WGS Statistics
Organism WGS Record. Vs Total IGHV IGLV IGKV TRAV TRBV TRGV TRDV
Enhydra lutris kenyoni NSES00000000.1 (NSES01) 181 29 27 45 55 16 6 3
Vgene Table
Organism Vgene Locus contig Contig Pos. AA sequence
Enhydra lutris kenyoni V43 trav NSES01002316.1 471872 LSRGEEIQQHPSFLTVREGDSFVINCTYTDSAPNYFFWYKQEPGKGLQLLIYTLSNVVKKQEQRLTVLFNKKDKHLSLQDTATHPRDSATYFCATR
Enhydra lutris kenyoni V44 trav NSES01002316.1 483300 VSSQKMEQNPQSLSIQEGEKAVLTCNYTNYSPVVFQWYRQDLGRGLVFLLLIRENEVEKQTGRLRATFDKTIQQSSFYITKSQPADSATYFCAA
Enhydra lutris kenyoni V45 trav NSES01002316.1 506413 VRGMTVEQSSSVLSLREGASSTLKCNFSQTARSVQWFRQHPGGGGLARLFYVFSGMQHSGRLNCTVNTKERSSTLHIGASQLEDSATYLCAAQ
Enhydra lutris kenyoni V46 trav NSES01002317.1 16995 SSIAQKVTQAQPAMLVQEKGTVTLECTYNTNKPRYSLLWYKQPSSGAIILLIRQDSYNHQNATEGCYSLNFQKTRNFIQLVISASQLEDSAVYFCALWE
Enhydra lutris kenyoni V47 trav NSES01002317.1 22242 QTHGDSVTQMEVQVTLLEEASLTVNCTYSASGSLTLFWYVQYPGEGLQLLLKALRGKEKGSNKGFEATFDSKLKSFHLEKGSAHASDSAVYYCALS
Enhydra lutris kenyoni V48 trav NSES01002317.1 36476 RECGAASSTLSVQEGSSSVINCSYSDNLSEYFPWYKQELGKGPLLLIDIRSSMATKEDQSLTVSLTRTAEHLSLHIRDTQPEDSAVYFCAASTHCFP
Enhydra lutris kenyoni V49 trav NSES01002317.1 44381 FSQGENVEQHPSTLSVQEGSSSVINCSYSDSNSDYFPWYKQEPGKGPQLLVYILSSMATKEEQRLTVLLNKTAKRFSLHIRDTQPEDSAGYFCAA
Enhydra lutris kenyoni V50 trav NSES01002319.1 8175 VRGMMVEQSASALIPQERASFTLKCNFSQTAGSVQWFRQHSGGGGLTWLFYIASGMQQSGRLNCTVNPRERSSTLHIGASQLEDSATYLCAVE
Enhydra lutris kenyoni V51 trav NSES01002319.1 31440 VRGMTVEQSPSTLSLQEGASSTLKCNFSSTPDSVQWFRQHPRGGGLMGLFFIASGMKQSGRLNCTVNIKERSSTLHIRASQLEDSATYLCAVE
Enhydra lutris kenyoni V52 trav NSES01002319.1 51655 QTCGDSVTQKEDQVTLSENAFLTMNCTYSASGYPVLFWYVHYPGEGLELLLKALKDKEKGSNKGFEATYDGTSKSFHLEKGSVQASDSAVYYCAMN
Enhydra lutris kenyoni V53 trav NSES01002319.1 60136 ETRGDSVTQTEGQVTLLEEASLTVNCTYSASGSLTLFWYVQYPGEGLQLLLKALRGKEKGSNKGFEATFDAKSKSFHLEKGSAQASDSAVYYCAVT
Enhydra lutris kenyoni V54 trav NSES01002320.1 13500 QTHGDSVTQVESQVTLSEEASLTINCTYTTTGYPTLFWYVQYPGEGLELLLKASRDKEKGSNKGFEATYNRDSKSFHLEKGSVQATDSAVYYCALS
Enhydra lutris kenyoni V56 trav NSES01002323.1 6546 FSQGENVEQHPSTLSVQEGSSSVISCSYSDRASEFFPWYKQELGKGPLLLTYILSTVATKEDQRLTVLLNRTAKRFSLHIRDTQPEDSAVYFCTAEA
Enhydra lutris kenyoni V58 trav NSES01002324.1 5878 FSQGENVEQHPSTLSVQEGGSSVINCSYLDGGSDYFPWYKQELGKGPQLLIYIRSTVATKEDQRLIISLNETAKRFSLNIRDTQPEDSAVYFCAA
Enhydra lutris kenyoni V59 trav NSES01002324.1 15164 QIRGDSVTQTEGHMTLLEEASLTVNCTYSASGSLTLFWYVQYPGEGLQLFLKALKDKKKKSNKGFEATFNSKSKSFHFGKGSVQASDSAVYYCALS
Enhydra lutris kenyoni V60 trav NSES01002324.1 46770 QIRGDSVTQMEGQVTLLEEASLTVNCTYSALGSLTLFWYVQYPGEGLQLLLKALRDKEKGSNKGFEATYDSKSKSFHLEKGSVKASDSAVYYCALS
Enhydra lutris kenyoni V61 trav NSES01002324.1 53725 VRGMTVEQSPSALNLQEGASYTLKCNFSSSPYSVQWFRQHPGGSDLTRLFYITSGMQHSGRLNCTVNTKEQFSTLHITASRLEDSATYLCAVE
Enhydra lutris kenyoni V62 trav NSES01002324.1 66258 QTHGDSVTQTEGLMTLLGEASLTINCTFSTAQYPALFWYVQYPGEGLELLLKALKDKEKGSNKGFEATLDSKSKSFHLEKRSVQASDSAVYYCAMY
Enhydra lutris kenyoni V63 trav NSES01002325.1 13185 VRGMNVEQSPSDLSLQEGASSTLKCNFSSFVNSVQWFRQHPGGGGLTRLFYIASGMKQSGRLNCTVNTKEWSSTLHIGASQLEDSATYLCAGA
Enhydra lutris kenyoni V64 trav NSES01002325.1 17740 FSQGENVEQHPSTLSVQEGSSSVINCSYSDSTSSYLPWYKQELGKGPQLLIDIFSSMTTKEDERLTLSLNKTAKHLSLHIRDTQPEDSAVYFCAAS
Enhydra lutris kenyoni V65 trav NSES01002325.1 24216 QTQGDSVTQTEGQVTLLEEASLTVNCTYSTTVFPTLFWYVQYPGKGPQLLLSSSRDQEKKSYKGFEVTLDSKSKSFHLEKGSVQASDSAVYYCVLS
Enhydra lutris kenyoni V66 trav NSES01002325.1 34321 VRGMTVKQSPSDLSLQEGASSTLKCNFSSTVNRVQWFRQNPGGGSFTSLFYIFSGMKQSGRLTCTVNTKEQSSTLHITASRLEDSATYLCAGE
