WGS Statistics
Organism WGS Record. Vs Total IGHV IGLV IGKV TRAV TRBV TRGV TRDV
Elaphurus davidianus JRFZ00000000.1 (JRFZ01) 271 9 25 10 128 52 10 37
Vgene Table
Organism Vgene Locus contig Contig Pos. AA sequence
Elaphurus davidianus V4 trav JRFZ01002356.1 194 GTNGDSVNQTEGPVTVSEGALMTLNCTYQTAGSALYLFWYVKHLNKAPQLLLKGSMTNQRPEHEGFQATLVKRDSSFHLQKQAVQTSDSAVYYCALS
Elaphurus davidianus V5 trav JRFZ01002403.1 5159 GVRGVKVEQSPSVLKLQEGANSTLRCNFSDTVNNVQWFQQNPGGSLTTLFFITSGTKQKERLSSTVNFKDRYSTLHIAASQLEDSATYLCAVE
Elaphurus davidianus V6 trav JRFZ01002403.1 9229 VSLGNEGEQSPSTLSVQEGNTAVITCTYRDTASEYFPWYKQEPGKGPQLLVATRSNMGKKKDQRLTVLLNKTAKRLSLHIATIQPGDSAAYFCAAR
Elaphurus davidianus V7 trav JRFZ01002403.1 12963 SIIAQKVTQDQPQVLVQEKEAVILDCKYDTSESRYSLFWYKQPSSGGMILLIRQDSHNQQNATEGRYSLNFQKARKSITLVISASQLEDSAVYFCALRE
Elaphurus davidianus V12 trav JRFZ01004756.1 2642 GTSGDSVTQTEGVVTLPEKAPLTLKCTYQSSYSVALFWYVQYQNKELELLLRSSLGNQVTSRGFEATHTSSDSSFHLQKSSVQTSDSAVYYCALR
Elaphurus davidianus V13 trav JRFZ01004756.1 18045 GTSGDSVSQTEGPVTVSEGVLMTLNCTYQTTYLNSYLFWYVQHLNKAPQLLLKSLTADKKVEHEGFQATLVKRDSSFHLQKQAVQASDSAVYYCALR
Elaphurus davidianus V31 ighv JRFZ01007739.1 382 VLSQVQLQESGPSLVKPSQTLSLTCAVSGFSLTSYAVGWVRQAPGKALEWVGIIYSGGSTYYNPALKSRLSITRDTSKSQVSLSLSSVTPEDTAVYYCAR
Elaphurus davidianus V41 trav JRFZ01009012.1 1204 TVTDAKTTQPSSMDYAEGEDVNLPCNHSTIGGDDYIHWYRQNLNQSPQYVIHGLRGTVNKSLASLTIASDRKSSTLVLPQVTLRDTAVYYCVLR
Elaphurus davidianus V56 trav JRFZ01012822.1 2700 ILGDSKTTQPNSAEGAEEEPVHLPCNHSTISGREHIYWYRQIFHQGPEYLIHGLNNNVTNRMASLSIAKDRKSSTLVPPQVTMRDTAVYYCVLR
Elaphurus davidianus V62 trav JRFZ01015327.1 196 TVIDAKTTQLSSMDCAEGEDVNLPCNHSTIRVDDYIHWYRQNPSQSPQYVIHGLRGTVNNSKASLTIASDRKSSTLVLPQVTLRDTAVYYCVLRG
Elaphurus davidianus V63 trav JRFZ01015327.1 3213 VRGVDVEQSPPSLSLQEGASYTLWCNFSTSSQSVNWYLQNPGGRLIHLFYIPSGTKQEGRLKATTVPAERRSSLHISSPRTTDSGTYFCAAQHGAPQ
Elaphurus davidianus V69 igkv JRFZ01017805.1 269 SSGDVVLTQTPLTLSFTPGETVSISCKSTQSLKYSDGKTYLYWFQHKPGQSPQGLIYQVSKRYTGVPDRFTGSGSETDFTLTISSVQAEDAGVYYCFQT
Elaphurus davidianus V87 trdv JRFZ01025407.1 6383 SGVAQKVTQDQPDVSSQVGQSVTLNCRYETSWTAYYLFWYKQPPSGQMTYVIRQSSSASSARKDRYSVNFKKADKSISLTISALQLEDSAKYFCALWE
Elaphurus davidianus V88 trav JRFZ01025407.1 23433 TVINAKTTQPSSTDCAEGEDVNLPCNHSTIDGNDYIHWYWQNPNQSLQYVIHGLRGTVNNSLASLTIASDRKSSTLVLPQVTLRDTDVYYCVLRE
Elaphurus davidianus V89 trav JRFZ01025407.1 26445 VRGADVEQSPPALSLQEGASYTLRCNFSTSSRSVNWYLQNPGGRIIQLFSVPSGTKQEGRLKATTVPAERRSSLHISSPRTTDSGTYFCAAQHGAPQ
Elaphurus davidianus V94 trav JRFZ01026340.1 728 VSSPENTVEQSPASLPVPEGAVASLSCTYSDSASQYFAWYRQYPGKGPEFLLLVYANKDKEEGKFTVQATKANKHVSLLIRDSEPSDSATYLCAV
Elaphurus davidianus V99 trbv JRFZ01028486.1 705 AVHAGVTQDPRFQVVRTGQSTTLKCTRDLNHDYMYWYRQDRGHGLRLIYYSGGVPSSEPGDVPEGYSVSRSNKENFLLTLKSAFRNQTSVYFCASSY
Elaphurus davidianus V100 trbv JRFZ01028486.1 5125 AVHAGVTQYPRFQVVRTGQSTTLKCTQDLGHNYMCWYRQDPGHGLRLIHFSAVASSTVKGDVPDGYSVSRPSTEYFPLTLKSANRSQTSVYFCASSD
Elaphurus davidianus V101 trbv JRFZ01028486.1 7550 LVDAGVTQIPRYLIKARGQRVTLGCSPVSGHLSVYWYQQALGQGPRFLVQYYRQEVRGEAQLPDRFSAKQFSDSRSELNLSALELTDSAVYLCASSP
Elaphurus davidianus V102 trbv JRFZ01028486.1 20069 AVHAGVTQDPRFQVVRTGQRVTLNCTQDLGHNYMCWYRQDPGHGLRLIHYSAVAPSTVQGDVPDGYSVSRPSTEKFPLTLNSANRSQTSVYFCASSD
Elaphurus davidianus V103 trbv JRFZ01028486.1 22134 AVHAGVTQDPRFQVVRTGQSATLNCTQDMNHDNMYWYRQDPGLGLRLIHYSAATPYTAKGDVPDGYSVSRPSTENFPLTLKSANRSQTSVYFCASSD
Elaphurus davidianus V104 trdv JRFZ01029487.1 13031 SSVAQRVTQDQPDISSQAGEVVTLSCRYETLRSSYIFWYKQLPSGEMIYLISQGSSSQNARDGRYSINFQRSHKSISLTVSDLQLEDSAKYFCALWE
Elaphurus davidianus V105 trav JRFZ01029837.1 1350 GTNGDSVNQTEGPVTVSEGALMTLNCTYQATYSNFYLFWYIQRLNKAPQLLLKGLTADKKVEHEGFQATLVKMDSSFHLQKWAVQASDSAVYYCALS
Elaphurus davidianus V117 trdv JRFZ01032876.1 4596 SSMADTVTQAQTTVTAREGEAATIDCTYQTSRSRYTLYWYRQFPDGRMEYLIYQDDNKANARRDRYSVNFQRARRFISLTISSLHLADSAKYFCALWE
Elaphurus davidianus V118 trav JRFZ01032876.1 25370 VKSDHHVMQSPPSLIVHEGSNASLNCSYKVTNFQSLHWYKQEEKVPTFLFALISTGIEKSGRLRGTLDRKELLSILHITVAEPGDSATYLCAAEAWCSL
Elaphurus davidianus V119 trav JRFZ01032876.1 31488 PRRADWIRSQETEVSGAEGKTVSLFCNYHTSSTSFVSLLWYRQYPNQAPEYILYRHWGSSGKGYASFATERFYSDNTANTTNLYIKKVVPADTALYLCALE
Elaphurus davidianus V120 trav JRFZ01032876.1 60889 PSVAQTVTQPQPEESVQEAGTVTLDCAYSTSDSDYYLFWYKQPPSGEMVFIIRQYAYERQNATNDRYSVNFQKEAKAFSLRISDSQLEDAAMYFCAYSG
Elaphurus davidianus V121 trav JRFZ01032876.1 64123 PSVAQTVTQPQPEESVQEAGTVTLDCAYSTSDSDYYLFWYKQPPSGEMVFIIHQNAYERQNATNDRYSVNFQKEAKAFSLRISDSQLEDAAMYFCAYSG
Elaphurus davidianus V122 trdv JRFZ01032876.1 128905 SNNVESADVPTVYKKEGESVTVECKFSVSYTYYMMYWYRQPSSGEMIYMVNIYSQSKHAREGRYSVEFYKPNQMLKLTISALTLSDSAIYFCAVRE
Elaphurus davidianus V123 trdv JRFZ01032876.1 169887 VSLDVILESETKTLTVLLGEPATFRCNVTGGNWKNYQMSWYKRNENNVLTLVYRLSNNSNENVRGNFKGKIDTSKNQYVLNIQKATIKDVGTYYCGSD
Elaphurus davidianus V124 trdv JRFZ01032876.1 192607 VMSAVVLLPQDQEKTVPVGKSVTLSCSMKGDSISKHYIFWYRKTPGNTMTFIYREGGTYGPGFEDNFRGKIDDLTNQAMLEVLKASKRDEGFYYCASV
Elaphurus davidianus V130 trav JRFZ01035622.1 2264 VRGVDVEQSPPALSLQEGASYMLRCNFSTSPLSVNWYLQNPGGRIIQLFYIPSGTKQEGRLNATTVPAARRSSLHISSPRTTDSGTYFCAEQHGAPQ
Elaphurus davidianus V131 trav JRFZ01035844.1 1350 QTRGDSVSQMDGQVTLLQGATLTVNCTYSATGYPTLFWYVQYPGEGPELLLKATKVNDKRTNKGFEATYNAKTTSFHLEKASAQESDSAVYYCALG
