WGS Statistics
Organism WGS Record. Vs Total IGHV IGLV IGKV TRAV TRBV TRGV TRDV
Eschrichtius robustus NIPP00000000.1 (NIPP01) 65 5 10 5 22 15 4 4
Vgene Table
Organism Vgene Locus contig Contig Pos. AA sequence
Eschrichtius robustus V37 trav NIPP01000168.1 95918 AHTQVVQVNDSMYGFIGTDVVLHCSFANPLPGVKITQVTWQKATNGSKQNVAIYNPAMGVSVLAPYRERVEFLRPSFTDGTIRLSRLELEDEGVYICEF
Eschrichtius robustus V58 trav NIPP01000428.1 1441 GTNGDSVTQTEGPVTVTEGAPRTLHCTYQTSDSAPYLFWYVQYLNKAPQLLLKGSKANQRAEHQGFQATLVTSDSSFHLQKPSVQTSDSAVYYCALS
Eschrichtius robustus V59 trav NIPP01000428.1 11415 LRGEDQVDQSPQTLKIREGGSLTLNCSYTVSNFRGLLWYRQDPGTGPELLFLLHSVGDEKQKERLKATLLKKGSSLHIAAPEPEDSATYLCAVE
Eschrichtius robustus V60 trav NIPP01000428.1 23844 GTGAQSVAQPDGRITVSEGAPLELRCNYSSSVQPTLFWYVQYPNQGLQLLLKYTSGNNLVTGIKGFEAEFRRGETSFHLRKTSAHLKDSAKYFCALS
Eschrichtius robustus V61 trdv NIPP01000428.1 42731 FGATQKVTQAQPAISSQLGKAVTLNCQYETSWRQYYIFWYKQLPSGEMTFLIDQSSSGQNAKKGRYSVNLQARRKLISLTISALLMEDSANYFCALWE
Eschrichtius robustus V62 trav NIPP01000428.1 53314 GTGAQLVTQPDGLITVSEGAPLELRCNYSSSVPPYLFWYVQYPNQGLQLLLEYTSRNSLVSGIKGFEAEFRKSETSFHLRKTSAHWKDSAKYFCALS
Eschrichtius robustus V63 trav NIPP01000428.1 71059 GMSGQQLNQSPRFMSIQEGEDVSMNCNSSSTLNLLLWYKQDAGGGPILLISLYKGGESTRNGKLTAQFSGTRKDSFLNISASEPKDAGTYFCAG
Eschrichtius robustus V64 trav NIPP01000428.1 85964 ASSDDKVIQSPPSLVVHEGTRATLNCSYEVTNFQSLHWYKQEEKVFTFLFILISAGIEKRSGRLRGTLDRKELLSTLHITATKPGDSATYLCAVE
Eschrichtius robustus V65 trav NIPP01000428.1 90718 PGRADWIRPQETEVSGTEGKTVSLLCNYYTSSTSFVDLYWYRQYPNQAPEYILYRGWGYSAKGYASFATERFYSENTANTTNLYIKRVLHADTALYHCALR
Eschrichtius robustus V66 trav NIPP01000428.1 119307 SSVAQMVTQPQPEVSVQEADTVTLDCTYSTSESGYYLLWYKQPPSREMIFIILQEAYKQQNATNSRYSVNFQKEAKSFSLRISDSQLEDAAMYFCAYRG
Eschrichtius robustus V67 trav NIPP01000428.1 123024 SSVAQMVTQPQPEVSVQEADTVTLDCTYSTSESGYYLLWYKQPPSREMIFIILQEAYKQQNATNSRYSVNFQKEAKSFSLRISDSQLEDAAMYFCAYRG
Eschrichtius robustus V68 trav NIPP01000428.1 186309 VSGKNGVQQGPRYLSALEGDFVTINCSYSGEMTTLQWLQQNPGGSVVSLFILSLEMKKKGRVSATINRKERHSSLHITASQPRDSATYFCAVE