Enhydra lutris kenyoni V67 trav NSES01002325.1 38752 FSQGENVEQHPSTLSVQEGSSSVINCSYSDSASSYFPWYKQELGNGPQLLIDIRSTVATKEDQRLTLSLNKTAKRFSLHIRDTQPEDSAVYFCAA
Enhydra lutris kenyoni V68 trav NSES01002326.1 5027 QTHGDSVTQTEGQMTLSEEASLIINCTFSTTSSPTLFWYVQYPGEGLELLLKALKDKETKHNKGFEATFNSKSKSFHLEKGSVQASDSAVYYCAMN
Enhydra lutris kenyoni V69 trav NSES01002326.1 13626 VRGMTVEQSPSDLSLQEGASSTLKCSFSNAVTNVQWFRQNPGGGSLTRLFYIASGMKQSGRLNCTVNTKERSSTLHIGASQLEDSATYLCAGE
Enhydra lutris kenyoni V70 trav NSES01002326.1 19573 FSQGENVEQHPSTLSVQEGSSSVINCSYSDSTSDYFPWYKQEPGKGPQLLIDIRSSMATKEEQRLTVSLNRMAKHLSLHIRDTQPEDSAVYFCAA
Enhydra lutris kenyoni V71 trav NSES01002326.1 24456 QTHGDSVTQTEGQVTLSEEASLTINCTYSATGYPTLYWYVQYPGEGLELLLKASRDKEKGSNKGFEATYNKDSKSFHLEKGSVQASDSAVYYCVMY
Enhydra lutris kenyoni V72 trav NSES01002326.1 27680 SSIAQKVTQAQPAMLVQEKGSVTLECTYSTNEPSYSLLWYKQPNSGAMVFLIRQDSYNQQNATEGRYSMNFQKTRNFIQLVISASQLEDSAVYFCALRE
Enhydra lutris kenyoni V73 trav NSES01002326.1 33838 QTHGDSVTQTEGQVTLSEEASLTINCTFSTSWSPTLYWYVQYPGEGLELLLKVSKDKEKGSNKGFEATYNKDSKSFHLEKGSVQASDSAVYYCAMN
Enhydra lutris kenyoni V74 trav NSES01002326.1 41734 VSGKNQVEQNPQSLVILEGENCTIQCNYSVTPFSSLRWYKQGTGRGPASLIVMANDDGRKSDGRYTATLDTTSKHSSLHIRAIQLSDSALYICAMS
Enhydra lutris kenyoni V75 trav NSES01002326.1 54368 MRSQQKGVEQSPGSLSLREGDAASLNCNYSDSASQYFMWYRQYSGKGPELLMSMYSKGNKTEGRFSGHVDRAKQYVSLLIRDSQPSDSATYLCAV
Enhydra lutris kenyoni V76 trav NSES01002326.1 56714 GTGAQSVTQPDAHVTVSEEAAMELRCNYSYSGTPYLYWYVQYPNQGLQLLLRYFSGNTLVKDIKGFETEFRKTESSFHLRKHSAHGSDTAEYFCAVS
Enhydra lutris kenyoni V77 trav NSES01002326.1 61788 GTGAQTVTQPEDHISVFEGDFVQIKCNYSYSGSPILFWYVQYPKQALQLLLKHISGESTKGFVANLNRDETSFHLKKQSAQEEDSATYYCALS
Enhydra lutris kenyoni V78 trav NSES01002326.1 66081 VNSQQEQHHQVLSIQEGENATMNCSYKTSISNLQWYRQDSGQGFVQLILIRSNEREKHSGRLRFTLDNSIKSSSLSIIASQTADSATYICAT
Enhydra lutris kenyoni V79 trav NSES01002326.1 71901 GTSGDTVTQTEGSVTLPEGTPLTLNCTYQSSYSVFAFWYVQYQNKEPELLLKSSSENQRVQNHGFQASLKSDKSFHLEKHSVQMSDSAVYYCAME
Enhydra lutris kenyoni V80 trav NSES01002326.1 84432 SSMTQKVTQAQPAISMLENENVTLDCVYEVSGLTYYLFWYKQPPSGEMIFLIHQESYMEQNATEGRYSLNFQKSDHSIGLTITALQLADSAVYFCALR
Enhydra lutris kenyoni V81 trav NSES01002326.1 92649 LSGEDRVEQRPQTLRLQEGDSVSLNCSYTVSTFNGLQWYRQDPGQGPEFLFVLYAVGDEKQKERLRATLLKEGSSLHIKASKPEDSATYFCAVK
Enhydra lutris kenyoni V82 trav NSES01002326.1 101595 VSSKQEVKQSPDALNIREQDSLVLNCSYTDGTLYSFQWFRQDPGKGLTFLMIILSNQKEQTSGRIKVSLDTSARQSALYIVASQPSDSATYFCAV
Enhydra lutris kenyoni V83 trav NSES01002326.1 118545 VTGAEVEQRPPALSLQEGASTTLQCNFSTSTNNVQWYRQDPGGRLILLFNIPSGTKKNGRLNSTTVPKERRSSLSISSSQTTDSATYYCAGEPQCSP
Enhydra lutris kenyoni V84 trav NSES01002326.1 141903 VGSVSNVERNPPWLHVQEGENTNFTCHFPSSNFYSLHWYRWEPAKNPTFLISVTLNGDEKRKGRVKTTLNTQEGYSSLYIRGCQPEDAATYLCAM
Enhydra lutris kenyoni V85 trav NSES01002326.1 149031 INGQEIKQNPQFLLLQEGKDFTISCNSSSILTSFQWYKQRPGGGPVLLISLLKGGEVKQKRLTALFGESRKDSSLHMEASQTADAGTYFCAGTQCCQ
Enhydra lutris kenyoni V86 trav NSES01002326.1 162305 ESTQQLEQSPRFLSIQEGENFTAYCNSTSTFSSFQWYRQKLGEGPVHLMTLSKGGEMKKHKRLTARFGELRKDSSLLITAAQPVDAAIYLCA
Enhydra lutris kenyoni V87 trav NSES01002326.1 175105 VTSQQKGDQQQVKQTPSLSVQEGKISILNCDHNNDLFDYFSWYKKYPAKGPNFLISIRSVTDKNEDGRFTVFFNKSAKHLSLHIAGSQPGDSALYLCAAS
Enhydra lutris kenyoni V88 trdv NSES01002326.1 192522 SSTAEKVIQIQHTVTMQEGESATFNCKYETSWSNYYTLYWYKQLPSGEMIFLIYQDESKPNAQQGRFSLDFQKAIKFISLTISPLKLTDSAMYFCALGS
Enhydra lutris kenyoni V89 trav NSES01002326.1 195967 IMSDADTTQPNAMESTEGEPVHLPCNHSTIGGNEYIYWYRQIPNQGPEYMIHGLKDNVTKGIATLIITRARKSSTLILPRVTLGDAAVYYCLLRE