Elaphurus davidianus V132 trav JRFZ01036500.1 22143 GTNGDSVNQTEGPVTVSEGALMTLNCTYQTTYSDHYLFWYVQHHNKAPQLLLKSSTADKMVEHEDFQATLVKKDSSFHLQKQAVQASDSAVYYCALS
Elaphurus davidianus V145 iglv JRFZ01045463.1 492 VDAQTVVQEPAVSVSPGGTVTLTCGLSSGSVTTSNYPGWFQQTPGQAPRTLIYYTNSRLSGIPDRFSGSISGNKAALTITGAQPEDEAVYYCAL
Elaphurus davidianus V147 trdv JRFZ01046367.1 70 SIIAQKVTQEQQPQVLVQEKEAVTLDCKYDTRGSQYSLFWYKQPSSGGMLLLIRQDSHNQQNATEGRYSLNFQKARKYISLVISASQLEDSAVYFCALRE
Elaphurus davidianus V148 trav JRFZ01046670.1 4800 LRGEDRVEQSPQTLRTQEGGSLSLNCSHTVSSFRGLQWYRQDPGKGPELLFLLNSPGDEKQKERLRGTLLKKGSSLHIEAPKPEDSATYLCAAQ
Elaphurus davidianus V151 trdv JRFZ01047648.1 2231 FGVAQKVIQNQPDISSQVGQSVTLNCRYETSWRNYYLIWYKQLPSGQMTYLIYQYSEDSNARNGRYSVNLQKAYKSISLIISSLQLEDSAKYFCALPK
Elaphurus davidianus V157 iglv JRFZ01052161.1 5364 SWAQAVLTQPSSVSGSPGQRVSITCSGSSSNVGYGNNVNWYQQLPGSAPRTLIYRDTSRISGVPDRFSGSKSGNTATLTISSLQAEDEGDYYCSSGDSSNNY
Elaphurus davidianus V158 iglv JRFZ01052161.1 15700 SWAQAVLTQPSSVSGSPGQRVSITCTGTSNNIGGGYYVGWFQQIPGSAPRLLIYATTSRASGVPDRFSGSRSGNTATLTISSLQAEDEADYYCASADGRSFD
Elaphurus davidianus V159 iglv JRFZ01052161.1 27065 SWAQAVLTQPSSVSGSPGQRVTISCTGSSSNIGGGYYVGWYQQLPGSAPRTLIYRTSSRASGIPDRFSGSSSGNTATLTISSLQAEDEGDYYCVSADSSSYH
Elaphurus davidianus V160 iglv JRFZ01052161.1 59686 SWAQAVLTQPSSVSGSLGQRVSITCSGSSSNVGRGNYVGWFQQLPGSAPRQLIYGATSRVSGVPDRFSGSRSGNTATLTISSLQAEDEGDYYCGAYESSSSN
Elaphurus davidianus V165 trav JRFZ01053838.1 1438 GTNGDSVNQTEGPLTVSEGALMTLNCTYQTADSAPYLFWYVQHLDKAPQLLLKGSMTNQRPEHEGFQATLVKRDSSFHLQKQAVQTSDSAVYYCALW
Elaphurus davidianus V169 trav JRFZ01055461.1 1025 VSSPQNTVEQSPASLPVPEGAVASLNCTYSDSASQYFVWYRQYPGKGPEFLLSVYLDKNKEEGKFTAQATKANKHVSLLIRDFESSDSATYLCAA
Elaphurus davidianus V175 trav JRFZ01055948.1 1965 QTRGDSVSQMDGQVTLLQGATLTVNCTYSATGYPTLFWYVQYPGEGPELLLKATKVNDKRTNKGFEATYNAKTTSFHLEKALVQESDSAVYYCALG
Elaphurus davidianus V188 trav JRFZ01059418.1 6468 GTSGDSVTQTEGIVTLPEKAPLTLKCTYQSSYSVALFWYVQYQNKELELLLRSSLGNQVTSRGFEATHTSSDSSFHLQKSSVQTSDSAVYYCALR
Elaphurus davidianus V189 trav JRFZ01059418.1 19535 GTSGDSVNQTEGPVTVSEGALMALNCTYQTADSAPYLFWYVQHLNKAPQFLLKGLTADKKVEHEGFQATLVKKDSSFHLQKQAVQASDSAVYYCALS
Elaphurus davidianus V191 trav JRFZ01060649.1 2216 VRGMDVVQSPSALSLQEGASSTLRCNFSTFPDSVQWYLQNPGGRLIHLFSLPSGTKQDGRLKATTVPAERHSSLHISSSRTTDAGTYFCAAQHGAPQ
Elaphurus davidianus V192 igkv JRFZ01061078.1 2637 SSGDVVLTQTPVSLSVTLGETVSISCKSTQSLKDGDGKTYLRWFQHKPGQSPQSLIYEISNRYTEVPDRFTGSGSETDFTLTISSVQAEDAGVYYCFQA
Elaphurus davidianus V198 ighv JRFZ01066446.1 625 VLSQVQLQESGPSLVKPSQTLSLTCAVSGFSLSSSSIAWIRQAPGKALEWVGGIGYSGSTGYNPALKSRLSITRDTSKSQVSLSLSSVTPEDTAVYYCAK
Elaphurus davidianus V212 trdv JRFZ01072248.1 859 SGVAQSVTQDQSHVLSEVGKTVTLNCRYETSWDMYKYSIFWYKQLPSGQMTYLIRQHSDDGNARDGRYSVNFRKAHKSISLTIPALELEDSAKYFCALRD
Elaphurus davidianus V217 iglv JRFZ01075127.1 30726 SWAQAVLTQPSSVSGSLGQRVSITCSGSSSNVGNGNNVGWYQQLPGSAPRTLIYRDSSRASGIPDRFSGSRSGNTATLTISSLQAEDEGDYYCSSSESSSYN
Elaphurus davidianus V224 trav JRFZ01076763.1 5826 VSLGNEVEQSPSTLSVQEGNSSVITCTYTDGNSLYFPWYKQEPGKGPQLLIAIRSNKGKEEDQRLTVLLNTTAKHLSLHISTTEAGDSAVYFCAAR
Elaphurus davidianus V240 trav JRFZ01082254.1 2680 TVIKLAAKTTQPSSMDCAEGEDVNLPCNHSTIGGNDYIHWYQQNPNQSPQYVIRGLQGTVNSSLASLTIASERKSSTLVLPQVTLRDTAVYYCVLRG
Elaphurus davidianus V248 trav JRFZ01088651.1 1816 TVIDAKTTQLSSMDCAEGEDVNLPCNHSTIRVDDYIHWYRQNPSQSPQYVIHGLRGTVNNSMASLTIASDRKSSTLVLPQVTLRDTAVYYCVLRG
Elaphurus davidianus V249 trdv JRFZ01089693.1 8523 SSVAQKVTQVQTAISSRVGQTVTLNCRYEVSWTTDYYYIFWYKQLLSGEMTFLIRQYSAHLNARNGRYSVNFQKADKSISLIISALQLQDSAKYFCALWE
Elaphurus davidianus V250 trav JRFZ01089693.1 28123 LRVQMKVEQSPGVLTLQEGRNSSLICNYSISIRNVQWLQQNPDGRLISLFYIASGMQQKGRLKSTINNKERYSQLYIRDSQPEDSATYFCAVD
Elaphurus davidianus V251 trav JRFZ01089961.1 1675 QTRGDSVSQMDGQVTLLEGATLTVNCTYSATGYPTLFWYVQYPGEGPELLLKATKANDKETNKGFEATYNAKPTSFHLEKASAQESDSAVYYCALR
Elaphurus davidianus V254 igkv JRFZ01090597.1 950744 SSGDIVLTQTPLSLSVIPGKTASISCRASQSLEDSYGDTYLSWHLQKPGQSPQLLIYLVSNRASGVPDRFTGSGSGTDFTLKISRVEAEDAGVYYCQQSIQEP
Elaphurus davidianus V258 trav JRFZ01091175.1 894 MNGQQIKHFPEFLLLQEGENFTTYCNFTSNFYNLQWYKQRPGGSPVLWMILAKGGEVKTQQRLTVRFGASRQHSSLHLTAAQPSDVGTYFCA
Elaphurus davidianus V259 trav JRFZ01091705.1 440 QTRGDSVSQMDGQVTLLQGATLTVNCTYSATRYPTLFWYVQYPGEGPELLLKAMKANDKETNKGFEATYNAKTTSFHLEKASVQESDSAVYYCALG
Elaphurus davidianus V260 igkv JRFZ01091732.1 111 SSGDVVLTQTPLTLSVTPGETVSISCKSTQSLKDSDGKTYLRWFQHKPGQSPQQLIYQVSNRDTGVPDRFTGSGSETDFTLTISSVQAEDAGVYYCFQT
Elaphurus davidianus V261 trav JRFZ01092457.1 837 TVIDAKTTQPSSMDCLEGEDVNLPCNHSTVGGNDCIHWYRQNPNQSPQYVIHGLRGTGNNSLASLTTASDRNSSSLVLPQVTLRDTAVYYCVLRG
Elaphurus davidianus V274 trav JRFZ01095117.1 628 GTSGDSVSQTEGPVSVSEGALMTLNCTYQTTYSNSYLFWYVQHRNKAPQLLLKGFTADKKVEHEGFQATLVKRDSSFHLQKQAVQASDSAVYYCALS
Elaphurus davidianus V286 trav JRFZ01099744.1 2617 GTNGDSVNQTEGPVTVSEGALMTLNCTYQATYSTSYHFWYVQHLNKAPQLLLKGLVADKTVEHEGFQATLVKRDSSFHLQKQAVQASDSAVYYCALR
Elaphurus davidianus V287 iglv JRFZ01100323.1 730 SWAQAVLTQPPSMSASLGQRVTISCTGSSSNIGMLGVSWYQHLPGSAPKTLIYDSNKRPSGVPDRFSGTKSGNTATLTITSLQAEDEADYYCASY
Elaphurus davidianus V298 trav JRFZ01102412.1 1121 GTNGDSVNQTEGPVTVSEGALMTLNCTYQTMYSEPYLFWYIQRLNKAPQLLLKGSMTNQRPEHEGFQATLDKRDSSFHLQKQAVQASDSAVYYCALR