Eschrichtius robustus V69 trdv NIPP01000428.1 285644 VYLDVILEPETKTLTVLLGEPATFRCSITGGDLKNYQMSWYKKNENNSLTLVYRLSNNSNENERSNFKGKIDALKSQYILDIQKTTVQDVGTYYCGSD
Eschrichtius robustus V70 trdv NIPP01000428.1 311540 VMSAAVLVPQDQARSVSVGEPVTLRCSMKGESISNYYTFWYRKTPGNTMTFIYREGGTYGPGFEDNFRGKIDSLNNQAVLNILEASERDEGSYYCAS
Eschrichtius robustus V116 igkv NIPP01000909.1 6168 TTGEATLTQSPASLSLSPGESATLTCRASQSVSKYLAWYQQEPGQAPRLLIYDATTRASGIPARFSGSGSGTDFTLTISSLEPEDVAVYYCYQYYSGY
Eschrichtius robustus V130 igkv NIPP01001107.1 363266 SNGDIVLTQTPLSLSVIPGDPASISCRPSQSLLHSDGYTYLSWYLQNPGRSPQLLIYGTSNRASGVPEWFTGSGSGTDFTLKISTVEAEDTAIYYCQQIIQRP
Eschrichtius robustus V131 igkv NIPP01001107.1 377467 SNGDIVLTQTPLSLSAIPGDPASISCRSSQSLLDSDGDTYLSWYLQKPGQSPQLLIYEVSNRASGVPDRFTGSGSGTDFTLKISRVEAEDVGVYYCQQAMEDP
Eschrichtius robustus V135 trbv NIPP01001265.1 293006 ASADKGITQIPKYLVMETRSKKSLRCEQHLGHNSMYWYKQSAQKPLELMFVYNYKELASNETVPSRFWPECPDSSHLYLHVDTLKLEDSALYLCASSK
Eschrichtius robustus V136 trbv NIPP01001265.1 312741 PGNAGVTQDPKFQVLRTGQSVTLKCAQDLDHYYMYWYRQDLGHGLRLIHYSSATGTTNKGDVPDGYSVSRSSLEDFPLTLASATPSQTSVYLCASSY
Eschrichtius robustus V137 trbv NIPP01001265.1 316998 PVDAAVTQKPRYHIIRAGNKMVLECSQHMNHLGMFWYRQDPGQGPRLIHYSNGVGSTGEGDVTEGYNVSRNKNEHFPLTLESASTNQTSLYLCASSE
Eschrichtius robustus V138 trbv NIPP01001265.1 337824 LSITGPVEAGITQEPRYKITVTGETVTLECHQTDNHDYMYWYRQDLGHGLRLIHYSYGAGNIEKGEIPDGYNVSRSNTEDFPLTLESVIPSQTSVYFCASSD
Eschrichtius robustus V139 trbv NIPP01001265.1 350047 PTDAGVTQTPRHEVTEMGHAVTLSCEPISDHIVLYWYRQTLVQGLEFLIYFLNQVPMDESGMPKDRFSAKMPNASFSTLKIQPTEPGDSATYLCASSK
Eschrichtius robustus V140 trbv NIPP01001265.1 354251 HVGAMVIQNPGYLVTRMGKPVTLSCSQNLNHEVMFWYQQKLSPAPSLLFYYYDKEFNNEKDTSDNLQSSRPNTSFCSLGIRSAGLGDSAMYLCASSR
Eschrichtius robustus V141 trbv NIPP01001265.1 358765 FLEADVSQTPGHLVQGKGRKVKMYCVPRKGDVYVSWYRQILAKEFKFLISFQNDKALDETEMPKERFSAECPPNSPCSLEIQPAELQDSAVYLCASSD
Eschrichtius robustus V203 trbv NIPP01003684.1 34551 VRAQTIRQWPLIRVQPAGSPLSLVCTVKGASSPNLYWYRQAAGGTLQLLFYSVGVGQIDSEEPQNFEASRPQDDLFILSSKKLLLSDPGFYLCAWS
