WGS Statistics
Organism WGS Record. Vs Total IGHV IGLV IGKV TRAV TRBV TRGV TRDV
Cervus elaphus hippelaphus MKHE00000000.1 (MKHE01) 45 3 2 3 11 16 6 4
Vgene Table
Organism Vgene Locus contig Contig Pos. AA sequence
Cervus elaphus hippelaphus V161 ighv MKHE01000013.1 89757309 VLSQVQLQESGPSLVKPSQTLSLTCTVSGFSLTGYGIHWVRQVPAKALEWVGGICSGGSTYYNPALKSRLSITRDTSKSQVSLSLSSVTPEDTAVYYCGR
Cervus elaphus hippelaphus V204 trgv MKHE01000018.1 104031467 GHGLSKVEQAQISLSTEVKKSINIHCKIESTDFGLVAIHWYRIKLNQVLEHLVYVISTTTAARNQVDGKNKIEARKDAQTFTSTLTVNFVEKKDVGIYYCACWG
Cervus elaphus hippelaphus V205 trgv MKHE01000018.1 104040013 GLGQLTLEQPEVSVTGTREKSVIMSCKVFSKDFSKDYIHWYRQKPDQGLEQLLYVLTTPALSHSGGTKNKLEAKKDVSSSTSTLRISFLQKEDEAMYYCAGWVS
Cervus elaphus hippelaphus V206 trgv MKHE01000018.1 104119134 HVEQPQISSTRKLSKTAHLECMVSGVTISTTSVYWYQERPGQAIQHLLHIFSNNTVKRESGILLSKFEAHMTPETSTSTLTVHNVREQDSATYYCALWD
Cervus elaphus hippelaphus V207 trgv MKHE01000018.1 104140314 GLGLSKVEQAQISLSTEVKKSINIHCKIESTNFESETVYWYRQKRNQALEHLVYVTSTTTAARSQVDGKNKIEARKDARMFTSILTVNFIEKEDAGIYYCAGWS
Cervus elaphus hippelaphus V208 trgv MKHE01000018.1 104164705 TQVSSNMEEDKLSVMRATGSSVVIDCDLTHNYIHWYKFQEGAVPRRLLYYDVYNSKVVLEPGTSQGKYHVYKGTGKGYTIVISSLQESDSGTYYCAFWE
Cervus elaphus hippelaphus V209 trgv MKHE01000018.1 104181168 TRVSSNTEGEKMSITKATGSSVEIICDLITQTLKYIHWYKYQEGTAPQRLLYYDISYSKVTLESGVSEGKYKVYKEKSYTFAISNLQESDSGMYYCAAWE
Cervus elaphus hippelaphus V212 trbv MKHE01000018.1 134346710 PSGTGVFQTPKYLLTQMGTKTSLECEQKLNHDSMYWYKQDSKKLLKVMFSYNNKVLIANETVPSRFSPDSPDKAHLNLHIDSLEPGDSAVYFCASSY
Cervus elaphus hippelaphus V213 trbv MKHE01000018.1 134359844 ISADPGITQIPKYLVMGMMDKKSLKCEQHLGHDAMYWYKQSAQKPPELMFIYDYKELAENASVPSRFQPRCPESSQCLLDLNALKPQDSAVYLCASSR
Cervus elaphus hippelaphus V214 trbv MKHE01000018.1 134376023 AVHAGVTQDPRFQVVRTGQSVTLNCTQDMNHDYMYWYRQDPGHGLRLIHYSDGPPGTDKGDVPDGYSVSRPSTENFPLMLKSANRSQTSVYFCASSD
Cervus elaphus hippelaphus V215 trbv MKHE01000018.1 134390327 AVHAGVTQDPRFQVVRTGQRTTLKCTQDLGHDNMFWYRQDLGHGLRLIYYSAGVPSSKPGDVPEGYSVSRSNKENFPLTLMSAIRNQTSVYFCASSY
Cervus elaphus hippelaphus V216 trbv MKHE01000018.1 134393189 HTGAGVVSQSPRHRVTRRGQTVNLRCDPISGHISLYWYRQTLGQGPEFLAYFQNERALDKSGLPKNRFSAERPDSTYSSLKIQPAEPEDSAVYLCASSP
Cervus elaphus hippelaphus V217 trbv MKHE01000018.1 134408516 PLEAEVTQTPRHLIKRTGQTVTLRCSPMSGHSSVSWYQEAWSQGPQFIVEFYETQPRAKGNFSNRFSAKQFRDFSSELNVTSLELTDSALYLCASSL
Cervus elaphus hippelaphus V218 trbv MKHE01000018.1 134445116 YISPEVTQSPSHRVTEKKQAVNLRCDPISGHDSLFWYYHAVGKEMKLLIYFIRESVQDNPGMPKGRFTAERTEGTSSTMRVHSEELGDLGVYFCASSR
