WGS Statistics
Organism WGS Record. Vs Total IGHV IGLV IGKV TRAV TRBV TRGV TRDV
Meriones unguiculatus NHTI00000000.1 (NHTI01) 269 48 8 103 70 24 8 8
Vgene Table
Organism Vgene Locus contig Contig Pos. AA sequence
Meriones unguiculatus V593 ighv NHTI01049614.1 1255 VQCDVQLVESGGGLVQPGKSLKLSCAASGFTFSNYYMYWVRQAPGKGLEWVSWIRYDGGSTAYADAVKGRFTISRDNAKNTLYLQMNSLRSEDTATYYCAR
Meriones unguiculatus V594 trav NHTI01050831.1 862 KTHGDSVTQTEGQVVLSENEFLTIHCNYSASGYPALFWYVQYPGEGPQLLFRASKANDKGSSRGFEATYDKETKSFHLQKASVQVSDSAVYYCALG
Meriones unguiculatus V595 trav NHTI01051368.1 983 MSQGEQIEQHPSILRVQEGARAVINCTYTDSASVYFPWYKQEPEKGPQYIMDIRGNVDRKQNQRLTVLLDKKAKHFSLHITDTQPGDSAMYFCAAS
Meriones unguiculatus V596 trav NHTI01052165.1 968 SSNGDSVTQTEGLVTLTEGMPVMLNCTYQTISSGPSLFWYVQYLNKAPQILLRSSTDNKRTEHRGFHATLHKSSSSFHLQMSSVQLSDSALYYCAVR
Meriones unguiculatus V597 trav NHTI01054580.1 189 RTHGDSVTQTGGQVTISEGKFLTINCTYSTTSIAYALLSWYVRYPGEGPQLLLKVITAGEKGSSRGFEATYDRGTTSFHLQKASVQESDSAVYYCALG
Meriones unguiculatus V598 trav NHTI01056240.1 568 ESLGEQVEQHPSSLSVHEGGSAVINCTYTDSASFYFPWYKQEAGKGPHLGIDIRGNVDRKQNQRLTILLDKKAKCFSLHITDTQPRDSAMYFCAA
Meriones unguiculatus V599 trdv NHTI01062657.1 71 FNVAQKVTQVQSTTSSHYGEEVTLDCSYETSQNLYRLFWYKQLVTGEMIFLIRQLSSSTQNERNGRYSVTMKKSAKSFSLVISASQLEDSGTYFCALWEV
Meriones unguiculatus V601 trav NHTI01065442.1 513 DTSAQSVTQPDAQVTVSEDASLQIRCNYSSSVPPSLFWYVQYPRQGLQLLLSYYSGDPVVHGMNGFEAEFSKSDSSFILRKARVHWSDSAVYFCAL
Meriones unguiculatus V602 trav NHTI01066932.1 53 GVRGAEVEQSPSVLSLQEGTSSALRCNFSTTMRGMQWFRQNPQGSLISLLYVAAGTKENGRLKSTFHSKESYSALHIRDTQLEDSGTYLCAAE
Meriones unguiculatus V785 trgv NHTI01000537.1 798581 GLGQLEQTEMSVTGLTDKSAQIPCKVSLPDFGNAYIHWYRQKTNQELEYLLYVKNNYHQLSLEGKKKKIEAGKDFVTSTSTLKVNFLKKEDEATYYCAAWIL
Meriones unguiculatus V786 trgv NHTI01000537.1 794307 GLRQLEQTEMSVTGLTDKSGQIPCKVSLPDFGNAYIHWYRQKTNQELEYLLYFKTSYHQLFLDGKNKKIEAGKDFLTSTSTLKVNFLKKEDEATYYCAAWIL
Meriones unguiculatus V837 trav NHTI01000946.1 41220 ASGQGVEQPATLMSVEGSFVEINCTYSTSGFNGLSWYQQREGRAPVFLSYAVLDGLKDSGPFSTFLRRSDGYSYLLLTELQIKDTASYLCAVR