Eschrichtius robustus V270 iglv NIPP01009233.1 7469 SWAQSALTQPPSVSGNLGQTVTISCAGTSSDVGGYNQVGWYQQHPGMAPKTLIYEVNKRPSGIPDHFSGSKCGNTASLTISVLQAEDKADYYCSSGTSS
Eschrichtius robustus V271 iglv NIPP01009233.1 18534 SWAQSGLTQPPSVSGNLGQTVTISCAGTSSDIGKYNAVGWYQQLPGMAPKTLIYDVNKRPSGIPDRFSGSKSGNTASLTISGLQAEDEADYYCGSARSGST
Eschrichtius robustus V272 iglv NIPP01009233.1 41837 SVASYELTQPPSVSVALGQTSKITCSGDLLDEKYTSWHQQKPGQAPVLVIYQDSKRPSGIPDQFSGSSSGKIATLTISGARAEDEADYYCGSADSSGY
Eschrichtius robustus V273 iglv NIPP01009233.1 48817 SVASSELTQPPAVSVSLGQMARITCQGDSLGSYYVSWYQQKPGQAPVLVIYDGSNQPTGIPDRFSGSSSGNTATLTISGARAEDEADYYCGSADSSDY
Eschrichtius robustus V288 trav NIPP01010630.1 56931 TLSLAKTIQPIFIDSYEGQEVNISCNHTNIATEDYIFWYRQFPNQGPQFVIQGYKTNIANEVASLFIPTERKSSTLSLPCAALKDAAVYYCVVS
Eschrichtius robustus V289 trav NIPP01010630.1 63650 GTGAQLVAQPDGLITVSEGARLELRCNYSSSVSPYLFWYVQYPNQELQLLLKYTSGNSLVSGIKGFKAEFRRSETSFHLEKQSALWSDSAKYFCALG
Eschrichtius robustus V290 trav NIPP01010630.1 72255 VSLGEKVEQSPSTLTVQEGNSSVITCTYTDTALDYFLWYKKEPGKGPQLLIDIRSNTSKKESQRWSVLLNDKAKRLSLHISDTQPGDSAVYFCATS
Eschrichtius robustus V291 trav NIPP01010630.1 79867 PSIAQKVTQNQPVILVQEKEVVTLDCIYDTSDFSYSLFWYKQPSSGAMILLIRQDTYNQQNATEGRYSLNFQKANKSIKLAISASQLEDSAVYFCALSE
Eschrichtius robustus V297 iglv NIPP01012065.1 58775 SWAQSGLTQPPSVSGNPGQTVTISCAGTSSDIGKYNYVSWYQQHPGMAPKMLIYDVNKRPSGIPDRFSGSKSGNTASLTISGLQAEDEADYYCSSYTSS
Eschrichtius robustus V298 iglv NIPP01012065.1 64057 SWAQSGLTQPPSVSGNLGQTVTISCAGTSSDIGGYNYVSWYQQHPGTAPKTLIYEVNKRPSGIPDRFSGSKSGNTASLTISGLQAEDEADYYCSSGTSS
Eschrichtius robustus V311 ighv NIPP01015724.1 40872 VLSRMQLQVSGPSLVKPSQTLSLTCTVSGFSLTCYGVHWACQSLGKGLEWVGVMWYSGSTYYNPTLKSRLSITRDTSKSQVYLSLNSLTTEDTALYYCAR
Eschrichtius robustus V323 igkv NIPP01019383.1 14645 CWGQITLTQSPETLAASQGSFVSITCKSSMEVGTSMAWYQQKPKEAPRLLIFGASARASGTPSRFQGSGSGFDFSLAIHGVQAEDVGVYYCQ
Eschrichtius robustus V327 ighv NIPP01021148.1 4007 VLSEVQLQQWGPGLLKPSQTLTLPCAVYGSSITSGYYCWNWIRQPTGKGLEWMGNICNDGTTYYSPSLKSRISISRDTSKNQFSLQLSSVTTEDTAVYYCAR