Enhydra lutris kenyoni V90 trav NSES01002326.1 202480 VSSQELEQSPQSLIVQEGEDFTINCSSSKPVYALHWYRQKKSKGLISLMILWKNGEEKNHEETTATLDEKKQQSSLHIRASQPSHSGTYLCAAD
Enhydra lutris kenyoni V93 trav NSES01002326.1 239695 SSTAQTVTQTQPDTSVRETETVTLHCTHDAGDTDYYLFWYKQPPSGEMSFIIRQESYKQENATEDRFSVNFQKAKKSFGLRISDSRLEDAATYFCA
Enhydra lutris kenyoni V94 trav NSES01002326.1 246424 SSTAQTVTQTQPDTSVRETETVTLHCTHDAGDTDYYLFWCKQPPSGEMSFIIRQESYKQENATEDRFSVNFQKAKTSFGLRISDSRLEDAATYFCAIPR
Enhydra lutris kenyoni V95 trav NSES01002326.1 279906 VSGKPGVEHSLQYLTAQEGDSVMITCSYSIGMTALHWLQQNPGGHIVSLFILSLEMKKKGRVRATINTEELHSSLYITASQPRDSATYLCAV
Enhydra lutris kenyoni V97 trav NSES01002326.1 346774 GSCRTEIVQSSNLAAMIGRDVTFQCQYDILDGNYDYVYWYLQRANQRLTYINHTSQGTMESEHYQLSVNRELSSSTLTIKHVQPRDRAIYYCAL
Enhydra lutris kenyoni V98 trdv NSES01002326.1 353122 VSLDIVLEPDAKTLTVPVGEPATLRCSLTGGDLKNYQVSWYKKNEDNSLTLVYRPSNNTNDNLRSNFKGNTNPSKSQLDIQRTAAEDAGTYYCACD
Enhydra lutris kenyoni V137 iglv NSES01003687.1 14469 FVAAYVLTQPPSMSVNLGQTASITCGGDNIGNTYVSWYQQKLGQAPVMIIYRESNRPSGIPDRFSGSNSGNTATLTISGAQAEDEADYYCLSYKSGSGN
Enhydra lutris kenyoni V138 iglv NSES01003689.1 988 SVTSSDLTQPPSVSVALGQTATITCTGGEAEYFYVYWYQQKPGQAPLTVIYADSKRPSGIPERFSGSKSGNTATLTISSAQAEDEADYYCQFYDSSGN
Enhydra lutris kenyoni V139 iglv NSES01003691.1 27622 SVVSSELTQPPFVSVALGEMATITCTGEELEYGYVHWYQQKPGQAPLTVIYGDSERPSGIPERFSGSKSGNTATLTISSTQAEDEADYFCQSYDSSAD
Enhydra lutris kenyoni V140 iglv NSES01003692.1 32126 SMASYVLTQPPSLSVNLGQTAKITCGGKNIGGKNAQWYQQKPGQAPVLIIYEDSKRPSGIPDRFSGTNSGNTATLTISGARAEDEADYYCQVWDSSAD
Enhydra lutris kenyoni V141 iglv NSES01003692.1 47279 SVVSSELTQPPFLSVALGQTATITCTREKVKYSSIYWYQQKPGQAPLTVIYAEIERPSGIPERFSGSRSGNTATLTISNAQAEDKADYYCQSYYSSGN
Enhydra lutris kenyoni V142 iglv NSES01003692.1 63577 FCALPVLTQPPSANASLEASVKLTCTLSREHSNYFVHWYQQEPGKAPRYLMKVNSDGSHSKGDGIPSRFSGSSSGVDRYLTISNIQLEDEAEYYCGESHTIDG
Enhydra lutris kenyoni V144 iglv NSES01003693.1 891 SMASYVLTQPPSMSVNLGQTVRITCGGNNIGSKNAQWYQPKPGQAPVLIIYGSSNRPSGIPDRFSGSNSGNTATLTISGARAEDEADYYCQVWDSSAN
Enhydra lutris kenyoni V145 iglv NSES01003693.1 40366 SMASSALIQHPSVSVSLGQTATITCSGEVLSKYYAQWYQQKPDETPKLVIYKDTERPSGIPDRFSGSSSGNTHTLTISGARAKDEADYYCQSSG
Enhydra lutris kenyoni V146 iglv NSES01003693.1 44651 STVAYELTQDSSVSVNLGQTARITCGGDNIGRKYAYWYQQKPSQAPLLIIYGDSNRPSGIPEQFSGTNSGNTTTLTISGAQAADEADYYCQVWDNSGN
Enhydra lutris kenyoni V245 igkv NSES01007835.1 62604 AHGDITMTQSPGSLPVSPGQRVTMNCRASQSVSNYVAWYQQKPGQAPRLLIYRASNRATGIPDRFSGSGSGTDFTLTISNLQAEDVGNYYCQHHYSSP
Enhydra lutris kenyoni V246 igkv NSES01007836.1 18557 SSGEVTLTQTPLSLSVTPGEPASISCRASQSLVHSNGNTYLSWFRQKPGQSPQSLIYKVSNRFTGVPDRFSGSGSGTDFTLRISRVEADDVGVYYCGQS
Enhydra lutris kenyoni V247 igkv NSES01007837.1 17582 SSGEVVLTQTPLSLPVTPGESASISCRASQSLVHSNGNTYLSWFRQKPGQSPQGLIYLVSNRFTGVPDRFSGSGSGTDFTLRISRVEADDVGVYYCSQS
Enhydra lutris kenyoni V248 igkv NSES01007838.1 2362 ACGDITMTQSPGSLAASPGQRVTMNCRASQSVSNDIAWYQQKPGQSPRLLIYGASNRATGIPDRFSGSGSGTDFTLSISNLQVEDVGNYYCQQYDSYL
Enhydra lutris kenyoni V340 trav NSES01011864.1 153078 PQAQVVQVNDSMYGFIGTDVVLHCSFANPLPSVKITQVTWQKATNGSKQNVAIYNPAMGVSVLNPYRERVEFLRPSFTDGTIRLSRLELDDEGVYICEF
Enhydra lutris kenyoni V370 trgv NSES01012976.1 42983 GGAGLKLSQPALLVERVGSSRPLDCKVDTGVRYIHWYRHQEGTEPKRLLYLDMSTSLVQWDFVLKADKVNAKKGKDNYSCTLSVLKLEKSDEGVYYCAAWE
Enhydra lutris kenyoni V371 trgv NSES01012983.1 36134 GLGQATLEQHEISVSRARDKSAHISCNVSAKDFNSETIYWYWQKPDQEIEYLTDVITNRVQVPLDGKNNKFEASKNTHTSTSTLKINFLEKEDEAVYYCGSWNW
Enhydra lutris kenyoni V372 trgv NSES01012984.1 1683 TNAEFLITQLVPSITKKQGNTAFLECQIKAGGLRNNVYIHWYQQKPDQPLKRILYISSNENVVHEQGFNEERYEARKWQRDLPASLRIHRVNEEDAGLYYCACWD