Meriones unguiculatus V908 trgv NHTI01001868.1 63330 RQTSSSLEARIKSITKTRGSTAKITCDTHTADKYIHWYRFQKGSAPQHLLYYSLSTSATVVDARFDSKKYHVYEGTDNSYTFVLLNLEESDSALYYCATWT
Meriones unguiculatus V909 trgv NHTI01001868.1 53390 GLGKLEQPEVSVSRAKDESAQISCKVSINSFKSVAIHWYRQKPNQGLEFLLYVIATPTHILINEKFKKMEARKNTSASISTLTIYSLEEEDEAIYYCSYG
Meriones unguiculatus V910 trgv NHTI01001868.1 49473 GSIPTSRLEMYVTKKKGNTAFLRCQIKTGVLNHNTYIHWYQEKPGQPLKRMLYISSKENIVYEKGFSEERYEVKKWQSDLSSILRIHYVTEEDTGTYYCACWG
Meriones unguiculatus V911 trgv NHTI01001868.1 47093 GDSWISQDQLSFTRKPNKTVHISCKLSGVPFQNTIVHWYQLKEGEPLKRIFYGSSKTYKQDNPHSRFETDEKSDGTFYLIINNVIKSDEAMYYCACWD
Meriones unguiculatus V924 igkv NHTI01002016.1 283815 AEGNIVMTQSPKVMSTSVGDRITLSCKSSQSVGSYVNWYQQTPGQPPKLLIYYASNRYTGVPDCFTGSGSGTDFTLSISSVQAEDLAVYYCLQYDSYP
Meriones unguiculatus V932 ighv NHTI01002284.1 25273 VQCDVHLVESGGGLVQPGKSLKLSCAASGFTFSDYVMRWVRQAPGKGLEWVTSISESGSKVYYADAVKGRFTISRDNAKNTLYLQMNSLRSEDTATYYCA
Meriones unguiculatus V944 igkv NHTI01002819.1 208861 AEGNIVMTQTPEFMSTSVGERITLSCKSSQSVSGWVAWYQQKPGQPPKLLIYGASNRYTGVPDRFSGSGSGTDYTLSISSVQAEDLAVYYCQQGYSYP
Meriones unguiculatus V945 igkv NHTI01002819.1 194248 TEGDIVMTQSPEIMSTSVGDRITLNCKSSQNVGSSVHWYQQKQGQPPKLLISYASDRYTGVPDRFTGSGYGTDFTLSISTVQAEDLAYYYCQQSNSYP
Meriones unguiculatus V949 iglv NHTI01002976.1 115992 SWGQFSLTQPNSVSGSLGSTVSLSCKHSSGNIGSYYVHWYQQHEGRSPTNVIYNDNKRPSGIPDRFSGSIDSSSNSASLTISNVQPEDEAVYYCLSSESGY
Meriones unguiculatus V950 iglv NHTI01002976.1 113696 SCGQLVLTQPKTVSGSPGSKVTISCQRSSGNIGDYYVQWYQQHEGRSPTNVIYKYNKRPSGIPDRFSGSTDSSSNSAFLTISNLQAEDEADYYCQSGESDY
Meriones unguiculatus V951 iglv NHTI01002976.1 22925 SWGQFQLTQPNSVSGSLGSTVSLSCKRSSGNIGDYYVQWYQQHEGRSPTTVIYGDDQRPSGIPDRFSGSIDRSSNSATLTIGNLQTEDEADYFCQSSGGGN
Meriones unguiculatus V964 igkv NHTI01003893.1 147692 AEGNIVMTQSPKVMSTSVGDRITLGCKSSQNVYNNVAWYQQKPGQPLKLLIYYASNRPSGVPDRFTGSGSGTDYTLSISSVQAEDLAVYYCQQYYDYP
Meriones unguiculatus V965 igkv NHTI01003893.1 115976 AEGNIVMTQFPEYMSTSVGDRITLNCKSSQNVYKYAAWYQQKPGQPPKPLIYYASNRHAGVPDRFTGSGSGTDFTFSISSVQAEDLAVYYCQQHSNYP
