILESASLSQTAVYFCASSD
Apodemus speciosus V386 trbv BDUI01005755.1 67158 HIDAGVTQSPSYEVIKNGQTATLKCEPISGHNDLFWYRQIKIRGLELLSYFRSKSLMEDGGAFKDRFKAEMPNSSFSTLKIQPTEPQDSAVYLCASSL
Apodemus speciosus V387 trbv BDUI01005755.1 42881 FVDMMVMQNPRYKVARVGKPVNLICSQTMNHDSMYWYQHKPKQAPKLLLYYYDENLNKEADTAENFQSRRLNTSFCSLDIGSAGLGDSAVYLCASSR
Apodemus speciosus V393 trdv BDUI01006323.1 84537 CNVAQTVTQIQSTASRQEEGEEVTLDCSYETSNFIYHLFWYKQLLSGEMVFLIQQTSFDSENKRSDHYSVVFQKSFKSISLVISALQQEDSGKYFCALREL
Apodemus speciosus V394 trav BDUI01006323.1 52596 GVRGDEVKQSPSVLSLHEGTSSALRCNFSTTMRSVQWFRQNPSGSLVSLLYLASGTKENVRLKSTFDSKERYSTLHIRDAQLEDSGVYLCAAE
Apodemus speciosus V395 trav BDUI01006323.1 39936 MSQGEQVEQLPSVLRVEEGSSAIINCTYEDSASLYFPWYKQEPGKYPKLIIDIRSNMERKQTQRLVLVLNKRAKHFSLHITDTQLGDSALYFCAAS
Apodemus speciosus V396 trav BDUI01006323.1 30209 VSSQQKVQQSLESLTVPEGTTASLNCTFSDSASQSFWWYQQHPGKGPKALVSTFSDGNKEEGRLTVYLKRASLHVSLHIRDSQPGDSAVYLCAVS
Apodemus speciosus V397 trdv BDUI01006323.1 897 SSLAQKATQVQSAINKQEGEEVTLDCSYETSKSFYQLSWYKQLPRGDMIFLIRQISSARHNERSGRYSVVFRKSAQSISLIIADSRVEDSMNYFCALGEA
Apodemus speciosus V423 iglv BDUI01009112.1 29397 SMASYILTQPPSVSVTLGQKASIVCSGDKLSDKYVHWYQQKEGKTPVLVIYKDSERPSGISDRFSGSNSGNKATLTISQTQAEEEADYYCQSWDSSDR
Apodemus speciosus V429 iglv BDUI01010736.1 57598 SVTNYELIQPPTASVTLGKTVTITCSGDELPKKYASWYQQKPDQTIMQVIYKDSERPSGISDRFSGSSSGTTAMLKISEAQAEDEADYYCLSAYSDANL
Apodemus speciosus V432 ighv BDUI01011155.1 52454 VQCEVHLKESGGGLAQPEGSMKLSCAASGFTFSDAWMNWVRQSPTKGLEWVAEIRNKVNNYATYYADSVKGRFTISRDDSKSNVYLQMNSLTSEDTGVYYCT
Apodemus speciosus V453 igkv BDUI01018355.1 25087 TSGDIVMTQSPTSLAVSAGEKVTMSCKSSQSVLYSANKKNYLAWYQQKPGQSPKLMFYWASTQNTGVPDRFIASGSGTDFTLTISSVQAEDLAVYYCQQYYSDS
Apodemus speciosus V454 igkv BDUI01018355.1 14430 TFGDIVMSQSPSALAVSAGEKVTMSCKSSQSLFGSGRRKDYLAWYQQKSGQSPKLLFYWASTQHTGVPDQFTASGSGTDSALTISSVQAEDLTVYYCQQYFNEP
Apodemus speciosus V462 trav BDUI01021440.1 21329 RTRGNSVTQKQGQVTLSEEEFLFINCTYSTTGYPTLFWYVQYPGEGPQLLLKVTTANNKGSSRGFEATYDKGTTSFHLQKASVQESDSAVYYCVMD
Apodemus speciosus V463 igkv BDUI01021613.1 36902 VRCDIQMTQSPASLSASVGETVTITCQASEDIYYGLNWYQQKQGKSPQLLIYSATRLEDGVPSRFSGSGSGTQYSLKINSLQPDDAASYFCQQGYS