Enhydra lutris kenyoni V373 trgv NSES01012985.1 15759 GLGQLKLEQPEISISRARYKSAHILCKVSTKDFTNAVIHWYRQKPHQEIEHLTYVLSSYTQVSLGGKKNKLEATKNAITSTSTLKVNFLEQEDEAMYYCACWFG
Enhydra lutris kenyoni V374 trgv NSES01012985.1 27951 GLGQLKLEQPEISISRARYKSAHILCKVSTKDFTNAVIHWYRQKPHQEIEHLTYVLSSYTQVSLGGKKNKLEATKNAITSTSTLKVNFLEQEDEAMYYCACWFG
Enhydra lutris kenyoni V399 trgv NSES01014483.1 11239 VSLSPGRRWSRAQALLVARVGSSHPLDCQVDSSVSYIHWYRHQEGTAPKRLLYLDMSRSLVQWDFPTKADKVNAEKGKESYSCTLLVPKLEKSDEGVYYCAAWE
Enhydra lutris kenyoni V429 igkv NSES01015670.1 45707 CGERLLLTQTPETLAAAQDSFISITCRSSVEVGASMAWYQQKPKEAPRLLIFEASARAAGTPSRFRGSGSGSDFSLNIHRVEAENVGGYYCQ
Enhydra lutris kenyoni V430 igkv NSES01015670.1 54607 ASSEIQMTQTPSSLSASPGDRVTITCRASQNANKWLIWYQQKPGRAPKLLIYEASKLGTGVPSRFSGSGSGTDFTLTISSLEPEDAGTYYCQ
Enhydra lutris kenyoni V431 igkv NSES01015670.1 59756 SSGEIVMTQTPLSLSLIPGELASISCGASQSLLQSDGNTYLHWYLQKPGQSPQLLIYLVSNRFTGVPDRFSGSGSGTDFMLRISRVEAEDMGVYYCGQNLQSP
Enhydra lutris kenyoni V432 igkv NSES01015670.1 66328 SSGEIVITQTPLSLPITPGESASISCRASQSLLHSNGNTYLYWFRQKPGQSPQDLIYKVSNRYSWVPDRFSGSGSGTDFTLRISRVEADDVGVYYCGQNLQSP
Enhydra lutris kenyoni V433 igkv NSES01015670.1 79192 SSGEIVMTQTPLSLPITPGEPASISCRASQSLLHSDGKTYLGWFRQKPGQSPQGLIYLVSNRYSWVPDRFSGSGSGTDFTLTISRVEADDVGVYYCVQNLQSP
Enhydra lutris kenyoni V434 igkv NSES01015670.1 89455 SSGEVVLTQTPLSLSISPREPASISCRASQSLLHSNRYNYLPWYLQKPGQSPQLLIYFATNRFAGVPDRFSGSGSGTDFTLRISRVEADDVGVYYCGQSLYA
Enhydra lutris kenyoni V435 igkv NSES01015670.1 110605 SSGEIVMTQTPLSLPITPGEPASISCRASQSLLHSDGKTYLGWFRQKPGQSPQGLIYLVSKRFSGVPDRFSGSGSGTDFTLTISRVEADDVGIYYCAQSLQSP
Enhydra lutris kenyoni V436 igkv NSES01015670.1 119263 SSGEIVMTQTPLSLPITPGEPASISCRASQSLLHSDGKTYLGWFRQKPGQSPQGLIYLVSKRLSGVPDRFSGSGSGTDFTLTISRVEADDVGIYYCAQSLQSP
Enhydra lutris kenyoni V437 igkv NSES01015671.1 3423 ATGEIVLTQSPALLSLSPGEKATLNCRASQSASSYVAWYQQKPGQPLRLLIYGASNRATGIPARFSGSGSGTDFTLTISNLEREDVAIYYCYQYNSGY
Enhydra lutris kenyoni V438 igkv NSES01015672.1 20689 VSWHSGLTQSPAFLSVSLGDSVSITCKANESISDYLSWYQQKPGQAPQLLIYDADNLKSGVPDRFSVIQLDREFILKISSVEAEDAASYYCQQDYILP
Enhydra lutris kenyoni V439 igkv NSES01015672.1 24170 SRGDIVLTQTPLSLSVTPGEPASISCRASQSPVHSNGNTYLSWFRQKSGQSPQLLIYKISNRFTGVPDRFSGSGSGTDFTLRISRVEADDVGVYYCGQLSKIP
Enhydra lutris kenyoni V440 igkv NSES01015672.1 33462 SSGEVTLTQTPLSLSVTPGEPASISCRASQSLVHSNGNTYLSWFRQKPGQSPQLLIYKVSNRFTGVPDRFSGSGSGTDFTLRISRVEADDVGVYYCKQG
Enhydra lutris kenyoni V441 igkv NSES01015673.1 7376 SSGEVMLTDSTLTVSYPKELASISCRASQSLLHGNGNTYLSWFRQKQGQSPQGLIYKVSNSFTGVPDRFRGSRSGTDFTLTISKVEAEDMGVYYCEQG
Enhydra lutris kenyoni V442 igkv NSES01015673.1 18805 SLGETVLTQSPAVLSMAPKEGVSLTCWASQNINKWLAWYQQEPGRAPKFLIYEASKLETGVPSWISSSWSGTDFTITISSLEPEDARTYYCLQSNSYP
Enhydra lutris kenyoni V443 igkv NSES01015673.1 31686 SSGDIVLTQTPLSLSISPREPASISCRASQSLVHSNGNTYLYWYLQKPGQSPQGLIYRVSNCFTGVPDRFSGSGSGTDFTLRISRVEADDVGIYYCQHCIQYP
Enhydra lutris kenyoni V511 ighv NSES01019648.1 52130 VLCEVQLVESGGDLVKPGGSLRISCAASGFTFSSYWMSWVRQAPGKGLQWVALINTGGSSTYYADSVKGRFTISRDNSKNTLYLQMNSLRAEDTAVYYCAR
Enhydra lutris kenyoni V512 ighv NSES01019648.1 57146 VQGEVQLVDSGGDLVKPGGGVSLRLFCAASGFNFSSYNMDWVRQAPGKGLQWVSYISSGGSTYYADSVKGRFTISRDNDKNKLYLQMNSLKAEDMALYYCAR
Enhydra lutris kenyoni V513 ighv NSES01019648.1 71900 GGVWGRPGEAWGGGTLRLSCAASRFTFSSYYMSWVRQAPGKGLQWIAYISSGGSSTSYADSVKGRFTISRDNGKNTLYLQMSSLRPENTVMYYCER
Enhydra lutris kenyoni V514 ighv NSES01019649.1 4459 VQCEVQLVESGGDLVKPGGSLRLSCEAFGFTFSSYSMSWVHQAPGKGLQWVTWIRSDGSSIYYTDSVKGRFTISRDNGKNTLYLQMDSLRPEDTAMYYCA