Cervus elaphus hippelaphus V219 trbv MKHE01000018.1 134458904 FLEAEVTQTPGHLVQGKGLDVEMYCVPEKGHIYVFWYQQILAKEFKFLISFQNDKVLDDKEMPKKRFLAECPSDSPCSLKIQATEPQDSAMYFCASSD
Cervus elaphus hippelaphus V220 trbv MKHE01000018.1 134478605 SGLGALVSQQPRRAVRKSGDSVTIQCRAVDFQATSVFWYRQLPKQGLVLMATSNVGTDATYEQGYNKDKLPISQPNLTFSSLKVTSVDPADSSLYFCGAR
Cervus elaphus hippelaphus V221 trbv MKHE01000018.1 134504813 SMDTEVTQSPSGLVKGKDQKAKMDCVPKKGHINVYWYRKKLEEPFEFLVYLQKQDIVKDTEVFKQRFSAECPQNSPCSLEINSTEAADSALYFCASSQ
Cervus elaphus hippelaphus V222 trbv MKHE01000018.1 134515838 FLDADVHQTPRHCVIGTGKKITLECSQTMGHDNMYWYQQDPGMELQLIHYSYGVNTTEKGERPSRSTVSRISKEHFPLTLETASSSQTSSYFCASSD
Cervus elaphus hippelaphus V223 trbv MKHE01000018.1 134517595 LKDAAVTQFPRRKILETKKEVTLQCSQKMGHYAMYWYRQDPGFGLRLIYYSTGRDTIKKGDVPEGYDVSRDELEHFPLTLKSASPNQTSVYFCASSE
Cervus elaphus hippelaphus V224 trbv MKHE01000018.1 134526705 SLEADVIQSPRYRITETKKRVTLTCSQNMNHEAMYWYRQDPGLGPRLIYFSRNIGNVQKGDIPDGYTVSREETPNFPLTLELASTSQASLYFCASSK
Cervus elaphus hippelaphus V225 trbv MKHE01000018.1 134540111 SLEADVIQSPRYRITETKKRVTLTCSQNMNHEAMYWYRQDPGLGPRLIYFSRNIGNVQKGDIPDGYTVSREETPNFPLTLELASTSQASLYFCASSK
Cervus elaphus hippelaphus V226 trbv MKHE01000018.1 134562067 LMDAQVTQTPRYLVKRRGEKVVIECMQNMDHERMFWYRQDPALGLRLLHFSINVGMVEEGDVPHGYSVSRKKKESFPLTLESATTNQTSVYLCASSE
Cervus elaphus hippelaphus V383 trav MKHE01000111.1 14206 KLGDSKTTQPNSVEGAEEGPVHLPCNHSTISGREHVYWYRQIPHQGPEYLIHGLNNNVTNRMASLSIAKDRKSSILVLPQVTMRDTAVYYCVLR
Cervus elaphus hippelaphus V386 trav MKHE01006837.1 350 TVIKLAAKTTQPSSMDCAEGEDVNLPCNHSTIGGNDYIHWYHQNPNQSPQYVIRSLQGTVNSSLASLTIASDRKSSTLVLPQVTLRDTAVYYCVLRG
Cervus elaphus hippelaphus V399 trav MKHE01000001.1 37666079 AHTQMVQVNDSMYGFIGTDVVLHCSFANPLPGVKITQVTWQKATNGSKQNVAIYNPAMGVSVLAPYRERVEFLRPSFTDGTIRLSRLELKDEGVYICEF
Cervus elaphus hippelaphus V469 iglv MKHE01000005.1 30672003 CFSSFLTQPPSVSRNLGQTVTICCAGTSSDVGHYNEVGWYQQLLGSAPKTLIYDVSKRPSGIADRFSGSKSGNTATLTISGLQTEDKAGYYCSSPGSD
Cervus elaphus hippelaphus V479 iglv MKHE01000005.1 8628 SWAQDVLTQPSSVSRSLGQRVIISCSGSSSNIGGDSVSWYQQLPGKAPRFLIYGDDTRALGVPDPISDSKSGNSASLTITLLQGEDEADYYCRSYDDSLD
Cervus elaphus hippelaphus V511 ighv MKHE01000009.1 17205153 VLSQVQLQESGPSLVKPSQTLSLTCAVSGFSLTSYAVGWVRQAPGKALEWVGGISSGGSTYYKPALKSRLSITRDTSKSQVSLSLSSVTPEDTAVYYCAK
Cervus elaphus hippelaphus V536 igkv MKHE01000011.1 77801989 SSGDIVLTQNPLSLSVIPGKMASISCRASQSLEDSYGDTYLSWHLQKPGQSPQLLIYLVSNRASGVPDRFIGSGSGTDFTLKISRVEAEDAGVYYCQQSIQEP