Elaphurus davidianus V321 trav JRFZ01111699.1 1694 GVRGVKVEQSPSVLKLQEGANSTLRCNFSAAVSSVHWFQQNPGGSLTALFSIASGTKQNERLSSTVNFKERYSTLHIAASQLEDAATYLCAVE
Elaphurus davidianus V328 trav JRFZ01112473.1 871 VRGMDVAQSPSALSLQEGASSTLQCNFSTSPDNVQWYLQNPGGHLIRLFYIPSGTKRDGRLNATTVPKERRSSLHISSSQTTDSGTYFCAAQHGAPQ
Elaphurus davidianus V331 trav JRFZ01113718.1 707 GVRAVKVEQSPSVLNLQEGANCTLRCNFSSTVRTLQWFQQNPGGSLISLFFIASGTKQNERLSSTVNSKELYSTLHIAASQLEDAATYLCAVE
Elaphurus davidianus V334 trav JRFZ01115626.1 174 GTNGDSVNQTEGPVSVSEGALMTLNCTYQATYSTSYPFWYVQHLNKAPQLLLKGLIADKKVEHEGFQATFVKRDSSFHLQKQAVQASDSAVYYCALS
Elaphurus davidianus V336 trav JRFZ01117016.1 2455 GTRAQTVTQPESHISVSKGDPVQVKCSYSYSGSPWLFWYVQYPRQCLQLLLKHSSRESIQGFTADLNQAEASFHLKKPSAQEEDSAVYYCALG
Elaphurus davidianus V351 trdv JRFZ01121476.1 55 SGLAQNVIQDQPDISGQLGQSVTLNCRYGTAWSYYYMFWYKLLPNGEMIYLIGQVSSSQNARNGRYSVNFQKARKSISLTISDLELEDSAEYFCALWE
Elaphurus davidianus V358 trdv JRFZ01123560.1 1645 SGVAQKVTQDQPAIISQVGKVVTLNCQYETSRNVHDYSIFWYKQLPSGQMTYLIRQYSEDENERDGRYSVNFQKAHKSISLTISFLKLEHSAKYFCALWE
Elaphurus davidianus V364 iglv JRFZ01124830.1 5819 VDAQTVVQEPAVSVSPGGTVTLTCGLSSGSVTTSNYPGWFQQTPGQAPRTLIYYTNSRLSGIPDRFSGSISGNKAALTITGAQPEDEAVYYCAL
Elaphurus davidianus V365 iglv JRFZ01124830.1 33915 SWAQAVLTQPPSVSASPGQRVTISCTGRSSNIGMLGVSWYQHLPGSAPKTLIYDSNKRPSGVPDRFSGTKSGNTGTLTITSLQAEDEADYYCASLDFSLNS
Elaphurus davidianus V366 iglv JRFZ01124830.1 98706 CFSSFLTQPPSVSRNLGQTVTIFCAGTSSDVGHYNEVGWYQELPGSAPKTLIYDVSKQPSGIADRFSGSKSGNTATLTISGLQTEDKAGYYCSSPGSD
Elaphurus davidianus V367 iglv JRFZ01124830.1 124774 RVVTSQLTQPPAVSVSLGQTASITCQGDDFEELSANWYQQKPGQAPVTVIYEDSERASGIPDRFSGSNSGKTATLTISRAQAEDEADYYCQSAHVSSGD
Elaphurus davidianus V368 trav JRFZ01125358.1 23593 TVIDAKTTQPSSLDCSEGEDVNLPCNHSTIGGNDYIHWYRQNPNQSPQYVIHGLRDTVNKSLASLTIASDRKSSILVLPQVTLRDTAVYYCALRG
Elaphurus davidianus V373 trbv JRFZ01127408.1 835587 VRAQTIHQWPPTRVQPAGSPLSLECTVKGTSNPSLYWYRQEAGGSLQLLFSSFGADQIDPKEFQNFEASRPQDGQFILSSKKLQLNNSGFYLCAWS
Elaphurus davidianus V379 trav JRFZ01128927.1 1301 GTNGDSVNQTEGPVTVSEGALMTLSCTYQTAGSAPYLFWYVQHLNKAPQLLLKGFTADKKVEHEGFQATLVKKDSSFHLQKWAVQTSDSAVYYCALS
Elaphurus davidianus V380 trav JRFZ01129057.1 520 TVINAKTTQPNSMDCAEGENVNLPCNHSTIRIDDYIHWYRQNPNQSPQYVIHGLRGTVNSSMASLTIASDRKSSTLVLPQVTLRDTAVYYCVLRG
Elaphurus davidianus V391 trav JRFZ01137325.1 1531 GVRAVKVEQSPSVLNLQEGANCTLRCNFSATVNSVQWFQQNPGGSLTRLFFIASGMKQNERLSSTVNSKELYSTLHITASQLEDAATYLCAVE
Elaphurus davidianus V393 trdv JRFZ01137616.1 7032 SAVAQKVTQDQPDVSRQVGQSVTLNCWYETSWIAYYLFWYKQSPSGQMTYVIRQGSEATNARNGRYSVNFKKADKSISLTVSALQLEDSAKYFCALRE
Elaphurus davidianus V394 trav JRFZ01137616.1 15684 TVIDAKTTQPSSMDCAEGEYVNLPCNHSTISGADYIHWYRQNPNQSPQFVIHGLRGTGNNSLASLTIASDRKSSTLVLPQVTLRDTAVYYCVLRG
Elaphurus davidianus V398 trdv JRFZ01138319.1 1218 SGVAQKVTQDQPDISSQVGELATMNCQYETSWRSYNIFWYKQLPSGEMIYLISQSSYGPNARDGRYSINFQRSLKAITLIISPLKLEDSAKYFCALWE
Elaphurus davidianus V402 trgv JRFZ01140699.1 69 GLGLSKVEQAQISLSTEVKKSINIICKIESTNFESEVVHWYRQKRNQALEHLVYVTSTTAAARSQVDGKNKIEARKDARMFTSILTVNFIEKEDVGIYYCAGWN
Elaphurus davidianus V403 trav JRFZ01140887.1 1292 GTNGDSVNQTEGPVTVSEGALMTLNCTYQTTYSDHYLFWYVQHHNKAPQLLLKSSTADKMVEHEGFQATLVKKDSSFHLQKQAVQASDSAVYYCALS
Elaphurus davidianus V419 trdv JRFZ01146047.1 222 SIIAQKVTQDQPQVLVQEKEAVTLDCKYDTRESRYSLSWYMQPSSGGMILLIRQDSHNQQNVTEGRYSLNFQKARKSITLVISASQLEDSAVYFCALRE
Elaphurus davidianus V431 trav JRFZ01147538.1 11576 GTGAQLVTQPDGHISVSEGNRLELRCNYSYGGSINLFWYVQYPSQGLQVLLKYLSGTTRVKGIKGFEAEFKKDENSFHLMKASAHGSDSAKYFCALC
Elaphurus davidianus V432 trdv JRFZ01147538.1 23087 SGVAQNVIQDQSDISGQLGQSVTLNCRYGTTWSSYYMFWYKLLPNGEMIYLIRQVSTGQNARDGRYSVNFQKARKSISLTISDLELEDSAEYFCALCE
Elaphurus davidianus V433 trav JRFZ01147538.1 34546 VRGVDVAQSPPALTPQEGASSTLWCNFSTLAESVHWYLQSPGGHLIHLIYIPSGTKQEGRLKATTVPRERRSSLHISSPRTTDSGAYFCAAQHGAPQ
Elaphurus davidianus V445 iglv JRFZ01150021.1 3506 SVVSYELTQPTSVSVALGQTAKITCSGDQLNNQYTSWHQQKPGQAPVTVIYKDNERPSGIPGRFSGSSSGNTATLTISGARAEDEADYYCQSADNIGD
Elaphurus davidianus V446 iglv JRFZ01150021.1 11381 STVSYELTQPTSVSVALGQTAKITCSGDLLDEKYTSWYQQKPGQAPVQVIYKDSKRPSGIPDRFSGSSSGKTATLTITSAQNEDEADYHCLSADSSYN
Elaphurus davidianus V447 iglv JRFZ01150021.1 18784 SVVSYELTQQTSVSVALGQTAKITCSGDQLSKQYASWYQQKPGQAPVTVIYKDSERPSGIPDRFSGSSSSNVATLTISGAQTEDEADYYCQSADSSYN
Elaphurus davidianus V448 iglv JRFZ01150484.1 492 RVVTSQLTQPPAVSVSLGQTASITCQGDYVEVLGANWYQQKPGQAPVLVIYGNSERASGIPDRFSGSSSDTTATLTISGARAEDEADYYCQSADSSDD
Elaphurus davidianus V453 trav JRFZ01152619.1 3302 SIIAQKITQDQPQVLVQEKEAVTLDCKYDTSDPQHSLFWYKQPSSGGMILLIRQDSHNQQNATEGRYSLNFQKARKSITLVISASQLEDSAVYFCALRE
Elaphurus davidianus V454 trav JRFZ01152708.1 361 VRGVDVEQSPAALSLQEGASHVLRCNFSASVNNVHWYLQNPGGRIVHLFSVPSGTKQEGRLKATTVPAERRSSLHISSPRTTDSGTYFCAAQHGAPQ
Elaphurus davidianus V458 trav JRFZ01153871.1 2130 GTSGDSVNQTEGPVTVSEGALMTLNCTYQTAGSAPYLFWYVQHLNKAPQLLLKGLTADKKVEHEGFQATLVKRDSSFHLQKRAVQTSDSAVYYCALS
Elaphurus davidianus V459 trav JRFZ01153871.1 4831 GTSGDLVNQTEGPVTVSEGALMTLNCTYQTTYTTSYLFWYVQHLNKAPQLLLKGLRADKKVEHEGFQATLVKRDSSFHLQKRAVQTSDSAVYYCALS
Elaphurus davidianus V493 trav JRFZ01164408.1 140 GTSGDLVNQTEGPVTVSEGALMTLNCTYQTTYTTSYPFWYVQHLNKAPQLLLKGLRADKKVEHEGFQATLVKRDSSFHLQKRAVQTSDSAVYYCALS