Enhydra lutris kenyoni V515 ighv NSES01019651.1 34699 VQCEAQLLESGGDLVKPGGSLRLSCAASGFTFSSYYMSWIRQAPGKGLQWVAGINGGGSSTYYADSVKGRFTISRDNGKNTLYLQMNSLRTEDTALYYCA
Enhydra lutris kenyoni V516 ighv NSES01019653.1 58754 VQCEVQLVESGGDLVKPGGSLRLSCAASGFTFSNYYMYWVCQAPGKGLQWVASIRSGGGNTYYADSVKGRFTISRDNGKNTLYLQMKSLRTEDMALYYCAK
Enhydra lutris kenyoni V517 ighv NSES01019655.1 71824 RGAAGGVWGKPGEDWGSLRLSCAASGFTFSNYDMSWVRQAPGKGLQWVSVIWYDGSKTYYADSVKDRFTISRDNGKNMLYLQMNSLRAEDMALYYCVK
Enhydra lutris kenyoni V521 igkv NSES01019929.1 1159 AHGDITMTQSPGSLAVSPGQRVTMNCRASQSVSNYVAWYQQKPGQAPRLLIYAASSRAPGIPDRFSGSGSGTDFTLTISNLQAEDVGNYYCMQHDSY
Enhydra lutris kenyoni V522 igkv NSES01019929.1 5851 CTGDIVLTQSPASLTVSPEHMAISCKTCQKVGDILSITHFIIWYQQKSGQRPRILTYKASSQVSGVPARFSGGGSGTEFSLTIDPMEHGDAASYYCQWSKETP
Enhydra lutris kenyoni V523 igkv NSES01019930.1 15723 VHGDITMTQSPGSLAVSPGQRVTMNCRASQGVYSNVAWYQQKPGQAPRLLIYGASSRATGIPDRFSGSGSGTDFTLSISNLQAEDVGHYYCQQYNNYL
Enhydra lutris kenyoni V524 igkv NSES01019930.1 98564 AHGDITMTQSPGSLAVSPGQQVTMNCRASQSVYSNVAWYQQKCGQAPRLLIYGASRRATGIPDRFSGSGSGTDFTLTISNLQAEDVGNYYCQQDNNYP
Enhydra lutris kenyoni V525 igkv NSES01019930.1 128464 AHGDVTMTQSPGSLAVSPGQRVTVNCRASQGVYNNVAWYQQKPGQAPRLLIYGASNRATGIPERFSGSGSGTDFTLTISNLQAEDVGNYYCQQLYSS
Enhydra lutris kenyoni V528 ighv NSES01020367.1 31942 VQCEVQLVESGGDLMKPGGSLRISCAASGFTFSSYYMIWVHQAPGKGLQWVAWINTGGSSTSYADSVKGQFTISRDNSKNMLYLQMNSLRAEDTAIYYCAR
Enhydra lutris kenyoni V530 ighv NSES01020770.1 20462 VLSQLTLQESGPGLVKPSQTLSLTCVVSRGSVTSSYYWNWIRQRPGRALEWMGYWTGSTSYNPAFQGRISITADTSKNQFSLQLSSVTTEDTAVYYCAR
Enhydra lutris kenyoni V531 trav NSES01020838.1 2214 QTRGVSVTQTEGQVTVLEEASLTVNCTYSASGTLILFWYVQYPGEGLQLLLKALRDKEKKSNKGFEATFDDKSKSFHLEKGSVQASDSAVYYCALS
Enhydra lutris kenyoni V532 trav NSES01020839.1 9563 QTRGDSVTQTEDQVTLSENAFLTMNCTYSASGYPALFWYVQYPGEGLELLLKALKDKEKGSNKGFEATYDGTSKSFHLEKGSVQASDSAVYYCAMN
Enhydra lutris kenyoni V533 trav NSES01020839.1 13085 SSIAQKVTQAQPAMLVQEKGTVTLECTYNTNEPRYSLLWYKQPSSGAMILLIYQDSYNQQNATEGHYSLNFQKTRNFIQLIISASQLEDSAVYFCALWE
Enhydra lutris kenyoni V534 igkv NSES01021012.1 5613 VRWHAGLTQSPAFLSLSLREGVFITCRANNSISNDLSWYQQKPGQAPQHLIYDADNLKSGVPDRFSAIQSDREFILKISAVEAEDAASYYCQRDYILP
Enhydra lutris kenyoni V535 igkv NSES01021012.1 13677 SREGGCDDTDFTLLLPVTLREPASIFCRASQSLIDSNGNTYLSWYLQKPGQSPQLLIYKVSNLFTGVPDRFSGSGSGTDLTLTISRVEADDVGVYYCGQFTKIH
Enhydra lutris kenyoni V537 ighv NSES01021124.1 2528 VQSEVQLVESGGDLVKPGGSLRLSCAASGFTFSSYAMHWVRQAAGKRLQWVAVISSDGSNTYYADSVKGRFTISRDNGKNTLYLQMNSLRAEDTAVYYCVK
Enhydra lutris kenyoni V538 igkv NSES01021469.1 4548 SHGKIVLTQSPAVLSMASKEGVTITCGASQNINKWLVWYHQEPGRAPKLLIYATSKLETGVLSRISGSGSGTDFTLRISSLEPEDAGTYYCQQSNSYP
Enhydra lutris kenyoni V539 iglv NSES01022106.1 2617 SMASSVLSQPHSVSVSLGQMATISCSGEILSGSYAYWYQKKPGQPPVQVIYKDTERPSEVPDRFSGSSSGTTHTLTINGAQAEDEADYYCQSSESSGE
Enhydra lutris kenyoni V541 ighv NSES01023099.1 6033 VECEVQLVESGGDLVKPGGSLRLSCAASGFTFSNYGMNWVRQAPGKGLQWVAIIWYDGSKTYYADSVKGRFTISRDNGKNMLYLQMNSLRAEDTAVYYCAT
Enhydra lutris kenyoni V543 trav NSES01025050.1 70 VRGMTVEQSPSALNLQEGASSILKCNFSSTVYNVQWFRQHPGGSGLTRLFYITSGMQHSGRLNCTVNTKEQFSTLHITASRLEDSATYLCAVE
Enhydra lutris kenyoni V544 ighv NSES01025316.1 2439 VQCEVQLVESGGDLVKPGGSLRLSCAASGFTFSNYGMSWVRQAPGKGLQWVAYISYNGGSTYYADSVKGRFTISRDNGKNTLYLQMNSLRTEDTALYYCAT
Enhydra lutris kenyoni V545 ighv NSES01025394.1 1342 VLSQLTLQESGPGLVKPSQTLSLTCVVSRGSVTSSYYWNWIRQRPGRALEWMGYWTGSTSYNPAFQGRISITADTSKNQFSLQLSSVTTEDTAVYYCAR
Enhydra lutris kenyoni V546 ighv NSES01026209.1 526 VQCEVQLVESGGDLVKPGGSLRLSCAASGFTFSNYYMHWVRQAPGKGLQWVAHISDTGSSTNYADSVKGRFTISRDNGKNTLYLQMNSLRAEDTAMYYCV