Eschrichtius robustus V331 trav NIPP01024630.1 4703 QTREDSVTQMDGQMTLPEGAALTINCTYSATGYPITFWYVQYPGEGPQVLLKAMKDNEKGTNKEFEATYHRESKSFHLEKASVQDSDSAVYYCVLS
Eschrichtius robustus V332 trav NIPP01024667.1 6549 MRSQQKGVEQSPASLHVPEGAIASLNCTYTDSTSDYFSWYRQYPSKGPELLLYGSLNKDKEEGRYTAQVNKAKQFVSLLMRDSQPSDSATYLCAV
Eschrichtius robustus V337 trav NIPP01028798.1 2042 VSGKNQVEQNPPSLMVLEGQNCTFQCNYTVSPFGNLRWYKQDTGRGLVSLIIMSHSDSKKLNGRYTATLDASAKHSSLHITAAQLSDPAFYLCAVG
Eschrichtius robustus V422 trdv NIPP01000428.1 397085 KDVLCNQVTQISQEQTVASGSEVTLQCIFQTAHSDPDLYWYQIRPDRSFQFVLYRDNTTSYDADFARGRFSVQYSLTHKTFHLVISSVRTEDSATYYCALR
Eschrichtius robustus V508 trgv NIPP01002092.1 27637 HLEQPQLSSTKKLSKTARLECVVSGVTISKMSVYWYQERPGQAMQHLLHILSNNTVKRESDVTLGKFEADKIPETSTSTLTIHNVREQDAAIYYCALWE
Eschrichtius robustus V509 trgv NIPP01002092.1 9973 GLGQLKWEQPEISVTGARDKSAVISCKVSSADFSQEYIHWYRHKPDQSIEHLASLVTGPALNHLGGKKNKIEARKDVPTSTSTLKISFLEKEDEATYYCASWFK
Eschrichtius robustus V510 trgv NIPP01002092.1 6010 TSGDIQITQRITSITKTKGNTASLECQIKTDMLKKSVYIHWYRQKPEQPLNRILYISSNENFVHEQGISEERYEARKWPSNSLLSLRIHGATEEDAALYYCACWD
Eschrichtius robustus V512 trgv NIPP01002150.1 248515 TQVSSNLKGDKMSVTSKIGETASLTCELTQDANYIHWYKHQKGTAPRRLLYYDVYYSKTKFDSGINEAKYRVYKVTGRSYTFAILTLEDSDSGMYYCAVWE
Eschrichtius robustus V546 trbv NIPP01003684.1 176381 TVDGGVTQTPKYLFKVEGRDVTLKCEQDFDYDVMYWYRQDPGQGLRLIYYSQTVKDVRKGDIAEGYSASREKKSLFPLTLTSTQKNQTALYLCAANI
Eschrichtius robustus V547 trbv NIPP01003684.1 170831 GSGLSALVSQHPSRAICKSGASVTIQCRSLDFQASSVLWYHQFPKQGLVLIATSNKGSDATYEQGYTKAKYPISHPSFTFSSLMVTNVHPADSSLYFCGAR
Eschrichtius robustus V548 trbv NIPP01003684.1 149564 CMDTEVTQSPGHLVKGKEQKAKMHCVPRKGHTRVYWYRKKLEEGFEFLVYLQNENIVDDTDVFKQRFSAHCPRNSPCSLEVKSTEAGDSALYFCASSQ
Eschrichtius robustus V549 trbv NIPP01003684.1 136097 PMDAEIYQMRFLLAEAGRDVTLECKQDLSYNAMYWYRQDAGQGLRLIYYSTVEKVVQRGDISEGYSVSREEKGLFPLTVKAAHTNQTALYLCAGS
Eschrichtius robustus V550 trbv NIPP01003684.1 127108 SMDADITQTPRNRIANTGKNTVLECSQTKGHESMYWYRQDPGLGLRLIYYSHGVNDINKGDVSDGYNVSRKEQAKFSLFLEPATPNQTALYFCASSI
Eschrichtius robustus V551 trbv NIPP01003684.1 108806 LKDAVVTQFPRHRVSKTGKELTLQCSQNMSHNSVYWYRQDPGFGLRLIYYSTSTRITEKGDVPEGYRVSRDELEYFPLTLESASTNQTSVYLCASSE