Apodemus speciosus V465 ighv BDUI01021762.1 21753 IQCEVKLVESGGGLVQPGSSLRLSCSASGFTFTDFYMSWLRQPPGKSPEWLGFIRNKANGYTTEYSASVKGRFTISRDNSQNILYLQMNTLRAEDTATYYCA
Apodemus speciosus V469 trav BDUI01024720.1 3318 VQTQTVSQSDAHVTVFEGDPVELRCKYSYGGSLYLIWYIQHHGHGLQVLLKYYSGNPVVRGANGFEAEFSKSNSSFHLRKASVHRSDSAVYFCAL
Apodemus speciosus V470 ighv BDUI01024723.1 10942 VLSQVTLKESGPGILQPSQTLSLTCSFSGFSLSTTGMAVNWIRQPSGKGLEWLSIIYWDDDKRYNPSLKSRLTISKDTSNNQVFLKLASVDTSDTATYYCARR
Apodemus speciosus V471 trav BDUI01024847.1 9079 MRKTHGDSVTQKEDQVTLSEDDFLFINCTYSTTTYPTLFWYVQYPGQGPQLLLQVTTANNKGSSRGFEATYDKGTTSFHLQKASVQESDSAVYYCGLR
Apodemus speciosus V472 trav BDUI01024847.1 8215 MRKTHGDSVTQKEDQVTLSEDDFLFINCTYSTTTYPTLFWYVQYPGQGPQLLLQVTTANNKGSSRGFEATYDKGTTSFHLQKASVQESDSAVYYCGLR
Apodemus speciosus V476 igkv BDUI01026143.1 6848 VRCDIQMTQSPSTLSAALGVSVTITCHASQNINSWLSWYQQKPGNFPKLLIYEASKLQTGIPSRFSGSGSGREFTLTISSLQPEDITYYYCLQYQSLP
Apodemus speciosus V480 igkv BDUI01029189.1 9709 AQCDVQITQSPSYLAASPGESVSITCRASKSISKYLAWYQQKPGKTIKLLIYSGSSLQSGIPSRFSGSGSGTDFTLTISSLEPEDFATYHCQQHNEY
Apodemus speciosus V490 trdv BDUI01035126.1 23050 TSLDVILEPVAKTFTVVAGNPATFYCTVTGGDLKNYQMSWYKKSGNNALFLVYKLNNNSTDDIMGNFKGKINISKNQFILDIQKATMKDAGTYYCGSD
Apodemus speciosus V501 igkv BDUI01050826.1 11203 ACVDIVMTQTALSTSVTSGVSASISYRCSKKLLKNNGRNYLNWYQQRPSRSLQPWIYEVSNHASGVPDRFSGSGSGTDFTLKISKVEVEDIGVYYCQHF
Apodemus speciosus V514 igkv BDUI01060738.1 7963 SSSDVVMTQTPLSLPVSIGDQASMSCRSSQSILHSSGNTYLKWYLQKPGQAPQLLIYEISNRFSGVPDRFSGSGSGTDFTLKISRVEPEDLGVYYCLQA
Apodemus speciosus V520 trav BDUI01071110.1 8510 SNMAQKLTQVQSTASRQEGEELILDCSYETSEITYHLFWYRQHLNGEIVFLTRQISSSTAKEINGRYFVVFHKSIKSISLVISALQPEDSGKYFCALWEV
Apodemus speciosus V529 igkv BDUI01097233.1 2196 TSGDIVMNQSPNSLAVSAGEKVTMSCKSSQSLLNSANKKNYLAWYQQKPGQSPKLLFYWASTQNTGVPDRVTASGSGTDFTLTISRVQAEDLAVYYCQQYFSNP
Apodemus speciosus V540 ighv BDUI01115066.1 1667 IPSQVYLQQSGSELRNPGSSVKLSCKDFDSDVFPIAYMSWVRQKPVHGFEWIGAILPNIGRTIYSEKYEDRATLDADTISNTAYLELSSLTSEDSAIYYCA
Apodemus speciosus V545 igkv BDUI01123232.1 1762 SNGDIVLTQSPASLAAPLGQRATISCRASKSVNFFGATHLMNWYQQKPGQPPKLLIYRASNLESGVPARFSGSGSGTDFTLSINPVEADDAATYYCQQSKELP
Apodemus speciosus V547 igkv BDUI01134331.1 402 VDGDIVMTQSHKSISTSVGESITMNCKASQNVYNNINWYQQKQGQSPKLLIYWASNRYTGVPDRFTGSGSGTDFTLTISSVQAEDLALYYCLQHSSYP