Enhydra lutris kenyoni V548 igkv NSES01027589.1 816 SREGGCDDTDFTLLLPVTLREPASIFCRASQSLIDSNGNTYLSWYLQKPGQSPQLLIYKVSNLFTGVPDRFSGSGSGTDLTLTISRVEADDVGVYYCGQFTKIH
Enhydra lutris kenyoni V580 trdv NSES01002326.1 423145 ESVLCDQVTQSPLDQTVASGSSVKLFCTYYTTESNPDLYWYRIWPGHSFQFIFYRDKILTHNADFTGDRFSVMHNPSQRTFNLVISLVEPEDSTTYYCAMN
Enhydra lutris kenyoni V598 trav NSES01003181.1 39802 TSDQEFQVTQPESSVSVRAGEILTLGCNVSARSPAGPVLWFRENGQERKLIYNFNGGKFPRVTQVENTEFNQTDYSIRISNVSPKDVGTYYCVKLTI
Enhydra lutris kenyoni V723 igkv NSES01007836.1 23807 AHGDITMTQSPGSLAGSPGQRVTMNCRASQSVSNYVAWYQQKPGQAPRLLIYDASSRATGIPDRFSGSGSGTDFTLSISNLQVEDVGNYYCQQGNSF
Enhydra lutris kenyoni V724 igkv NSES01007837.1 7336 ACGDVMMTQSPGSLAGSPGQRVTINCRASRSVSNYVAWYQQKPGQVPRLLIYGASSRATGIPDRFSGSGSGTDFTLSVSNLQAEDVGNYYCQHHYSS
Enhydra lutris kenyoni V784 trbv NSES01010461.1 314723 HMDAEITQSPRNEIARTGKKVTLICHQTENYDYMYWYRQDLGHGLRLIYYSINTGSTQKGEVSDGYNISRPKTEEFHLILPSVTSSQTSVYFCANSY
Enhydra lutris kenyoni V785 trbv NSES01010461.1 292549 FTDAGVIQTPRHKVTKMGQEVTLKCQPISGHTALYWYSQTSVQGLKLLIYFNNQAPIDDSGMSKEQFSAEMPDQSLSTLKIKPTEPQDSATYLCASSV
Enhydra lutris kenyoni V786 trbv NSES01010461.1 287085 PMGAMVIQSSRYQVTRVGKPVNLSCSQNMNHDSMYWYQQKLNQGPKLLLYFYDTDLNKEADTSDNFQASWANTSFCSLNILSPGLGDSGVYLCASSK
Enhydra lutris kenyoni V787 trbv NSES01010461.1 281492 ALHAKVTQTPGHLVKGKGQKAKMHCVPIKGHSFVYWYQQIPAKEFKFLISFQKDAIFDKTGMPEKRFSAACPQNASCSLEIEPTELQDLAVYFCASSE
Enhydra lutris kenyoni V788 trbv NSES01010461.1 270742 PVNAGVTQNPRHLVIRTGQEATLKCRPEKGHDYFYWYQQPQGESLKFMVYLQNKNTIDDSGMSKERFSTDFSKDGQSIFKIQPAELGDSAVYFCASSL
Enhydra lutris kenyoni V789 trbv NSES01010461.1 233325 LVDAGITQTPKHCVSGIGKKIVLECSQTMGYENMYWYRQDPGKALQLIHYSYGVNTTENEELSSGSTVSRLKKEHFPLTLESASPSQTSLYICASSE
Enhydra lutris kenyoni V790 trbv NSES01010461.1 228097 LKGALVTQFPRHRIVGTEKELTLQCLQDMKYVLMYWYRQDPGFGLRLIYYSTGARNFEKGDVPRGYRVSRKDLQSFSLTLESASTNQTSVYLCTSSE
Enhydra lutris kenyoni V791 trbv NSES01010461.1 219237 PVEAGVTQTPRHFITRTGRQLTLYCSQDMDHDVMYWYRQDPGVGLKLIYFSRNVDFLEDGDVPDGYSVLRKEKKDFPLTLKSTGMNQTSLYLCASSV
Enhydra lutris kenyoni V792 trbv NSES01010461.1 204999 SVFGTLLSQQPRRDICQRGTSMTIQCEAETQLPLMYWYRQLPGQSLILIATANQGMEATYESGFTKEKFPISRPTLTFSSLTVNNMSSEDSSFYLCSAG
Enhydra lutris kenyoni V793 trbv NSES01010462.1 52668 STGTGVTQTPKHLVTGTGRNVTLKCKQHLGHNAMYWYKQSVQKPPKLMLAYNYKDLLQNETASSRFLPDRPNNTQLDLHIDALEPEDSTLYLCASSK
Enhydra lutris kenyoni V794 trbv NSES01010462.1 51685 PTGHTEPECRQTPSHQVTERGTRVPLKCDPTSGHLFLHWYRQILEQKLEFLVLFYKSTLLEKSETFKDRFSARRTDGSFSTLQIQPTELGGSATYLCAS
Enhydra lutris kenyoni V795 trbv NSES01010462.1 32427 PVASGVTQTPRHLIKTRGQKVTLRCSPVSGHLSVYWYQQVLGQGPRFLIQYYNMEERDKGDIPERFSAQQFRNYSSQLDLDLLELEDSALYLCASS
Enhydra lutris kenyoni V796 trbv NSES01010462.1 26794 SLNAGITQTPKFQVLGTGQNMTLKCHQDMNHNSMYWYRQDHGHGLRLIHYSVGAGTSTNGEVPDGYSASRPNIMIFLLKLLSTTPSQTSVYFCASSV
Enhydra lutris kenyoni V797 trbv NSES01010462.1 23384 HAGPGVSQFPRHRVTKRGQNVTLSCDPISGHVVLYWYRQTIGKGPEFLVYFQNKEALDKSGMTNDRFSAKRSEGTRSTLQIQRAEQGDSAVYLCASS
Enhydra lutris kenyoni V798 trbv NSES01010462.1 7329 HAGPGVSQFPRHRVTKRGQNVTLSCDPISGHISLYWYRQTVGKGPEFLVYFQNEDALDKSGMTNDRFSAERSEGTRSTLQIQRAEQGDSAVYLCASS
Enhydra lutris kenyoni V799 trbv NSES01010462.1 1274 PAGAEVIQTPRHLIRGSGGKAVLKCEPVSGHSSVRWYQQTLGQGPKFLIEYYEQMLRDKGDMPERFSAQQLSNYSSQLDLSLLEPGDSAMYLCASS
Enhydra lutris kenyoni V914 igkv NSES01015672.1 923 VSGDIVMTQSPASLNGSPGERIAMNCKSSQSLLYSSNQKNYLAWYQQKPGQAPKMLIIWASTRASGVPDRFSGSGSGTDFTLTISNLQAEDVGDYYCQQYYNYP
Enhydra lutris kenyoni V915 igkv NSES01015673.1 12606 SHGDITMTQSPGSLAPGQWVTMNCRASQSVNKYVAWCQQKPGQAPRLLFYFASNWASGIPEWYSGSGSGTDFTLTISNLQAEDVGDYYCQQYYSYL