Cervus elaphus hippelaphus V537 igkv MKHE01000011.1 77758556 VFMLLISGARCDLQVTQSPSFLSASLGCRVSITCWASQSIDSELDWYPQKPGQDSKLLIYYATRLHTRVPSWFSGSGSGTDFTLTISSPEAEDAATYYCQQDHS
Cervus elaphus hippelaphus V538 igkv MKHE01000011.1 77736851 ASGKVVLHQTPAYIAVPIGESISITCRANQSISDYLSWYKQKPGQAPSILIYDADNQYSGVPGRFTATQSETEFVFTISEVEADDAAMYYCQQDYVL
Cervus elaphus hippelaphus V561 trav MKHE01000012.1 99115461 SAGKGVEQPTELMAMEGASAQVNCTYQTSGFSGLFWYQQHDGGAPVFLSYNVLDGLETRGHFSSFLSRFDAHSYLLLKELHMKDFASYLCAVI
Cervus elaphus hippelaphus V562 trav MKHE01000012.1 99025296 MSRGEKVEQYPSFQSVQEGDNCVINCTYTDSASTYFFWYKQEPGKGLQLLIHILSNEGKKQGQRLIVLLNKKNKHLSLNITATHPEDSATYFCATR
Cervus elaphus hippelaphus V563 trav MKHE01000012.1 98996306 GSNGDSVTQPKGQVTLLEGESLTVNCSYETKQYPALSWYVQYSGEGPQLLLRAHRDNEKGSGKGFEATYNTETTSFHLEKASVQESDSAVYYCALS
Cervus elaphus hippelaphus V564 trav MKHE01000012.1 98818810 VSSLLTVEQRPASLWVQEGESANFTCSFPSSSFYALHWYRWEPAKGLKNLFVVSVNGDEKKQGRMRVTLNTKEGDSSMYIRGSQPEDSATYLCA
Cervus elaphus hippelaphus V565 trav MKHE01000012.1 98795730 IMVDTEITQLSSMDCAEGEDVNLPCNHSTIDALDYIHWYWQNPNQSPQYVIYGLRDMVNNSKASLTIASDRKPSTLALPQVTLRDTTVYYCILRG
Cervus elaphus hippelaphus V566 trav MKHE01000012.1 98735458 LRVQMKVEQSPGVLTLQEGRNSSLICNYSTSMTSVQWFQQNPDRRLISLFYIASGTQQKERLKSTINSKEHYSQLYIRDSQPEDSATYFCAVD
Cervus elaphus hippelaphus V567 trav MKHE01000012.1 98683431 MLGDSKTTQPNSAEGAEEGPVHLPCNHSTISGREHIYWYRQIPHQGPEYLIHGLNNNVTNRMASLSIAKDRKSSILVLPQVTVRDTAVYYCVLR
Cervus elaphus hippelaphus V568 trav MKHE01000012.1 98673478 VSAQQLNQSPQSMSIQEGEDVSMNCNASSTLNLLQWYKQDAGEGLILLIKLLKGGELARNGKLTAQFGGTKKDSLLNISASEPKDAGTYFCAD
Cervus elaphus hippelaphus V569 trdv MKHE01000012.1 98569474 SNNVESANVPTVYKKEGESVTVECKFSVSYTYYMMYWYRQPSSGEMIYMVNIYSQSKHAREGRYSVEFYKPSQMLKLTISALTLSDSAIYFCAVRE
Cervus elaphus hippelaphus V570 trdv MKHE01000012.1 98493569 VSLDVILESETKTLTVLLGEPATFRCNVTGGNWKNYQMSWYKRNENNFLILVYRLSNNSNENVRGNFKGKIDTSKNQYVLNIQKATIKDVGTYYCGSD
Cervus elaphus hippelaphus V575 trdv MKHE01000012.1 56675594 SIIAQKVTQDPQPMLVQEKEAVALDCTYDTSDAGYSLFWYKQPSSGAVIFLLHLESHSKQNATEGCYSLNFQRASKSITLVISASQLEDSVVYFCALKEPSV
Cervus elaphus hippelaphus V633 trbv MKHE01000018.1 134656745 VRAQTIHQWPPTRVQPAGSPLSLECTVKGTSNPSLYWYRQEAGGSLQLLFSSFGADQIDPKEFQNFEASRPQDGQFILSSKKLQLNNSGFYLCAWS
Cervus elaphus hippelaphus V796 ighv MKHE01004851.1 1219 VLSQVQLQESGPSLVKPSQTLSLTCADSGYSITSGYGWNWIRQAPGKGLVWMGCINYDGNTYYSPSIKSRTSISRDTSKNQFSLQLSSVTTEDTAVYYCAR
Cervus elaphus hippelaphus V798 trdv MKHE01008378.1 1015 ASVAQRVTQDQPDISSQVGEVVTLSCRYETLQSSYNMFWYKQLPSGEMIYLIGQGSSSQNARDGRYSINFQRLRKSISLTISDLQLEDSAKYFCALRE