WGS Statistics
Organism WGS Record. Vs Total IGHV IGLV IGKV TRAV TRBV TRGV TRDV
Delphinapterus leucas NQVZ00000000.1 (NQVZ01) 48 10 9 3 9 12 2 3
Vgene Table
Organism Vgene Locus contig Contig Pos. AA sequence
Delphinapterus leucas V8 trbv NQVZ01001236.1 91007 VRAQTIHQWPLIRVQPAGSPLSLECTVKGTSNPSLYWYRQAAGGALQLLFYSNSIDQIDAEEPQNFEASRPKDGLFILHSKKLLPSNSGFYLCAWN
Delphinapterus leucas V320 igkv NQVZ01018398.1 39019 SSGDIVMTQTPLSLTVIPGETASISCKSSQSLVHSNGNTYLNWLQQKPGQSPQRLIYKVSNRDSGVSDRFSGSGSGTDFTLKISRVEAGDAGVYYCHQG
Delphinapterus leucas V321 igkv NQVZ01018399.1 13349 CWGQITLTQTPETLAASQGSFVSITCKSSVEVGTSMAWYQQKPKEPPRLLIFGASARASGTPSRFRGSGSGFDFSLAIHGVEAEDVGVYYCQ
Delphinapterus leucas V334 igkv NQVZ01019119.1 211157 VVLTQPCPVSGSLEQKVTISCTHSSGNIGSYSVYWYQQRPGSAPTTVIYKDDQRPSGVTNRFSGSIDTSSSAAYLTRSGLQPEDKANYYCQSGHDSNK
Delphinapterus leucas V335 iglv NQVZ01019119.1 216345 ALSQPVLTQPSSLSSYLGASARLTCTLNSGFNVGNFWIRWYQQKPGNPPRYLLTFHSDSDKHQGSGVPSRFSGSSDASTNAGILLISGLQPEDEADYYCAT
Delphinapterus leucas V336 iglv NQVZ01019120.1 11974 CLSQPVLTQPPSLSASPGASARLTCTLSSGYIVGGYHIFWYQQKPGSSPRYLLRFKSDSDKYQGSGVPSRFSGSKDASANSGLLLISALQPEDEADYYCAT
Delphinapterus leucas V337 iglv NQVZ01019120.1 15287 SWAQAVLTQPRSMSGALGQRVTISCAGSSSSIGSNYVSWYQQVPGAAPRLLIYDNSKRPSGVLDRFSGSKSGNSGSLTITGLQAGDEADYYCQSYDDSLD
Delphinapterus leucas V363 trav NQVZ01020179.1 6555 SSVAQMVTQPQPEVSVQEADTVTLDCTYSTSDSDYYLLWYKQPPSGEMIFIIGQEAYKQQNATNGRYSVNFQKEAKSFRLRISDSQLEDAAMYFCAYSG
Delphinapterus leucas V364 trav NQVZ01020179.1 10277 SSVAQMVTQPQPEVSVQEADTVTLDCTYSTSDSDYYLLWYKQPPSGEMIFIIGQEAYKQQNATNSHYSVNFQKEAKSFRLSISDSQLEDAAMYFCTYSG
Delphinapterus leucas V365 trav NQVZ01020179.1 33293 LNAEVKVEQSPPSLSIQEGEASTIYCNHSITASDRLHWYRQDLGKSLESLFLLLSNGVMKQKGQLTASLDTKARRSTLHITASQPGLSATYFCAVD
Delphinapterus leucas V366 trav NQVZ01020179.1 55974 VSGKNDVEQSPRYLSALEGDFVTINCSYSEKMTTLQWFQQNPGRDVVSLFILSLEMKKKGRVSATINRKERHSSLHITASQPRDSATYFCAVE
Delphinapterus leucas V367 trdv NQVZ01020180.1 23127 VYLDVILEPETKTLTVLGEPATFRCSITGGDLKNYQMSWYEKNENNSLTLVYRLSNNSNENERSNFKGKIDALKSQYILDIQKTTVKDVGTYYCGSD
Delphinapterus leucas V368 trdv NQVZ01020181.1 13138 VMSAVMLVPQDQARSVSVGESVTLRCSMKGESISNYYTFWYRKTPGNTMTFIYREGGTYGPGFEDNFQGEIDFLNNQAVLNILEASERDEGSYYCAS
Delphinapterus leucas V472 ighv NQVZ01027073.1 5210 APAGVWGRLGAAWGSLRLSCAASGFTFSSYAMYWVCQAPGKGLEWISGISSSGGSTYYVDSVKGRFTISRDNSKNTLYLQMNSLRSEDTAMYYCAKD
Delphinapterus leucas V473 ighv NQVZ01027073.1 8726 VLSQVHLQESGPGLVKPQQTLSLTCALSGFSITTSGYCWSWVRQPPRKGLEWMGIICYNGAIAYNPSLKSRTSISSDTSKNQYSLQLSSVITEDMATYYCAR