Enhydra lutris kenyoni V935 iglv NSES01017004.1 41518 SWAQSVLTQPSSLSGSPGQRVTISCTGDSTNIGDGYTVSWYQQHPGKAHKTIIYNTSSRPSGVPERFSGSRSGNTGSLTITGLKAEDEADYYCLSGDKSLS
Enhydra lutris kenyoni V936 iglv NSES01017011.1 11564 SWAQSVLTQPSSLSGSPGQRVTISCTGGSTNIGGGYAVSWYQQHPGKAPKSIIYNTSSRPSGVPERFSGSRSGNTGSLTITGLKTEDEADYYCSKWDKS
Enhydra lutris kenyoni V937 iglv NSES01017012.1 19544 SWAQSVLTQPPSVSGSLGQTVTISCTGSSSNIGNYGLAWYQQLPGTPPKTVIYWDDSRPSGIPIRFSGSRSGISGTLTITGLQAEDEAEYYCSAWDSSLS
Enhydra lutris kenyoni V938 iglv NSES01017012.1 12020 SWAQSVLTQPPSVSGTLSGRVTISCTGSSNNIGGYGVSWQQQLPGKAPRTIIYANTYRPSGVPDRFSGSKSGSTATLTITGLQAEDEAEYYCATWDNSLR
Enhydra lutris kenyoni V939 iglv NSES01017017.1 103342 SRAQSMLTQPTSMSGALGQRVSISCTGSSSSIGGGYGVNWYQQLPGMTPKLLVYHDGRRPSGVPDQFSVTKSGSSAFLTITELQAENEADYYCQSFDSNLRM
Enhydra lutris kenyoni V940 iglv NSES01017017.1 56360 CVDTGILHVRVCGMEVHLTCTGNSNNVEACYVGWYQQISHGAPKTMMLGTTRPSGIPAGFSGCHSRNTDSLTISGLQPEDKADYYCSA
Enhydra lutris kenyoni V941 iglv NSES01017017.1 41218 SWAQSVLTQPPSVSGALGQTVTISCSGSTTSFDIIGVKWYKQLPGNPPKLLIYGNNKRPSGIPDRFSGSKSGSSGSLTVTGLQAEDEADYYCQSVDFSFS
Enhydra lutris kenyoni V979 iglv NSES01019585.1 79829 SLASYVLTQPPSVSVALGQTAQVTCGGKNIGNKNVYWYQQKSGQSPVLIIYFSSSRPSGIPERFSGTNSGNTATLTISGAQAEDEADYYCQSYDSSGN
Enhydra lutris kenyoni V980 iglv NSES01019585.1 32160 SVAAYVLTQPPTMSVNLGQTASITCSGDNIGNTYVSWHQQKPGQAPVTIIYSDSNRPSGIPDRFSGSNSGNMATLTISGAQAEDEADYYCASYDNSRNT
Enhydra lutris kenyoni V981 iglv NSES01019585.1 3809 SMASNVLTQPSSVSVSLGQMATVTCSGEILSKEYTQWYLKKPGQSPKLVIYKDTDHPSGILDQFSGSSSGNTHTLTISGAQAEDEADYYCQSFDRSAD
Enhydra lutris kenyoni V982 iglv NSES01019587.1 33143 SMASSVLTQPHSVSVSLGQTATITCSGEILSEKYAYWYQQKPGQPPVQVIYKDTERPSGIPDRFSGSSSGTTHTLTINGAQAEDEADYYCQSSESSGE
Enhydra lutris kenyoni V983 iglv NSES01019589.1 12185 SMVSSEVTQPPFLSVALGEMATITCTREELEDGYAHWYQQKPGQAPLMVIYGDSEWPSGIPERFSGSKSGNTATLTITGTQAEDEADYYCQSYDGHTD
Enhydra lutris kenyoni V984 iglv NSES01019590.1 36048 SVASYVLTQPPSVSVALGQTAQVTCGGNNIGNKYVYWYQQKPGRAPVLTIYDSNKRPSGIPERFSGTNSGSTATLIISGARAEDEADYYCQVLDRGSD
Enhydra lutris kenyoni V985 iglv NSES01019592.1 13049 CWAQSTLTQPPSLSGALGNTVTISCTGSSSNIGSNPYISWYQQASGTSPKLLIYRVGSRPSGIPDRFSGLKTGNTAILTISGLQAEDEGDYYCTSIASSDV
Enhydra lutris kenyoni V986 iglv NSES01019594.1 8612 SWAQSSLTQPSSVSGALGQTVTISCVGTSNDIGRYNYVSWYQQLPGMSPKLLIYDVSYRPSGIPDRFSGSKSGNTASLTISRLQAEDEAHYYCTSFRSDKT
Enhydra lutris kenyoni V987 iglv NSES01019596.1 7784 SWAQSSLTQPSSVSGALGQTVTISCVGTSNDIGRYNYVSWYQQLPGMSPKLLIYDVSYWPSGIPDCLSGSKSGNTASLTISRLQAEDEAHYYCTSFRSD
Enhydra lutris kenyoni V988 iglv NSES01019597.1 158474 ISSEAVVTQEPSLTVFLGETVTLTCASSYGAVSDGQYTYWFQQKPGQPPRTLIYDTHNKPSWTPARFSGSLLGGKAVLTLTGAQPEDEAEYHCFLQYGDG
Enhydra lutris kenyoni V989 ighv NSES01019655.1 5715 VQCEVQLVESRGDLVKPGGSLRLSCAASGFTFSSYAMHWVRQASGKGLQWVASISYDGSSTYYANSVKGQFTISRDNGKNTLYLQMNSLSAEDTALYYCEK
Enhydra lutris kenyoni V990 igkv NSES01019930.1 134118 SSGVIVLTQTPLSLSVTPGELASISCRDSQSLVHDNGNTYLHWFRQKPGQSPQLLIYKVSNHFTGVPDRFSGSGSGTDFTLTISRVGADDVGVYYCQQSIQYP
Enhydra lutris kenyoni V991 igkv NSES01019930.1 122265 SHGENVLTQSPAILSMAPKEGVTITCRASENFNKRLAWYQQEPGRALKLLICAASKLETGVPSWFSGSGSGTNFTITTSSLEPEDAGTYYCLHSKSYL
Enhydra lutris kenyoni V992 igkv NSES01019930.1 71868 SSRDIVLTQTPLSLSVAPGESASISCRASQSLLHRDGNTYLYWYLEKPGYSPQLLIYEVSIHKSGVPDKFSGSGSGTDFILRISRVEDDDVGVYYCEQG
Enhydra lutris kenyoni V993 igkv NSES01019930.1 66561 SNGEVVMTQTPLLLPVTPGEPASISCKASQSLVHSNGNTYLHWYLQKSGQSPQLLIYEVSKHFTGVPDRFSGSGSGTDFTLRISRVEADDVGVYYCEQG