Apodemus speciosus V548 trav BDUI01139410.1 832 RAQGDSVTQTEGQVTLSEKDFLTIHCNYSASGYPALLWYVQYPGEGPQLLFRVSRDKEKGSSRGFEATYDKGTTSFHLRKASVRESDSAVYYCAVG
Apodemus speciosus V551 trbv BDUI01145771.1 312 PVDPKIIQKPKYLVAGTGSERILICEQHLGHNAMYWYRQSAKKSLEFMFSYSYQKLLDNQTVPSRFQPHNSKNNYLDLQITALKPDDAATYFCASSQ
Apodemus speciosus V554 trav BDUI01149555.1 1557 LAGQTQVEQSPQSLVVRQGENCCLQCSYTVIPFNNLRWYKQDTGRGPVSLTVLTNKEDKTSNGRYSASLDEDAKRSTLNITASLLDDTATYLCVVG
Apodemus speciosus V562 igkv BDUI01186584.1 1625 SNGDIVLTQSPASLAASLGQRATISCKASQSVTNYGISFIHWYQQKPGQTPKLLIYSASNLESGVPARFSGSGSETHFTLTINPVEAEDAATYYCQQGMEDP
Apodemus speciosus V563 trdv BDUI01186600.1 1212 KDVLCITLTQSSPDQTVASGSEVTLLCTYKGESPNPDLFWYRKRPEGSFQFVLYRDDTRSHDADFVQGRFSVKHSKASRTFHLVISPVRLEDSATYYCASG
Apodemus speciosus V564 trbv BDUI01190178.1 701 SANSEVVQSPRHIIKEKGGRSIVKCIPISGHSNVAWYQQTQGQELKFLIQHYEKMETDKGNLPSRFSVQQFNDYHSEMDMSALELEDSAVYFCASS
Apodemus speciosus V566 ighv BDUI01207635.1 923 FLSQVQLKESGPGLVQPSQNLTQSITCTVCGFSLTNYGVHWVPQPLGKGMEWMGAIWSYGGTDYNSALKSRLSISRDTSKSHVFLKLNSLQTDDTAMYYCA
Apodemus speciosus V567 ighv BDUI01217959.1 1282 VESQVQLQQSGAELVRPGASVKISCKASGYTFTSSEMHWVKQRPGQGLEWIGRIDPEDGGTGYNEKFKGKATLIADTSSSTAYMQLSSLTSEDSAVYYCV
Apodemus speciosus V569 igkv BDUI01233952.1 1242 STGDIVMTQSPASLAVSLGQKATISCRASKSVSASSYSYMHWYQQKPGQPPKLLIYEASNLESGVPDRFSGSGSGTDFTLTINPMEAEDTATYYCQQSKELP
Apodemus speciosus V571 igkv BDUI01244928.1 424 SNGDIVLTQSPASLAVSLGQRATISCKASESVSLYGIIHNMHWYQHKPGQPPKLLIYGASNLESGVPARFSGSGSETDFTLTINPVEADDAATYYCQQSKELP
Apodemus speciosus V572 trav BDUI01247724.1 943 KTHGDSVTQKQGQVTLSEDDFLFINCTYSATGYPTLFWYVQYPGEGPQFLLKVTTANNKGSSRGFEATYDKRSTSFHLQKASVQESDSAVYYCALS
Apodemus speciosus V574 igkv BDUI01248502.1 1487 ISCDIQMTQSPLLLSASLGDQLIINCRASKDIKKYFAWVQQKPGKAPRMLIHFASILLPGVPEKFSGSGSGKDFSLTIRNLESEDFAVYYCLQYS
Apodemus speciosus V579 igkv BDUI01282499.1 476 CRGDIMLTQSPAILSVTPGDKVTLSCKASQSIGTYLHWYQKKTNESPRLLIKYASQSISGIPSRFSGSGSGTEFTLSINSVELDDSSSYYCQQSYSWP
Apodemus speciosus V583 trav BDUI01305908.1 999 KSHGEKVKQHHSALSVREGDSAVINCTYTDTAFSYFPWYKQEAGKGLHFVIDMHSNVDRKQNQRLTVFLEEKAKQFSLHITATQPEDSATYFCAA