Elaphurus davidianus V531 trav JRFZ01180690.1 1039 VRGVDVAQSPPALTPQEGASSTLWCNFSTLAESVHWYLQSPGGHLIHLIYISSGTKQERRLNARIVPAERRSSLHISSPRTTDSGPYFCAAQHGAPQ
Elaphurus davidianus V549 trav JRFZ01189461.1 577 MNGQQIKHFPEFLLLQEGENFTTYCNFSSNFYNLQWYKQRPGGSPVLLMILAKSGEVKTQQRLTFRFGASRQHSSLHLTATQPSDVGTYFCA
Elaphurus davidianus V552 ighv JRFZ01190954.1 17224 VLSQVQLQESGPSLVKPSQTLSLTCAVSGFSLTSHPVEWVRQAPGMGLEWVGAIDYNGNTYYNAALKSRLSITRDTSKSQVSLSLSSVTPEDTAMYYCAR
Elaphurus davidianus V553 ighv JRFZ01190954.1 42005 VLSQVQLQESGPSLVKPSQTLSLTCAVSGFSLTSYAVGWVRQAPGKALEWVGGISRSGNTWYKPALKSRLSITRDTSKSQVSLSLSSVTPEDTVVYYCAK
Elaphurus davidianus V555 trbv JRFZ01191096.1 789 VVESGVTQTPKYLIKSRKQNATLRCSPESGHRSVYWYQQALGQGPQFLIQYFDGKLYQKGDISDQFSGKQFNDFHSELNLSSLELTDSAVYLCASSQ
Elaphurus davidianus V556 trav JRFZ01191357.1 2962 GTRAQTVTQPESHISVSKGDPVQVKCSYSYSGSPWLFWYVQYPRQRIQLLLKHSSRESIQGFTADLNQAEASFHLKKPSAQEEDSAVYYCVLGNIVPV
Elaphurus davidianus V568 trav JRFZ01002215.1 16187 LRVQMKVEQSPGVLTLQEGRNSSLICNYSTSMTSVQWFQQNPDRRLISLFYIASGTQQKERLKSTINSKERYSQLYIRDSQPEDSATYFCAVE
Elaphurus davidianus V569 trdv JRFZ01002215.1 6733 SSMADTVTQAQTTVTAREGEAATIDCTYQTSRAWYTLYWYRQFPDGRMEFLIYQDDNKANARRDRYSVNFQRARRFISLTISSLHLADSAKYFCALWE
Elaphurus davidianus V571 iglv JRFZ01002511.1 662666 RVVTSQLTQPPAVSVSLGQTASITCQGDDFEELGANWYQQKPGQAPVTVIYGNSERASGIPDRFSGSNSGDTATLTISRAQAEDEADYYCQSADVSSVA
Elaphurus davidianus V581 trav JRFZ01005232.1 448 VSLGNEVEQSPSTLSVQEGNSCFITCTYTDVASSYFPWYKQEPGKGPQLLIDIRSNMGKNEGQRLTVLLNKTAKHLSLHITTTEAGDSAVYFCAAS
Elaphurus davidianus V583 trav JRFZ01005703.1 2835 GTNGDSVNQTEGPVTVSEGALMTLNCTYQATYSNFYLFWYIQRLNKAPQLLLKGLTADKKVEHEGFQATLVKKDSSFHLQKQAVQASDSAVYYCALS
Elaphurus davidianus V588 trav JRFZ01006183.1 2478 GVRAVKVEQSPSVLNLQEGANCTLRCNFSATVNSVQWFQQNPGGSLTRLFFIASGMKQNERLSSTVNSKERYSTLHITASQLEDAATYLCAVE
Elaphurus davidianus V594 trav JRFZ01007717.1 81288 SAGKGVEQPTELMAMEGASAQVNCTYQTSGFNGLFWYQQHDGGAPVFLSYNVLDGLETRGHFSSFLSRFDAHSYLLLKELHMKDFASYLCAVI
Elaphurus davidianus V595 trav JRFZ01007717.1 16318 GLRAQSVTQPEDQVPVAEGGPVTVKCTYSVSGSPYLFWYVQHRNQGLQFLLKYLGGDKLVQGNYGFEAEFNKSQTSFHLKKPSVVGSDSALYFCAVS
Elaphurus davidianus V596 trav JRFZ01007717.1 6338 TLSLAKTSQPIFIDSYEGQDVNISCNHTTIATNDYIFWYRQFPNQGPQYIIQGYKTNVENEVASLLIPADRKVSTLRLARASLRDSAVYYCIVR
Elaphurus davidianus V607 trav JRFZ01009178.1 554 GTNGDSVNQTEGPVTVSEGALLTLNCTYQTAGYSASLFWYVQHLNKAPQLLLKALTADKKVEHEGFQATLVKRDSSFHLQKQAVQASDSAVYYCALS
Elaphurus davidianus V612 trav JRFZ01010262.1 2484 QTRGDSVSQTDGQVTLLQGATLTVNCTYSATGYPTLFWYVQYPGEGPELLLKATKVNDKRTNKGFEATYNAKTTSFHLEKALVQESDSAVYYCALG
Elaphurus davidianus V626 trav JRFZ01013784.1 2538 QTRGGSVTQLGGQVTLPEKATLTISCTYSAPGYPTHFWYVHYSREGPRLLLEATKDKEKRITKEFEATYHRKSKSFHLKKASVQESDSVVYYCALR
Elaphurus davidianus V635 trdv JRFZ01015658.1 483 SGVAQKVTQDQPVIISQVGKVVTLNCQYETSRNVPDYSIFWYKQLPRGQMTYLIHQYSEDGNERGGCYSVNFQKAHKSISLTISFLKLEHSAKYFCALWE
Elaphurus davidianus V646 ighv JRFZ01019993.1 26923 VLSQVQLQESGPSLVKPSQTLSLTCAVSGVSLSSYAVHWIRQAPGKALEWVGAIAYSGSTCYNPALKSRLSITRDTSKSQVSLSLSSVTPEDTAVYYCAK
Elaphurus davidianus V647 ighv JRFZ01019993.1 24802 AAAGVWGRLGAALGWGGGRSLRLSCVASGFTFSSYGMHWVRQAPGKGLDWVLYINTGGGSTYSADSVKGRFTISRDNSKSTVTLQMNSLRAEDITMYYCAR
Elaphurus davidianus V648 ighv JRFZ01019993.1 10475 VLSQVQLQESGPSLVKPSQTLSLTCADSGYSITSGYGWNWIRQAPGKGLVWMGCINYDGNTYYSPSIKSRTSISRDTSKNQFSLQLSSVTTEDTAVYYCAR
Elaphurus davidianus V649 trav JRFZ01020769.1 11134 GTRAQTVTQPESHISVSKGDPVQVKCSYSYSGSPWLFWYVQYPRQRIQLLLKHSSRESIQGFTADLNQAEASFHLKKPSAQEEDSAVYYCVLGNIVPV
Elaphurus davidianus V650 trav JRFZ01020769.1 6652 VNSQQGEQNLQTLSIQEGENVTMNCSYKSITLTALQWYRQNLRRGFVHLILMCSNERQKYSGRLHLTLDNSIKSSSLSIMASQAEDAATYLCAAD
Elaphurus davidianus V658 trav JRFZ01022065.1 30313 VSSQYTLDQSPLFLSIQERTHADLNCTYQKKTFYNFIWFKQEPGKGLVSLSLIQSSQKEQADKNFEELLGKEKFYSVLCISASHPGDTATYFCAL
Elaphurus davidianus V659 trav JRFZ01022065.1 5905 GTRAQTVTQPESHISVSKGDPVQMKCSYLYSGSPWLFWYVQYPRQRIQLLLKHSSRESTQGFTADLNQAEASFPLKKPSAQEEDSAVYYCALG
Elaphurus davidianus V660 trav JRFZ01022065.1 1423 VSSQQGEQNLQILSIQEGENVTVNCSYKSITLTALQWYRQDSRQGFVHLILMRSNERQKYSGRLHFTLDNSIKSSSLSITASQAEDAATYLCAAD
Elaphurus davidianus V670 trdv JRFZ01026018.1 1167 SIMAQKVTQNQSEIPVLEKEDVTLNCAYETNSYTYYLFWYKQPPSGEMIFLIHQESFNELNTTKGQYFLNFQKTMSSISLTITDLQLEDSAVYFCALR
Elaphurus davidianus V673 trav JRFZ01028510.1 1828 GVRGVKVEQSPSVLKLQEGANSTLRCSFSAAVNNVQWFQQNPGGSLTTLFFITSGTKKKERLSSTVNFKERHSTLHIAASQLEDAATYLCAVE
Elaphurus davidianus V674 trdv JRFZ01029052.1 16359 SGVAQKVTQDQPYISSQIGQSVILNCRYELGRSEYTHYLFWYKQLPSGEMTFLIRQESSGRNARSGRYSVNFQRAQNSISLNISALQLEDSAKYFCAVWE
Elaphurus davidianus V675 trav JRFZ01029052.1 6905 VNGQQISQIPQFLRLQEGENFTTYCNSSSILPTLQWYKQSPGGSPVLLMILAKGGEVKTEQRLTGRFGETRKHSSLHLAAAQPSDVGTYFCA
Elaphurus davidianus V686 trav JRFZ01031513.1 1416 SSIAQEVTQDLPPMSVQEKETVTLGCTHDTSGTAQSLFWSKKPNSGAMAFLVRQDSHNKQNATEGRCSLNFQEASKFIKLTISASQLEDSAVYFCALRE
Elaphurus davidianus V690 trdv JRFZ01032876.1 312393 KGVLCNQVTQSSPEQRVATGSEVTLLCTFQTLYSNPDLYWYRIRPDGVFQFVLYRDNAKSHDADFAQGRFSVQHSVSRKTFHLVISSVRPEDTATYYCALEL
Elaphurus davidianus V694 trav JRFZ01033350.1 2098 ILGDSKTTQPSSAEGAEEEPVHLPCNHSTISGPEYVYWYRQISHQGPEYLIHGLNNNVTNRMASLSIAKDRKSSILVLPQVTVRDTAVYYCVLR
Elaphurus davidianus V702 trav JRFZ01034745.1 6777 GTNGDSVNQTEGPVTVSEGALMTLNCTYQTAGSALYLFWYVKHLNKAPQLLLKGSMTNQRPEHEGFQATLVKRDSSFHLQKQAVPTSDSAVYYCALS