Eschrichtius robustus V552 trbv NIPP01003684.1 92418 PLEADVTQSPRHQITETRKRVTLTCSQNMNHDAMYWYRQDPGLGLKLIYFSRNVEFVEKGDVPDGYIVSRKKKPDFPLTLASASTNQTSLYLCASSL
Eschrichtius robustus V648 iglv NIPP01014752.1 47981 VVLTQPRSVLGSLEQKVTISCTRSSGNVGSYYVHWYQQRPGSAPTTVIYKDDQRPSGVPNRFSGSIDTSSSAAYLTISGLQPEDEANYYCQSGCDSNK
Eschrichtius robustus V649 iglv NIPP01014752.1 36755 SWAQSGLTQEGSVSGSVGQEVTLSCTGNGNNVGANTVNWYQQISHGAPKTAMLTGSLPSGIPDRFSGSTSVNTASLTISGLQPEDKADYYCSTWDDSISG
Eschrichtius robustus V650 iglv NIPP01014752.1 21713 FLSQPVPTQPPSLSTSPGASARFTCTLSSGYSVGGYHIFWYQQKPGSSPRYLLRFRSDSDKHQGSGVPSRFSGSKGASANAGLLLIAGLQPEDEADYYCAT
Eschrichtius robustus V663 trav NIPP01019759.1 24373 GTGAQLVAQPDGHITVSEGARLELRCNYSSSLSTYLFWYVQYPNQGLQLLLKYTSGNSLVSGIKGFEAEFRRSETSFYLRKPSAHWSDSAEYFCALS
Eschrichtius robustus V664 trav NIPP01019759.1 10317 GTRAQTVTQPEDHISVFEGSPVQVKCNYSYSGSPELFWYVQYPKQHLQLLLKHTSRESIRGFTADLNKGEASFHLKKPSAQEEYSAVYYCALR
Eschrichtius robustus V665 trav NIPP01019759.1 5296 VNSQQGEENLQALSIQEGENATMNCSYKTTIDTLHWYRQDSRRGFAHLILIRSNEREKRSGRLRVTLDNSIKSSSLSITASQAADTATYFCATE
Eschrichtius robustus V667 ighv NIPP01020895.1 9457 FLSQMQLQKSGRGLVNPQQTLSLPCAVSGFSITTSSYYWSWVRQPPGKGQEWMQDIEYDGSTYYSPSLKSCTPISRDTSKNQFSLQLSSVTTEDTAMYYCAR
Eschrichtius robustus V668 ighv NIPP01020895.1 7513 VLSQMLVQVSGPGLLKTLSLTCSVSGFSITNSADCWDWIHHPPGKGLGHLRCIESVQSTVYILSLQKLHSISRDTSENQFSLQISSVISEDTAMYYCT
Eschrichtius robustus V670 ighv NIPP01022268.1 5568 VLSQVHLQDSGPSLVKPSQTLSLICTVSGFSITSYAVTWVRQPPGKGLEWVGWINTGGSTYYNPTLKSRLSITRDTSKSQVYLSLSSLTTEDTAVYYCAG
Eschrichtius robustus V672 igkv NIPP01022761.1 4577 SSGDIVMTQTPLSLSVVPGETASISCKSSQSLVHSDGNTYLNWFQHKPGQSPQRLIYKVSNRDSGVSDRFSGSGSGTDFTLKISRVEAEDAGVYYCCQG
Eschrichtius robustus V675 iglv NIPP01023596.1 5696 SWAQSALTQPPSVSGNPGQTITISCAGTSSDIGKYNYVGWYQQRPGTAPKTLIYQVNKRPSGIPDRFSGSKSGNTASLTISGLQAEDEADYYCSSGTSS
Eschrichtius robustus V680 trav NIPP01025648.1 2353 MRSQQKGVEQSPASLHIPEGAIASLNCTYTDSASQYFMWYRQYPSKGPELLLDGYMNNDKEEGRYTAQVNKAKQYVSLLIRDSQPSDSATYLCAV