Delphinapterus leucas V474 ighv NQVZ01027324.1 8023 ALSQVQLQESGPSLVKPSQTLSLTCTFSGFSLTSYAAVAWVRQPPGKGLEWVGGIYGGGSAYYNPTLKSRLRITTDTSKSQVYLSLSSLTTEDTAVYYCAR
Delphinapterus leucas V476 iglv NQVZ01029199.1 238 SWAQSGLTQPPSVSGNLGQTVTISCAGTSNDIGKYNNVGWYQQLPGMAPKTLIYDVNKRPSGIPDRFSGSKSGNTASLTISGLQAEDEADYYCSSARSG
Delphinapterus leucas V477 ighv NQVZ01029204.1 1804 VLSQVQLQESGPSLVKPSQTLSLTCTVSGFSLTSDDVSWVRQPPGKGLEWVGVMGYSGSAYYNPTLKSRLSITRDTSKSQVYLSLSSLTTEDTAVYYCAR
Delphinapterus leucas V478 trav NQVZ01029343.1 263 SSIAQKVTQDQPVILVQEKEVVTLDCIYDTNDFTYSLYWYKQPSSGAMILLIRQDSYNQQNATEGRYSLNFQKANKSIKLAISASQLEDSAVYFCALSE
Delphinapterus leucas V479 trav NQVZ01029389.1 720 QTREDSVTQMDGQMTLPEGAALTINCTYSATGYPTTFWYVQYPGEGPQVLLKAMKDNEKGTNKEFEATYHKESKSFHLEKASVQDSDSAVYYCALS
Delphinapterus leucas V480 iglv NQVZ01030261.1 1938 SWAQSGLTQPPSVSGNLGQTVTISCAGTSSDIGGYNAVGWYQQLPGMAPKTLIYNVNTRPSGIPDRFSGSKSGNTASLTISGLQAEDEAVYYCSSAGGG
Delphinapterus leucas V483 trav NQVZ01031958.1 1218 GTRAQTVTQPEDHISVFEGSPVQVKCNYSYSGSPVLFWYVHYPKQQLQLLLRHTSRESIRGFTADLNKGEASFHLKKLSAQEEDSAVYYCALR
Delphinapterus leucas V496 trbv NQVZ01001237.1 65886 PMDAEIYQVRFLLAEAGRNVTLECKQNLTYNSMYWYRQDPGQGLRLIYYSMVVKDVQRGDISEGYSVSPEEKGLFPLTVKAAHTNQTGLYLCSGS
Delphinapterus leucas V497 trbv NQVZ01001237.1 60338 SMDVGITQTPRNRMANTGKSTVLECSQTKGHESMYWYRQDPGLGLRLIYYSHGVNDINEGDVSDGYRVSRKEQAKFSLFLEPATRNQTALYFCASSI
Delphinapterus leucas V498 trbv NQVZ01001237.1 51664 LKDAVVTQFPRHKVSKTGKELTLQCSQKQSHYSMYWYRQDPGFGLRLIYYSTNTNTTEKGDVPEGYRVSRNEFEYFPLTLKSASTNQTSVYFCASSE
Delphinapterus leucas V499 trbv NQVZ01001237.1 42991 ALEADVTQSPRHQITETGKRVTLTCSQNMQHNAMYWYRQDPGLGLKLIYFSTNVELLEKGDVPDGYIVSREKKPDFPLTLASASTNQTSLYLCASSL
Delphinapterus leucas V500 trbv NQVZ01001238.1 80095 ASADTKITQIPKYLIMETRNKKSLRCEQHLGHNSMYWYKQRAQKPPELMFVYNYKELASNETVPSRFWPECPDSSHIYLHVDTLKLEDSALYLCASSK
Delphinapterus leucas V501 trbv NQVZ01001238.1 60450 PGNAGVTQDPKFRVLRTGQSTTLKCAQDLDHNYMYWYRQDLGHGLRLIHYSTATGTTNKGDVPNGYSVSRSNLENFPLTLVAATHSQTSVYLCASSY
Delphinapterus leucas V502 trbv NQVZ01001238.1 55946 GPMDAAVTQKPRYHIIRAGNKMVLDCSQHMNHLGMFWYRQDLGQGPRLIHYSNGVGSTGEGDVTEGYSVSRNKNEHFPLTLEPASTKQTSLYLCASSE
Delphinapterus leucas V503 trbv NQVZ01001238.1 37665 LSITGPVEARITQKPRHKITVTGETVTLQCHQTDKHDYMYWYRQDLGHGLRLIHYSSGVGNIEKGEIPDGYNVSRSNTEDFPLTLESVIPSRTSVYFCASSD
Delphinapterus leucas V504 trbv NQVZ01001238.1 23732 PTDAGVIQTPRHEVTEMGHAVTLSCEPISGHTALYWYRQTLVQGLEFLIYFINQAPTDESGMPKDRFSAKMPNASFSTLKIQPTEPGDSATYLCASSK
Delphinapterus leucas V505 trbv NQVZ01001238.1 16571 TVDGRVTQTPKYLFKVEGRDVTLKCEQEFGYDAMYWYRQDPGQGLRLIYYSQVVKDVQKGDIAEGYSASREKKSLFPLTLTSTQKNQTALYLCATNI