Elaphurus davidianus V703 trav JRFZ01034745.1 1167 GTSGDSVNQTEGPVTVSEGALMTLNCTYQTAGSAPYLFWYVQHLNKAPQLLLKGLTADKKVEHEGFQATLVKRDSSFHLQKQAVQTSDSAVYYCALS
Elaphurus davidianus V707 trav JRFZ01036444.1 493 GTRGDSVNQTEGPVTVSEGALMTLNCTYQTAGSALYLFWYVQHLNKAPQLLLKGSTADKKVEHEGFQATLVKRDSSFHLQKQAVQASDSAVYYCALR
Elaphurus davidianus V715 iglv JRFZ01039582.1 834 HLASSQLTQLPSVSVSLGQTASVTCQGDDIGSSYAQWYQQKPGQAPVKVIYQYNQRPAGIPDRFSGSSSGDAATLTISGAQAEDKADYYCQSAGISSGD
Elaphurus davidianus V718 trav JRFZ01041931.1 55100 TLSLAKTSQPIFIDSYEGQDVNISCNHTTIATNDYIFWYRQFPNQGPQYIIQGYKTNVENEVASLLIPADRKVSTLRLARASLRDSAVYYCIVR
Elaphurus davidianus V719 trav JRFZ01041931.1 49656 GLRAQSVTQPEDQVPVAEGGPVTVKCTYSVSGSPYLFWYVQHRNQGLQFLLRYIGGDKLVQGNYGFEAEFNKSQTSFHLKKPSVVGSDSALYFCAVS
Elaphurus davidianus V720 trav JRFZ01041931.1 41018 TLSLAKTSQPIFIDSYEGQDVNISCNHTTIATGDSIFWYRQFPNQGPQYIIQGYKTNVENEVASLLIPADRKVSTLRLARASLRDSAVYYCIVR
Elaphurus davidianus V721 trav JRFZ01041931.1 30326 GVRGVKVEQSPSVLSLQEGANSTLRCNFSTSINYVQWFQQNPGGSLTSLFFIASGTKQNERLSSTVNSKERYSTLHISASQLEDAATYLCAVE
Elaphurus davidianus V722 trav JRFZ01041931.1 22432 VSRGEKVEQYPSFQSVQEGDNCVINCTYIDSASTYFFWYKQEPGKGLQLLIHILSNEGKKQGQRLIVLLNKKNKHLSLNITATHPEDSATYFCATR
Elaphurus davidianus V723 trav JRFZ01041931.1 5435 GSNGDSVTQPKGQVTLLEGESLTVNCSYETKQYPALSWYVQYSGEGPKLLLRAHRDNEKGSSKGFEATYNTETTSFHLEKTSVQESDSAVYYCALS
Elaphurus davidianus V747 trdv JRFZ01050562.1 33176 PGVAQKVTQYQPDIISQVQNVVTLNCRYETSLNVYTYWIFWYKQLPSGEMTYLIRQYSEGGNERDGHYSVNFQKARKFISLTISSLKLEHSGKYFCALWE
Elaphurus davidianus V748 trdv JRFZ01050562.1 1714 SGVAQSVTQDQSHIVSEVGKTVTLNCQYETRWDMFYYYIFWYKQLPSGQMTYLIRQYSDDGNARDGRYSVNFQKAHKSINLTISALQLEDSAKYLCALWD
Elaphurus davidianus V749 trdv JRFZ01052302.1 8311 SGVAQNVIQDQPDISGQLGQSVTLNCRYRATWSYFYMFWYKLLPNGEMIYLIGQVSTGQNARDGRYSVNFQKARKSISLTISDLELEDSAEYFCALWE
Elaphurus davidianus V758 trav JRFZ01057343.1 1459 GTNGDSVNQTEDPVIVSEGALMTLNCTYQTIYSDPYLFWYIQHLNKAPQLLLKSLTADKRVEHEGFQATHVKRDSSFHLQKQAVQTSDSAVYYCALR
Elaphurus davidianus V762 trav JRFZ01059644.1 1506 LRGEDRVEQSPQTLRTQEGGSLSLNCSHTVSGFRGLQWYRQDPGKGPELLFLLYSAGDEKQKERLRATLLKKGSSLHIEAPKPEDSATYLCAVQ
Elaphurus davidianus V765 trav JRFZ01061663.1 2322 VRGVDVEQSPPALSLQEGASYTLRCNFSTSPQSVNWYLQNPGGRLIYLFYIPSGTKQEGRLKATTVPAERRSSLHISSPRTTDSGTYFCAAQHGAPQ
Elaphurus davidianus V770 trav JRFZ01066589.1 17540 VRGVDVAQSPPALTPQEGVSSTLWCNFSTLAESVHWYLQSPGGHLIHLIYISSGTKQERRLNARIVPAERRSSLHISSPRTTDSGPYFCAAQHGAPQ
Elaphurus davidianus V771 trdv JRFZ01066589.1 6042 SSVAQKVTQVQTAITSQVGQTVTLNCRYEVSWTTDYYYIFWYKQLPSGEMNFLIHQYSEHVNARNGRYSVNFQKAGKSISLIISALQLEDSAKYFCALWE
Elaphurus davidianus V781 trdv JRFZ01070838.1 1640 SSMADTVTQAQTTVTAREGEAATIDCTYQTSRTWYTLYWYRQFPGGRMEYLIYQDSYKANARRDRYSVNFQKGKKFISLTISSLYLADSAKYFCALWE
Elaphurus davidianus V782 trav JRFZ01071075.1 327 GVRAVKVEQSPSVLNLQEGANCTLRCNFSATVNSVQWFQQNPGGSLTRLFFIASGMKQNERLSSTVNSKELYSTLDITASQLEDAATYLCAVE
Elaphurus davidianus V793 trav JRFZ01073438.1 2606 GTNGDSVNQTEGPVTVSEGALMTLNCTYQTMYSEPYLFWYVQHLNKAPQLLLKGSMANQRPEHEGFQATLVKRDSSFHLQKQAVQTSDSAVYYCALS
Elaphurus davidianus V796 trav JRFZ01075259.1 1010 VSSQYTLDQSPLFLSIQERTHADLNCTYQKKTFYNFVWFKQEPGEGLVSLSLIQSSQKEQADKNFKELLGKEKFYSVLHISASHPGDSASYFCAL
Elaphurus davidianus V813 trav JRFZ01081252.1 717 TVINAKTTQPSSMDCAEGEDVNLPCNHSTIGGNDYIHWYQQNPNQSPQYVIHGLRGTVNNSLASLTIASDRKSSTLALPQVTLRDTAVYYCVLRG
Elaphurus davidianus V823 trav JRFZ01087215.1 29176 TVINAKTTQPSSMDCAEGENVNLPCNHSTIRIDDYIHWYRQNPNQSPQYVIHGLRDTVNSMASLTTASDRMSSTLVLPQVTLRDTAVYHCVLRG
Elaphurus davidianus V824 trav JRFZ01087215.1 26067 VRGVDVEQSPPALSLQEGASYTLRCNFSTSPMSVNWYLQNPGGRIIQLFYIPSGTKQEGRLNATTVRAERRSSLHISSPRTTDAGTYFCAAQHGAPQ
Elaphurus davidianus V827 trav JRFZ01087733.1 912 GVRAVNVEQSPSVLNLQEGANCMLRCNFSSTVRTLHWFQQNPGGSLISLFFIASGTKQNERLSSTVNSKELYSTLHIAASQLEDAATYLCAVE
Elaphurus davidianus V831 iglv JRFZ01089119.1 3139 SWAQAVLTQPSSVSGSPGQKVSITCSGSSSNVGRGYGSWYQQLPGSAPSLLIYGATSRASGVPDRFSGSRSGNTATLTISSLQAEDEGDYYCAAYDSSGNV
Elaphurus davidianus V845 trav JRFZ01094615.1 2630887 AHTQMVQVNDSMYGFIGTDVVLHCSFANPLPGVKITQVTWQKATNGSKQNVAIYNPAMGVSVLAPYRERVEFLRPSFTDGTIRLSRLELKDEGVYICEF
Elaphurus davidianus V850 trav JRFZ01095675.1 24065 MNGQQIKHFPEFLLLQEGENFTTYCNFSSNFYNLQWYNKQRPGGSPVLLMILAKGGEVKTQQRLAVRFGESRQYSSLHLMAAQPSNVGTYFCAPKQCSG
Elaphurus davidianus V851 trav JRFZ01095675.1 14808 IMVDTEITQLSSMDCAEGEDVNLPCNHSTIDALDYIHWYWQNPNQSPQCVIYGLRDMVNNSKASLTIASDRKSSTLALPQVTLRDTTVYYCVLRG
Elaphurus davidianus V860 trav JRFZ01098641.1 658 TVIDAKTTQPSSMDCPEGEDVNLPCNHSTIGGNDYIHWYWQNPNQSPQYVIHGLRGTVNNSLASLTIASDRKSSTLVLPQVTLRDTAVYYCVLRG
Elaphurus davidianus V863 trdv JRFZ01102502.1 1736 SGVAQNVIQDQPDISGQLGQSVTLNCRYRTTWSYYYMFWYKLLPNGEMIYLIGQVSSSQNARNGRYSVNFQKARKSISLTISDLELEDSAEYFCALWE
Elaphurus davidianus V867 trav JRFZ01104164.1 633 VRGMDVAQSPSALSLQEGASSTLQCNFSTSPDNVQWYLQNPGGHLIRLFYIPSGTKRDGRLNATTVPKERRSSLHISSSQTTDSGTYFCAAQHGAPQ
Elaphurus davidianus V869 trav JRFZ01104621.1 46710 TVIKLAAKTTQPSSMDCAEGEDVNLPCNHSTIGGNDYIHWYQQNPNQSPQYVIRGLQGTVNSSLASLTIASDRKSSTLVLPQVTLRDTAVYYCVLRG
Elaphurus davidianus V870 trav JRFZ01104621.1 43677 VRGVDVEQSPPALSLQEGASYTLQCNFSTLPQSVNWYLQNPGGHLIQLFYIPSGTKQEGRLNARTVPAERGSSLHISSSRTTDSGTYFCAAQHGAPQ