Enhydra lutris kenyoni V994 igkv NSES01019930.1 29444 PNGEVVMTQTPPLLSITPGELASISCRASQSLVHSNGNTYLSWYLQKPGQSPQLLIYKVSSHFTGVPDRFNGSGSGTDFTLTISRVEADDVGVYYCQQGIQYP
Enhydra lutris kenyoni V995 igkv NSES01019930.1 9899 SHGKIVLTQSPAILFMPPKEVVTITCWASQNINKWLAWYQQKPGRAPKLLIYEASKLETGVPSEFSGSGSVTDFTLTISSLEPEDAWTYYCLQSNSY
Enhydra lutris kenyoni V1000 ighv NSES01020261.1 94182 VQCEVQLVESGGDLVKTGGSLRLSCAAYGFTFSSYGMSWVRQAPGKGLQWVASISYDGSNTYYADSVKGRFTISRDNGKNQLYLQMNSLRTEDTAVYFCAK
Enhydra lutris kenyoni V1001 ighv NSES01020261.1 53962 VQCEVQLVESGGDLMKPGKSLRLSCAASGFTFSSYNMYWVRQAPGKGLQWVAWIKYDGSSKSYADYVKGKFTISRDNSKNTLYLQMNSLRAEDTAVYYCVK
Enhydra lutris kenyoni V1002 ighv NSES01020261.1 37006 IQCEVQLVESGGDLVKAGGSLRLSCAASGFTFSNYYVYWVCQPPGKGLQWVASISSGGGTTYYADSVKGQFTISRDNSKNTLYLQINSLRAEDTALYYCVK
Enhydra lutris kenyoni V1003 ighv NSES01020261.1 8635 VYSQVHLLQSGAEVRNPGASVKVSCKASGYTFTDYYMHWVRQPPEQGLEWMGRIDPEDGATNIAQKFQARLTLMADTSTSTAYMELRSLRSEDTAVYYCA
Enhydra lutris kenyoni V1004 ighv NSES01020261.1 865 AVGGVCGRSGEAWGSLRLSCAASGFTFSSYYMSWVRQVPGKGLHWVASISNDGSSTYYADPVKGRFTISRDKGKNTLYLQMNSLRAQGTAVYYCAT
Enhydra lutris kenyoni V1005 ighv NSES01020262.1 385 VQCEVQLVESGGDLVKPGGSLRLSCVGSGFTFSSYGMSWVRQTPGKGLQWVAVISSDGSSTSYADSVKGRFTISRENGKNTLYLQMNSLRAEDTAVYYCAI
Enhydra lutris kenyoni V1006 ighv NSES01020806.1 33685 VQCEVQLVESGGDLVKPGGSLRLSCAASGFTFSNYDMSWVRQAPGKGLQWVASISYDGSNTYYADSVKGRFTISRDNGKNTLYLQMNSLRTEDTAVYFCST
Enhydra lutris kenyoni V1007 ighv NSES01020806.1 22037 QLVQSEAEVRKLGESVKVSCKASGYTFTSYTMNWVQRVPGKSLQYMGWINMKTGNPTYAQGFSSRFVFSMDTSVSTAYLQISSLNSEDTAVYYCARDAM
Enhydra lutris kenyoni V1008 igkv NSES01021012.1 22406 SLTMSPASLTMSPGQKATISCKASQKVGDILGITHYITWYQQKSGQHPRMLIYKASSQASGVPARFSGSGSGTEFSLMIDPVEEGNAACYYCKQSKE
Enhydra lutris kenyoni V1009 igkv NSES01021087.1 6417 AHGDITMTQSPGSLAVSPGQRVTMNCRTSQGVYSNVAWYQQKPGQAPRLLIYYASSRATGIPERFSGSGSGTDFTLTISNLQAEDVGHYYCQQYNNY
Enhydra lutris kenyoni V1010 ighv NSES01021763.1 576 IKCEVQLVESGGDLVKTGGSLRLSCAASGFTFSNYGMSWVRQAPGTGPERVAVIWYDGSKTYSADSVKGRFTKSRDNSKNMLYLQMNSLRAEDTAVYYCAK
Enhydra lutris kenyoni V1011 igkv NSES01021962.1 3442 VHGDITMTQSPGSLAVSPGQRVTMNCRASQSVSNYVAWYQQKPGQAPRLLIYYASNRATGIPDRFSGSGSGTDFTLSISNLQAEDVGSYYCQQYDSSP
Enhydra lutris kenyoni V1012 ighv NSES01022077.1 3369 VQCEVQLVESGGDLVKPGGSLRLSCAAFGFTFSSSYMNWVCQAPGNGLQWIADISGDGSSTSYADSVEGRFTISRDNSKDTLYLQMNSLRAEDTAVYYCAT
Enhydra lutris kenyoni V1013 ighv NSES01022549.1 4453 AQCEMQLVESGGDLVKPGGSLRLSCAASGFSFSGYGMSWVCQAPGKGLELVSNIDAGGGSTSYTDSVKGRFTISRDNAKNTLYLQMNSLRTEDTAVYFCAK
Enhydra lutris kenyoni V1014 ighv NSES01022772.1 2390 VLSQLTLQESGPGLVKPSQTLSLTCAVSRGSVTSSYYWNWIRQCPGRALEWMGYWTGSTSYNPAFQGLISITADTSKHHFSLQLCSVTTEDTAMYYCTR
Enhydra lutris kenyoni V1015 igkv NSES01023133.1 4165 SHGEIVLTQSPAVLSRALKERVTITCQASQNINKWLAWYQQEPRRTPKLLIYEASKLETGVPSRFSGSGSGTDFTLTISSLEPEDARTYYCLQYNSYP
Enhydra lutris kenyoni V1017 ighv NSES01023860.1 1178 VQCEVQLVEPGGELVKPGGIPETLCAASRFTFSSYFMNWVRQTPGKGLQWVADISNHGSSTSYTDFVKGRFTIPRENGKNTLYLQMNSLRAEDTAVYYCAR
Enhydra lutris kenyoni V1018 igkv NSES01025395.1 553 AHGDITMTQSPGSLAVSPGQRVTMNCRASQSVSNDIAWYQQKPGQSPRLLIYGASNRAMGIPDRFSGSGSGTDFTLSISNLQAEDVGHYYCQQYGSY
Enhydra lutris kenyoni V1019 ighv NSES01025423.1 535 VECEVQLVESGGDLVKTGGSLRLSCAASGFTFSNYDMSWVHQAPGKGLQWVAVIWYDGSKTYYADSVKGRFTISRDNGKNMLYLQMNSLRAEDTAVYYCAT
Enhydra lutris kenyoni V1020 igkv NSES01025669.1 1862 AHGDITMTQSPGSLAVSPGQRVTMNCRASQSVSNYVAWYQQKPGQAPRLLIYDASSRAPGIPDRFSGSGSGTDFTLTISNLQAEDVGSYYCQQLYSF
Enhydra lutris kenyoni V1022 igkv NSES01025885.1 507 SRGDIVLTQTPLSLSVTPGEPASISCRASQSPVHSNGNTYLSWFRQKSGQSPQLLIYKISNRFTGVPDRFSGSGSGTDFTLRISRVEADDVGVYYCGQLSKIP