Meriones unguiculatus V966 igkv NHTI01003893.1 84625 AEGNIVMTQSPKVMSTSVGDRITLSCKASQNVYNYVNWYQQKSGQPPKLLIYRASNRYTGVPDRFTGSGSGTDFTLSISSVQAEDLADYYCQQSSSYP
Meriones unguiculatus V967 igkv NHTI01003893.1 71603 AEGDIVMTQSPEIMSTSVGDRITLNCKSSQNVGSSVHWYQQKPGQPPKLLISYASDRYTGVPDRFTGSGSGTDFTLSISSVQAEDLADYYCQQSYSYP
Meriones unguiculatus V968 igkv NHTI01003893.1 18735 AEGNIVMTQSPELMSTSVGDRITLGCKSSQSVSNAVHWYQQKSGQPPKLLMYRVSNRPSGVPDRFTGSRSGTDFTLTINSVQAEDLAVYYCQQVYSYP
Meriones unguiculatus V969 igkv NHTI01003900.1 88111 AQGNILMKQSPEFMSTSVGDRITISCKSSQSVSDYVAWYQHKPGQPPKLLIYGASTRPSGVPDRFTGSGYGTDFTLSISSVQAEDLAVYYCQQYNSYT
Meriones unguiculatus V970 igkv NHTI01003900.1 42546 DIVMTQSPEIMSTSIGDRISLNCKSSQNVGIYVHWYQQKQGQPPKLLIYDASNRYTGVPDRFTGSGSRTDFTLSISSVQAEDLADYYCQQGNSYP
Meriones unguiculatus V971 igkv NHTI01003900.1 16491 AEGNIVMTQSPEFMSTSVGDRITLSCKSSQSVSGYVAWYQQKPGQPPKLLIWNASNRYIGVPDRFTGSGSGTDYTLTISSVQAEDLAVYYCQNSYSTP
Meriones unguiculatus V977 igkv NHTI01004184.1 72382 AEGDIVMTQSPEIMSTSVGNRISLSCKSSQSVGSTIAWYQQKPEQSPKRLIYYASTRDTGVPDRFTGSASGTDFTLSISSVQDEDLAVYYCQQGYSAP
Meriones unguiculatus V978 igkv NHTI01004184.1 27392 AEGNIVMTQSPEFMSTSVGDRITLSCKSSQNVNKYVAWYQQKPGQPPKPLIYYASNRHTGVPDRFTGSGSGTDYTLSISSVQAEDMAVYYCQQGISTP
Meriones unguiculatus V982 trbv NHTI01004638.1 81153 VSAQTIHQWPAVKVQPVGSSLSLECTIKGKSNPNLYWYWQATGGPLQLLFYSINVGDVEPGLPRNLSASRPKDGQFTLSAKKLLLSHSGFYLCAWS
Meriones unguiculatus V983 igkv NHTI01004823.1 87931 ACADIVMTQSPSSLAVSEGEKVSISCRSSQSLYYSGNQKHILSWYQQKSGKSPKRLIYWASTRDTGVPDRFTGSGSGTDYTLSISSVQAEDLAVYYCMQGVS
Meriones unguiculatus V984 igkv NHTI01004823.1 36342 ACADIVMTQSPSSLAVSAGEKVSISCRSSQSLYHSSSKKNLLSWYQQKPGQSPKLLIYWASSRYTGVPDRFTGSGSGTDFILSISSVQDEDLASYYCMQGLSTP
Meriones unguiculatus V985 igkv NHTI01004823.1 25991 VCADIMMTQSPSSLAVSAGEKVSISCRSSQSLYHSSSKKNLLSWYQQVPGQSPKLLINDASTGDTGVPDRFTGSGSGTDFTLSINSVQDEDLATYYCLQGLSTP
Meriones unguiculatus V987 ighv NHTI01004984.1 105624 VQCDVQLVESGGGLVQPGKSLKLSCVASGFTFSSYWMNWVRQAPGKGLEWVAYINKDGGSTYYADAVKGRFTISRDNAKNTLYLQMNSLRSEDTATYYCAR