Elaphurus davidianus V871 trdv JRFZ01104621.1 34982 SGVAQSVTQDQPDILSEVGKTVTLNCQYETSWDVYKYYFFWYKQLPSEQMTYLIRQYSDHGNARHGRYSVNFQKAHNSISLTISAIELEDSAKYFCALLD
Elaphurus davidianus V880 trdv JRFZ01107387.1 919 PGVAQKVTQDQPAIISQVGKVVTLNCQYETSRNVPDYSIFWYKQLPSGQMTYLIRQYSEDENERDGRYSVNFQKAHKSISLTISFLKLEHSAKYFCAFWE
Elaphurus davidianus V883 ighv JRFZ01110201.1 18627 VLSQVQLQESGPSLVKPSQTLSLTCTVSGFSLTGYGIHWVRQAPGKALEWVGGICSGGSTYYNPALKSRLSVTRDTSKSQVSLSLSSVTPEDTAVYYCGR
Elaphurus davidianus V884 ighv JRFZ01110201.1 9578 VLSQVQLQESGPSLVKPSQTLSLTCAGSGFSLTSYAVHWVRQAPGKALKWVGAIGYCGSTCYKPALKSRLSITRDTSKSQVSLSLSSVTPEDTAVYYCAR
Elaphurus davidianus V900 trav JRFZ01112600.1 34399 GTNGDSVNQTEGPVTVSEGALMTLNCTYQATYSNIYLFWYVQHLNKAPQLLLKGLTADKTVEHEGFQATLVKRDSSFHLQKQAVQASDSAVYYCALS
Elaphurus davidianus V901 trav JRFZ01112600.1 14668 GAGAQSVTQPDDHITVSEGARLELKCNYSSSVSPYLLWSVQYPDQGPQLLLKYVSGDNLVSGIKGFEAELRKSEKSFHLRKIPAHWKDSAKYFCALS
Elaphurus davidianus V902 trav JRFZ01112600.1 11659 VRGMDVVQSPPALSLQEGASSTLRCNFSTSLDKVQWYLQNPGGHLIRLFYIPSGTKQEGRLNATTVPAERRSSLHISSPRTTDSGTYFCAAQHGAPQ
Elaphurus davidianus V903 trbv JRFZ01112653.1 561 AVHAGVTQDPRFQVVRTGQSTTLKCTRDLNHDYMYWYRQDRGHGLRLIYYSGGAPSSEPGDVPEGYSVSRSNKENFLLTLKSAFRNQTSVYFCASSY
Elaphurus davidianus V909 trav JRFZ01113813.1 1977 VRGVDVEQSPPALSLQEGASYMLRCNFSTSPMSVNWYLQNPGGRIIQLFYIPSGTRQDGRLKATIVPAERGSSLHISSPRTTDSGTYFCAAQHGAPQ
Elaphurus davidianus V912 trav JRFZ01115029.1 2914 GTNGDSVSQTEGPVSVSEGALMTLNCTYQATYSASYPFWYVQHLNKAPQLLLKGLTADKKVEHEGFQATLVKRDSSFHLQKQAVQASDSAVYYCALS
Elaphurus davidianus V913 trav JRFZ01115029.1 733 SIMAQKVTQNQSEIPVLEKEDVTLNCAYETNSYTYYLLWYKQPPSGEMIFLIHQESFNELNTTKGQYFLNFQKTMSSISLTITDLQLEDSAVYFCALR
Elaphurus davidianus V916 trav JRFZ01116290.1 1448 LRGEDRVEQSPQTLRTQEGGSLSLNCSHTVSSFRGLQWYRQDPGKGPELLFLLNSAGDEKQKERLRATLLKKGSSLHIEAPKPEDSATYLCAVQ
Elaphurus davidianus V920 trdv JRFZ01117643.1 770 SGVAQKVTQDQPVIISQVGKVVTLNCQYETSRNVHDYSIFWYKQLPSGQMTYLIRQYSEDENERDGRYSVNFQKAHKSISLTITFLKLEHSAKYFCAFWE
Elaphurus davidianus V921 trdv JRFZ01118364.1 4580 SGVAQKVTQDQPVIISQVGKVVTCQYETSRNVPDYSIFWYKQLPRGQMTYLVHQYSEDGNERGGCYSVNFQKAHKSISLTISFLKLEDSAKYFCALWE
Elaphurus davidianus V928 trav JRFZ01121378.1 16672 GAGAQSVTQLNDHITVSEGARLELKCNYSSSVSPYLLWSMQYPDQGPQLLLKYVSGDNLVSGIKGFEAEFRKSEKSFHLRKIPAHWKDSAKYFCALS
Elaphurus davidianus V929 trav JRFZ01121378.1 13681 VRGMDVVQSPPALSLQEGASSTLRCNFSTSLDNVHWYLQNPGGHLIHLFSVPSGTKQDGRLKATTVPRERHSSLHISSSRTTDSGTYFCAVQHGAPQ
Elaphurus davidianus V944 trav JRFZ01126833.1 6384 GTSGDSVNQTEGPVTVSEGALMTLNCTYQTAGSTPYLFWYVQHLNKAPQLLLKGLTADKKVEHEGFQVTLVKKDRSFHLQKQAVQASDSAVYYCALS
Elaphurus davidianus V945 trbv JRFZ01127408.1 1119414 LVDAGVTQTPRYLIKARGQRETLGCSPVSGHLSVYWYQQALGQGPRFLVQYYRQEVRGEAQLPDRFSAKQFSDSRSELNLSALELTDSAVYLCASSP
Elaphurus davidianus V946 trbv JRFZ01127408.1 1115612 AVHAGVTQDPRFQVVRTGQSATLNCTQDLGHNYMYWYREDPGHGLRLIHYSTVASSTVKGDVPDGYSVSRPKTENFPLTLKSANRSQTSVYFCASSD
Elaphurus davidianus V947 trbv JRFZ01127408.1 1113535 AVHAGVTQDPRFQVVRTGQSATLNCTQDMNHDNMYWYRQDPGLGLRLIHYSAATPYTAKGDVPDGYSVSRPSTENFPLTLKSANRSQTSVYFCASSD
Elaphurus davidianus V948 trbv JRFZ01127408.1 1103307 LVDAGVTQTPRYLIKARGQRVTLECSPVSGHLSVYWYQQALGQGPRFLVQYFRQEVRGEAQLPDRFSAKQFSDFRSELNLSSLELTDSAVYLCASSQ
Elaphurus davidianus V949 trbv JRFZ01127408.1 1091911 AVHAGVTQDPRFQVVRTGQKATLKCTQDLGHNNMFWYRQDLGHGLRLIYYSAGVPSSEPGDVPEGYSVSRSNKENFPLTLKSAFRNQTSVYFCASSY
Elaphurus davidianus V950 trbv JRFZ01127408.1 1079172 LVESGVTQTPKYLIKSRKQQATLRCSPESGHLSVYWYQQALGQGPQFLIQYYDGEEYQKGNISDRFSGEQFSDSRSELSLTPLELTDSALYLCASSQ
Elaphurus davidianus V951 trbv JRFZ01127408.1 1076985 AVHAGVTQDPRFQVVRTGQRTTLKCTQDLGHNSMYWYRQDLGHGLRLIYYSAVVPSSEPGDVPEGYSVSRSNKENFPLTLKSANRSQTSVYFCASSY
Elaphurus davidianus V952 trbv JRFZ01127408.1 1074485 LVDSGVTQTPKYRIKSRKQQATLRCSPDSGQCSVYWYQQALGQGPQFLVQYYDGEEYQKGNISDRFSGKQLNDSCSELSLTPLELRDSTLYLCASSQ
Elaphurus davidianus V953 trbv JRFZ01127408.1 1070460 LVDSEVTQTPKYLIKSRKQQVTLRCSPESGHRYVSWYQQALGQGPQFLVQYYDGKVHTKGNMSDRFSGEQFGDSRSQMNLSSLELTDSALYLCASRE
Elaphurus davidianus V954 trbv JRFZ01127408.1 1068514 AVHAGVTQDPRFQVVRTGQRTTLKCTQHMYHDSMYWYRQDLGHGLRLIHYSSATDTTYQGDVPEGYSVSRSRAENFPLTLESANPSQTSVYFCASGY
Elaphurus davidianus V955 trbv JRFZ01127408.1 1065593 HTGAGVVSQSPRHRVTRRGQTVNLRCDPISGHISLYWYRQTLGQGPEFLAYFQNERALDKSGLPKNRFSAERPDSTYSSLKIQPAEPEDSAVYLCASSP
Elaphurus davidianus V956 trbv JRFZ01127408.1 1056142 PLEAEVTQTPRHLIKRTGQTATLRCSPMSGHSSVSWYQQAWSQGPQFVFEFYETQPRAKGNFSNRFSAKQFRDFSSELNVTSLELTDSALYLCASSL
Elaphurus davidianus V957 trbv JRFZ01127408.1 1048820 HTGAGVVSQSPGHRVTGRGQSVNFSCDPIPGHQGLYWYRQMLGQGPEHLTYFQGKEEADKSGIPNNRFSAERPDGTYSSLKIQSTEPGDSAVYLCASSP
Elaphurus davidianus V958 trbv JRFZ01127408.1 1026681 STDANLGVTQTPRHEVTEKGQAVTLSCEPIKSHTALYWYRQTLVRGLEFLIYFRNEAPIDESGMPKDRFSAKMLNASFSALMIQPTDPGDSATYLCASSK
Elaphurus davidianus V959 trbv JRFZ01127408.1 1015587 PTDAGVTQTPRHEVTEKGQAVTLSCEPIKSHAALYWYRQTSVRGLELLIYFNNQEPVDESGMPKDRFSAKMPNTSLSTLKIQPTEHGDSATYLCASSK
Elaphurus davidianus V960 trbv JRFZ01127408.1 1013108 YISPEVAQSPSHRVIEKKQAVNLRCDPISGHDSLFWYYHAVGKEMKLLIYFIRESVQDNPGMPKGRFTAERTEGTSSTMRVHSEELGDLGVYFCASSR
Elaphurus davidianus V961 trbv JRFZ01127408.1 1010802 HVGAMVIQNPRYLVTGMGKPVNLSCSQNMKHDVMYWYQQKPSQAPKLLLYYYDKQLTREKNTSENFQSSQPNTSFCSLDIRSAGLGDSAVYLCASSR