Delphinapterus leucas V506 trbv NQVZ01001238.1 10929 GSGLSALVSQHPSRAICKSGASVTIQCRSGTLQATTAYWYHQFPKQGLVLIATSNEGSDATYEQGYTKAKYPVSHPNLTFTSLMVTNVHPADSSLYFCGVR
Delphinapterus leucas V747 trgv NQVZ01015814.1 296550 HLEQPQLSSTKKLSKTARLECVVSGVTISKVSVYWYQDRPGEAMQHLLHILSNNTVRRESDVTLGKFEADKKPETSTSTLTIHNVQEQDAATYYCALWE
Delphinapterus leucas V748 trgv NQVZ01015814.1 283032 GLGQLKLEQPEISVTGVRDKSVLISCKVSSGDFSNEYIHWYRHKPNQGIEHLAYVVTAPALKDLGGKKNKIEARKDAPTSTSTLKIRFLAKEDEATYYCAWWFY
Delphinapterus leucas V814 iglv NQVZ01019268.1 28176 SVASYELTQPPLVSVALGQTSKITCSGDLLDKKYTSWYQQKPGQAPVLVIYKDSNLASGIPDRFSGSSSGKIATLTISRAQAEDEADYYCRSADSSDY
Delphinapterus leucas V815 iglv NQVZ01019268.1 20764 SVASSELTQPPAVSVSLGQTARITCQGDNLGDSYVQWYQQKPGQAPVLVIYDGSDLASGIPDRFSGSSSGKIATLTISRAQAEDEADYYCGSADSSSY
Delphinapterus leucas V897 trav NQVZ01023112.1 74308 AHTQVVQVNDSMYGFIGTDVVLHCSFANPLPGVKITQVTWQKATNGSKQNVAIYNPAMGVSVLAPYRERVEFLRPSFTDGTIRLSRLELEDEGVYICEF
Delphinapterus leucas V949 ighv NQVZ01026841.1 21369 VLSQVQLQESGPSLVKPSQTLSLTCTVSGFSLTSYAVAWVRQPPGKGLEWVGGICGGGGAYYNPTLKSRLRITTDTSKSQVYLSLSSLTTEDTAVYYCAR
Delphinapterus leucas V950 ighv NQVZ01027075.1 2797 ALSQVQLQESGPSLVKPSQTLSLTCTVSGFSLTSYGVAWVRQPPGKGLEWVGNMWNDGDTYYNPTLKSQLSITRDTSKSQVYLSLSSQRTEDTAVYYCAR
Delphinapterus leucas V952 trav NQVZ01027958.1 3662 VSLGEKMEQSPSTLTVQEGNSSVITCTYTDSALDYFLWYKKEPGKGPQLLIDIRSNKSKREHQRWSVLLNDKAKRLSLHISDTQPGDSAVYFCAAS
Delphinapterus leucas V956 ighv NQVZ01029260.1 1677 VLSQVQLQESGPSLVKPSQTLSLTCTVSGFSLTSSYVAWVRQPPGKGLEWVGMIHGGGSAYYNPTLKSRLRITTDTSKSQVYLSLSSLTTEDTAVYYCAR
Delphinapterus leucas V957 iglv NQVZ01029291.1 368 SWAQSGLTQPPSVSGNPGRTVTISCAGTSSDIGGYNYVSWYQQLPGTAPKLLIYQVNKRPSGIPDRFSGSKSGNTASLTISGLQAGDEADYYCSSYTSS
Delphinapterus leucas V958 iglv NQVZ01029292.1 367 SWAQSGLTQPPSVSGNLGQTVTISCAGTSSDIGKYNAVGWYQLLPGTAPKTLIYQVNKRPSGIPDRFSGSKSGNTASLTISGLQAGDEGDYYCSSETSSGN
Delphinapterus leucas V959 ighv NQVZ01029314.1 1951 SLSQVQLQESGPSLVKPSQTLSLTCTVSGFSLTSYGVSWVRQPPGKGLEWVGGIYGGGSAYYNPTLKSRLRITTDTSKSQVYLSLSSLTTEDTAVYYCAR
Delphinapterus leucas V961 ighv NQVZ01029912.1 2052 LVQPGGSLRLSCAASGFTVSSFDMSCVRQAPGKGLEWISVISSSGGNTYYADSVKGRFTISRDNSKNTLYLQMNSLRSEDTAVYYCAKDTQ
Delphinapterus leucas V962 ighv NQVZ01030234.1 2301 ALSQVQLQESGPSLVKPSQTLSLTCTVSGFSLTSYAVSWVRQPPGKGLEWVGGINSGGSAYYNPTLKSRLSITMDTSKSQVYLSLSSLTTEDTALYYCAR
Delphinapterus leucas V963 trdv NQVZ01032798.1 658 FGAAQKVTQVQPAISSQLGEAVTLSCQYETSWSRYDIFWYKQLPSGEMTFLIYQSSSGQNAKNGRYSVNFQKRHKFISLTISALLVEDSANYFCALWE