Elaphurus davidianus V962 trbv JRFZ01127408.1 1006195 FLEAEVTQTPGHLVQGKGLDVEMYCVPEKGHIYVFWYQQILAKEFKFLISFQNDKVLDDKEMPKKRFSAECPSDSPCSLKIQATEPQDSAMYFCASSD
Elaphurus davidianus V963 trbv JRFZ01127408.1 992238 TVAGGVTQTPKYLLKKEGGAVTLECEQDFDYDSMYWYRQDPGLGLRLIFFSQFVGVVQREDIAKDYNASREKKPFFPLTVTSAQKTQTALYLCAASR
Elaphurus davidianus V964 trbv JRFZ01127408.1 988847 SGLGALVSQQPRRAVRKSGDSVTIQCRAVDFQATSVFWYRQLPKQGLVLMATSNEGTDATYEQGYNKDKLPISQPNLTFSSLMVTNVDPADSSLYFCGAR
Elaphurus davidianus V965 trbv JRFZ01127408.1 981615 SMDTEVTQSPSHLVKGKDQKAKMDCVPKKGHAYVYWYRKKLEEAFEFLVYLQNQDTVEDTEVFKQRFSAECPKNSPCSLEIKSTEAADSALYFCASSQ
Elaphurus davidianus V966 trbv JRFZ01127408.1 967302 SMDIEVTQSPSHLVKGKDQKAKMDCVPIKGHTYVYWYRKKLEEAFEFLVYLQNEEIREDTAVFKQRFSAKCPQNSRCSLEINSTEAADSALYFCASSQ
Elaphurus davidianus V967 trbv JRFZ01127408.1 964419 SMDTEVIQSPSHLVKGKDQKAKMDCVPKKGHINVYWYRKKLEEPFEFLVYLQNQDTVEDTEVFKQRFLAECPQKSPCSLEINSTEAADSALYFCASQP
Elaphurus davidianus V968 trbv JRFZ01127408.1 959325 SMDTEVTQSPSHLVKGKDQKAKMDCVPKKGHIYVYWYRKKLEEAFEFLVYLQNEEIREDTAVFKQRFSAQCPKNSPCSLKINSTKAADSALYFCASQP
Elaphurus davidianus V969 trbv JRFZ01127408.1 953106 SMDTEVTQSPSGLVKGKDQKAKMDCVPKKGHIHVYWYRKKLEEPFEFLVYLQKQDIVKDTEVFKQRFSAECPQNSPCSLEINSIEAADSALYFCASSQ
Elaphurus davidianus V970 trbv JRFZ01127408.1 944508 SMDTEVTQSPSHLIKGKDEKAKMNCVPKEGHAYVYWYRKKLEEAFEFLVYFQNEDPMEETAVFKQRFSAECPKNSPCSLEIKSTEAADSALYFCASSQ
Elaphurus davidianus V971 trbv JRFZ01127408.1 929761 SMDTGVTQTPRNRIANTGKSIVLECSQTKGHESMYWYRQDPGQGLRLIYSSYDINGINKGDVSDGYNVSRKEKAKFSLYLEPATPSQTAIYFCASNI
Elaphurus davidianus V972 trbv JRFZ01127408.1 923963 FLDADVHQTPRHCVIGTGKKITLECSQTMGHDNMYWYQQDPGMELQLIHYSYGVNTTEKGERSSRSTVSRISKEHFPLTLETASSSQTSSYFCASSD
Elaphurus davidianus V973 trbv JRFZ01127408.1 922253 LKDAAVTQFPRRKILETKKEVTLQCSQKMGHYAMYWYRQDPGFGLRLIYYSTGPDTIKKGDVPEGYDVSRDELEHFPLTLKSASPNQTSVYFCTSSE
Elaphurus davidianus V974 trbv JRFZ01127408.1 916290 SLEADVTQSPRYRITETKKRVTLTCSQNMNHEAMYWYRQDPGLGPKLIYFSRNIGNVQKGDIPDGYTVSREEKPNFPLTLELASTSQASLYFCASSK
Elaphurus davidianus V975 trbv JRFZ01127408.1 903902 LMDAQVTQTPRYLVKRRGEKVVIECMQNMDHERMFWYRQDPALGLRLLHFSINVGMVEEGDVPHGYSVSRKKKESFPLTLESATTNQTSVYLCASSE
Elaphurus davidianus V976 trbv JRFZ01127408.1 897696 SAFGALLSQKPSRAIRQSGTSVKIECQVDSQLNFMYWYRQLPGQSLVLMATANQGSKATYESGFAEDKFPISRPTLVFSTLTVNNASSEDSSSYFCSAG
Elaphurus davidianus V982 trav JRFZ01130247.1 7652 VRGADVEQSPPALSLQVRASYTLQCNFSTSPMSVNWYLKNPEGCLIHLVSVPSGTKQDGRSKATTVPAERCSSLHISSPRTTDSSTYFCAAQYGAPQ
Elaphurus davidianus V997 trdv JRFZ01136254.1 599 SGVAQKVIQDQPDVSSQVGQSVTLNCRYETSWTAYYLYWYKQLPSGQMAYVIRQGSSASNARKDRYSVSFKKADKSISLTISALQLEDSAKYFCALRE
Elaphurus davidianus V1005 trav JRFZ01137323.1 289 LRGEDRVEQSPQTLRTQEGGSLSLNCSHTVSSFRGLQWYRQDPRKGPELLFLLYLAGDEKQKDRLRATLLKKGSPLHIEAPKPEDSATYLCAVQ
Elaphurus davidianus V1006 trdv JRFZ01137632.1 912 SGVAQKVTQYQPDITSQVQNVVTLNCLYEKSWNVYTYWIFWYKQLPSGEMTYLIHQYSEDGNERDGHYSVNFQKAHQFISLTISSLKLEHSGKYFCALLE
Elaphurus davidianus V1014 trav JRFZ01141693.1 2147 VNSQQGEQNLQTLSIQEGENVTMNCSYKSITLTALQWYRQDSRRGFVHLILMRSNERQKYSGRLHFTLDNSIKSSSLSITASQAEDAATYLCAAD
Elaphurus davidianus V1018 trdv JRFZ01143436.1 531 SSVAQNVIQDQPDISSRVGESVTLNCRYETSRMYGTVWSSYNIFWYKQLPSGEMIFLTRGGRYSINFERSRKSSSLTISTLQLEDSAKYFCALWE
Elaphurus davidianus V1024 trav JRFZ01145684.1 4694 GTRGDSVNQTEGPVTVSEGALMTLNCTYQTAGSALYLFWYVQHLNKAPQLLLKGSTADKKVEHEGFQATLVKRDSSFHLQKQAVQASDSAVYYCALR
Elaphurus davidianus V1031 trav JRFZ01147491.1 469 LRGEDRVEQSPQTLRTQEGGSLSLNCSHTVSSFRGLQWYRQDPGKGPELLFLLNSAGDEKQKERLRATLLKKGSSLHIEAPKPEDSATYLCAVQ
Elaphurus davidianus V1050 trgv JRFZ01150794.1 3597284 HLEQPQISSTRKLSKTAHLECMVSGVTISTTSVYWYQERPGQAIQHLLHIFSNNTVKRESGILLSKFEAHMTPETSTSTLTVHNVREQDSATYYCALWD
Elaphurus davidianus V1051 trgv JRFZ01150794.1 3585357 GLGLSKVEQAQISLSTEVKKSINIICKIESTNFESEVVHWYRQKRNQALEHLVYVTSTTAAARSQVDGKNKIEARKDARMFTSILTVNFIEKEDVGIYYCAGWN
Elaphurus davidianus V1052 trgv JRFZ01150794.1 3579805 GHGLSKVEQAQISLSTEVKKSINIHCKIESTNFGLVAIHWYQIKLNQVLEHLVYVISTTTAARNQVDGKNKIEARKDAQTFTSTLTVNFVEKDVGIYYCACWG
Elaphurus davidianus V1053 trgv JRFZ01150794.1 3571494 GLGQLTLEQPEVSITGTREKSVIMSCKVFSKDFSKDYIHWYRQKPDQGLEQLLYVLTTPALSHSGGTKNKLEAKKDVSSSTSTLRISFLQKEDEAMYYCAGWVS
Elaphurus davidianus V1054 trgv JRFZ01150794.1 3567177 ISITQRITSITKKKGNTAFLECQIKTDKLKKSVYMHWYRQKPEQPLKRILYISSNENVVHEQGISEERYEARKWPSNSLVSLRIHQATEEDAGLYYCACWVE
Elaphurus davidianus V1055 trgv JRFZ01150794.1 3564741 GDIKMKISQQQLSSTRRPDRTVHIRCKLSGVPLENAIVHWYQEKEGEPLTRILYGSANSYKLDKPNSRLEMDSKKNGIFYLIINNVVKSDEAMYYCACWD
Elaphurus davidianus V1056 trgv JRFZ01150794.1 3529309 TQVSSNMEEDKLSVMRATGSSVVIDCDLTHNYIHWYKFQEGAVPRRLLYYDVYNSKVVLEPGTSQGKYHVYKGTGKGYTIVISSLQESDSGTYYCAFWE
Elaphurus davidianus V1057 trgv JRFZ01150794.1 3517057 TQVSSNTEGEKMSITKATGSSVEIICDLITQTLKYIHWYKYQEGTAPQRLLYYDISYSKVTLESGVSEGKYKVYKEKSYTFAISNLQESDSGMYYCAAWE
Elaphurus davidianus V1068 iglv JRFZ01153061.1 2358 SWAQAVLTQPPSVSGSPGQRVIISCTGSSSSTGDNDVSWYQQLPGKAPRLLIYGDDIRASGVPDRFSGSKSGNTGTLTITSLQAADEVDYYCASY
Elaphurus davidianus V1079 trdv JRFZ01158442.1 1489 SGVAQKVTQNQPDISSQVGQSVTLNCRYETSWINHYLVWYKQLPSGQLTYLIHQYSEDSNARNGRYSVNFQKADKSISLIISSLQLEDSAKYFCALPK
Elaphurus davidianus V1082 trav JRFZ01159564.1 375 DSRGQSVTQPDDPVLVSEGTSLELKCNYSYGATPYLFWYVQYPRQRPQLLLKYFSGNTVVQGIRGFVAEFKSSEFSFNLRKFSAHWSDSAEYFCALS
Elaphurus davidianus V1088 trav JRFZ01160659.1 603 GTSGDSVNQTEGPVTVSEGALMTLNCTYQTAGSTPYLFWYVQHLNKAPQLLLKGLTADKKVEHEGFQATLVKTDRSFHLQKQAVQASDSAVYYCALS
Elaphurus davidianus V1090 trav JRFZ01163933.1 1502 ILGDSKTTQPNSAEGAEEEPVHLPCNHSTISGNEYVYWYRQISHQGPEYLIHGLNNNVTNRMASLSIAKDRKSSILVLPQVTVRDTAVYYCVLR
Elaphurus davidianus V1108 igkv JRFZ01171027.1 325 SSGDIVLTQTPLSLSVIPGETASISCKSSQSLVHSDGKTYLNWIQHKPGQSPQCLIYQVSNRYSGVLDRFTGSGSGTDFTLTISRVRAEDAGVYYCYQGTEDP
Elaphurus davidianus V1111 trdv JRFZ01172335.1 1123 SGVAQSVTQDQPHIVSEVGKTVTLNCRYETSWDMYKYSIFWYKQLPSGQMTYLIRQHSDDGNARDGRYSVNFRKAHKSISLTIPALELEDSAKYFCALRD
Elaphurus davidianus V1114 iglv JRFZ01173386.1 55848 SWAQAVLTQPPSVSGSPGQRVTISCTGSSSNIGILGVSWYQQLPGSVPKTLMYGSNKRPSGVPDRFSGTKSGNTGTLTITSLQAEDEVDYYCASADLSLIS
Elaphurus davidianus V1115 iglv JRFZ01173386.1 46626 SWAQAVLTQPSSVSGSPGQRVTISCTGSSSNIGRGDDVGWFQQIPGSAPRSLIYDTTSRHSGVPDRFSGSRSGNTATLTISSLQAEDEADYYCLSGDSSGYD
Elaphurus davidianus V1116 iglv JRFZ01173386.1 41398 VDAQTVVQEPALSVSLGGMVTLTCGLSSGSVTSSNYPSWFQQTPGQAPRTVIYSTNSRPSGIPARFSGSISGNKAALTITGAQPEDEAIYYCGLGSSSYN
Elaphurus davidianus V1117 iglv JRFZ01173386.1 23548 VDAQTVVQEPALSVSPGGTVTLTCGLSSGSVTSSNYPGWFQQTPGQAPRTVIYSTNSRPSGIPARFSGSISGNKAALTITGAQPEDEAVYYCGLGSSSYS
Elaphurus davidianus V1118 iglv JRFZ01173386.1 18537 SWAQDVLTQPSSVSRSLGQRVSITCSGSSSNIGGDSVSWHQQLPGKAPRFLIYGDDTRALGVPDPISDSKSGNLASMTITLLQGEDEADYYCRSYDDSLD
Elaphurus davidianus V1119 iglv JRFZ01173386.1 5011 SWAQAVLTQPSSVSGSPGQRVSITCSGSSSNVGYGNYVSWYQQLPGSAPRTLIYGATSRASGVPDRFSGSRSGNTATLTISSLQAEDEGDYYCASGDSSSNY
Elaphurus davidianus V1123 igkv JRFZ01173919.1 1268838 SSGDIVLTQTPLSLSVIPGEMASISCKSRQSLLHSDGKTYAYWLLQKPGQSPQRLIYQVSNRDTGVPDRFTGSGSGTDFTLTISRVQAEDAGVYYCCQGTEDP
Elaphurus davidianus V1124 igkv JRFZ01173919.1 1257511 ARCDLQVTQSPSFLSASLGCRVSITCWASQSIDSELDWYPQKPGQDSKLLIYYATRLHTRVPSWFSGSGSGTDFTLTISSLEAEDAATYYCQQDHS
Elaphurus davidianus V1125 igkv JRFZ01173919.1 1240699 ASGKAVLHQTPAYIAVPIGESISITCRANQSISDYLSWYKQKPGQAPSILIYDADNQYSGVPGRFTATQSETEFVFTISEVEADDAAMYYCQQDYVL
Elaphurus davidianus V1126 igkv JRFZ01173919.1 1227541 TMGETMLTQTPASLALTPGEMATLTCRASQSISSYLDWYQQKPGQAPRLLIYTATNRASGIPARFSGSGSGTSFTLTISSLEPEDAAVYYCYQHSSG
Elaphurus davidianus V1127 igkv JRFZ01173919.1 1187534 TIAEITLTQSPATVSVTPGDRITITCKASQKVDDDLYWYQQKPGQAPKLIIKQASTLISGVPSRFSGSGYDIDFTLTIDDIKSEDSAYYFCQHDENIP
Elaphurus davidianus V1143 trav JRFZ01178351.1 13734 GTNGDSVNQTEGPVTVSEGALMTLNCTYQTVDLAPYLFWYVQHLNKAPQLLLKGLTADKKVEHEGFQATLVKGDRSFHLQKQAVQTSDSAMYYCALR
Elaphurus davidianus V1144 trav JRFZ01178351.1 6917 GTNGDSVNQTEGPVTVSEGALMTLNCTYQTMYSEPYLFWYVQHLNKAPQLLLKGSMANQRPEHEGFQATLVKRDSSFHLQKQAVQTSDSAVYYCALS
Elaphurus davidianus V1149 trav JRFZ01179583.1 960 VRGVDVEQSPPALSLQEGASYTLRCNFSTSPQSVNWYLQNPGGRLIYLFYIPSGTKQEGRLKATTVPAERRSSLHISSPRTTDSGTYFCAAQHGAPQ
Elaphurus davidianus V1160 trdv JRFZ01186619.1 1383 SSVAQRVTQDQPDISSQVGEVVTLSCRYETRLSTYNMFWYKQLPSGEMIYLIRQGSSSQNARDGRYSINFQRSQRSISLTISDLQLEDSAKYFCALWE
Elaphurus davidianus V1166 trbv JRFZ01189019.1 51695 AVHAGVTQDPRFQVVRTGHSLTLNCSQDLGHDYMCWYRQDPGLGLRLIHYSTGPFTKEQGDVPDGYSVSRPNTENFPLTLESAKRSQTSVYFCASSYSTALH
Elaphurus davidianus V1167 trbv JRFZ01189019.1 47510 SVHAGVTQDPRFQVMRTGQRATLKCTQDLGHDHMCWYQQDMGLGLRLIHYSVSSPTTEKGDVPDGYSVSRPRTENFPLMLDFANHSQTSVYFCSSSY
Elaphurus davidianus V1168 trbv JRFZ01189019.1 45219 LVDSGVTQTPKYLIKSRKQQVTLRCSPESGHRSVYWYQQALGQGPQFLIQYYNREVIQKGDISDQFSGKQFNEFHSELNLSSLELMDSAVYLCASSQ
Elaphurus davidianus V1169 trbv JRFZ01189019.1 40521 LVDSGVTQTPKYLIKSRKQNATLRCSPESGHRYVSWYQQILGQGPQFLIQYYNRGVNEKGNMPDRFLGEQFSDSRSQMNLSSLELTDSAVYLCASSP
Elaphurus davidianus V1170 trbv JRFZ01189019.1 38135 AVHAGVTQDPRFQVVRTGQSTTLKCTQDLNHDYMCWYRQDPGHGLRLIYYSAVVPNSEPGDVPEGYSVSRSNKENFPLTLKSAIRNQTSVYFCASSY
Elaphurus davidianus V1171 trbv JRFZ01189019.1 34138 AVHAGVTQDPRFQVVRTGQRTTMKCTQDLGHNSMYWYRQDPGLGLRLIHYSAVAPSTEQGDVPDGYSISRPKTENFPLMLKSANRSQTSVYFCASSD
Elaphurus davidianus V1172 trbv JRFZ01189019.1 25475 GLVESGVTQTPKYLIKSRKQQSTLRCSPESGHRSVYWYQQALGQGPQFLIQYYDGKEYLKGNISDRFSVKQLSGSRSELNLSSLELTDSALYLCASSP
Elaphurus davidianus V1173 trbv JRFZ01189019.1 18886 LVDSGVTQTPKYLIKSRKQNATLRCSPESGHRYVSWYQQILGQGPQFLIQYYNRGVNEKGNMPDRFLGEQFSDSRSQMNLSSLELTDSAVYLCASSP
Elaphurus davidianus V1174 trbv JRFZ01189019.1 16574 SVHAGVTQDPRFQVMRTGQSVTLNCTQDMNHDYMYWYRQDPGLGLRLIHYSAGTPYTAKGDVPDGYSVSRPSTENFPLTLKSANRSQTSVYFCASSY
Elaphurus davidianus V1175 trbv JRFZ01189019.1 14371 LVDAGVTQTPRYLIKARGQRETLGCSPVSGHLSVYWYQQALGQGPRFLVQYYRQEVRGEAQLPDRFSAKQFSDSRSELNLSALELTDSAVYLCASSP
Elaphurus davidianus V1180 trav JRFZ01191728.1 5110 DSRGQSVTQPDDPVLVSEGTSLELKCNYSYGATPYLFWYVQHPRQRPQLLLKYFSGNTVVQGIRGFVAEFKSSEFSFNLRKFSAHWSDSAEYFCALS
Elaphurus davidianus V1181 trbv JRFZ01193230.1 24865 TSGTGVFQTPKYLLTQMGTKTSLECEQKLNHDSMYWYKQDSKKLLKVMFSYNNKVLIENETVPSRFSPDSPDKAHLNLHIDSLEPGDSAVYFCASSY
Elaphurus davidianus V1182 trbv JRFZ01193230.1 20405 ISADPGITQIPKYLVMGMMDKKSLKCEQHLGHNAMYWYKQSAQKLPELMFIYNYKELAENASVPSRFQPRCPESSQCLLDLNALKPQDSAVYLCASSR
Elaphurus davidianus V1185 trgv JRFZ01194135.1 379 IQQDLRVLQSSVMVGHAGRAVTMSCQVSRSVDYVHWFRQLEGQAPERLLYLALSKRDVQWDSVLRGDKVNAARGADGKSCTMSLMKLAKSDEGVYYCAAWRS