Meriones unguiculatus V988 ighv NHTI01004984.1 90325 VQCDVQLVEPGGGLVRPGKSLKLSCAASGFTFSNYYMSWVRRAPGKGLEWVSRISNGGVSTYYADAVKGRFTISRDNAKNTLYLQMNSLKSEDTATYYCAR
Meriones unguiculatus V989 ighv NHTI01004984.1 83041 ALSQVQLKESGPGLVQPSQPLSLTCTVSGFSLNSYGIHWVRQPPGKGLEWMGVIWSGGSTDYNSALKSRLSISRDTSKSQVFLKMNNLQTEDTAVYYCAR
Meriones unguiculatus V990 ighv NHTI01004984.1 76557 VQCDVQLVESGGGLVQPGKSLQLSCAASGFTFSDYGMHWVRQAPGKGLEWVAAISSSGGTTYYADAVKGRFTISRDNAKNSLYLQMNSLKSEDTATYYCAR
Meriones unguiculatus V991 ighv NHTI01004984.1 67423 VQSDVQLVESGGGLVQPGKSLKLSCAASGFTFSNYYMHWVRQAPGKGLEWVSRISNDGGSTAYVDAVRGRFTISRDNAKNTLYLQMNSLRSEDTATYYCAR
Meriones unguiculatus V992 ighv NHTI01004984.1 35281 VQCDVQLVESGGGLVHLGKTLKLSCAASGFTFSDYGMIWVRQAPGNGLEWVAYISYNSDTIYYADAVKGRFTISRDNAKNTLYLQMNSLRSEDMATYYCSR
Meriones unguiculatus V993 ighv NHTI01004984.1 21205 IQCEVQLVESGGGLVQPGKSLNLSCAASGFTFSNYYMHWVRQAPGKVLEWVADISGDSSDIYYADAVKGRFTISRDNAKNTLYLQMNSLRSEDTATYYCAT
Meriones unguiculatus V994 ighv NHTI01004984.1 8868 VQCEVQLVESGGGLVQPGKSLKLSCAASGFTFSNYYMSWVRQAPGKGLQWVAGISYDGGSTYYVDAVKGRFTISRDNAKNTLYLQMNSLRSEDTATYYCA
Meriones unguiculatus V996 igkv NHTI01005081.1 70360 ACADIVMTQSPSSLAVSAGEKVSISCRSSQSLYHSSSKKNLLAWYQQKPGQSPKLLIYHASTRYTGVPDRFTGSGSGTDYTLSISSVQDEDLAIYYCQQGISDP
Meriones unguiculatus V997 igkv NHTI01005081.1 49975 ACADIVMTQSPSSLAVSPGEKVSISCRSSQSLYYSVNQKNYLAWYQQKPGQSPKLLVYWASTRHTGVPDRFTGSGSGTDFTLSISSVQAEDLAVYYCQQYYEYP
Meriones unguiculatus V998 igkv NHTI01005081.1 15829 ASAHILMTQSPSSLAVSEGEKLSVSCRSSQSLLHSSNQKNYLFWYQQKPGQSPKWLISYASTRDTGVPDRFTGSGTGTDFTLSICSVQAEDLAVYYCLQTYSDP
Meriones unguiculatus V1001 igkv NHTI01005131.1 84129 AFADIVMTQSPSSLAVSAGEKITISCRSSQNLLYSGNQKNLLSWYQQKPGQSPKMLIYYASTRLTGVPDRFTGSGSGTDFTLTINSVQAEDLAVYYCQQGISTP
Meriones unguiculatus V1002 igkv NHTI01005131.1 55024 ACADIVMTQSPSSLAVSAGEKVSISCKSSQSLYYSNNQKNLLSWYQQKPGQSPKLLIYWASTRHTGVPDRFTGSGSGTDYTLSISSVQAEDLAVYYCMQDISAP
Meriones unguiculatus V1008 igkv NHTI01005449.1 46577 TCAGIVMTQSPSSLAVSAGEKVTISCRSSQSLYYSDNQKNLLSWYQQKPGHSLKLLVYWASTLHTGVPDRFTGSGSGTDFTLSISTVQAEELAVYYCQNSFSIP
Meriones unguiculatus V1009 igkv NHTI01005449.1 1522 TCADIVMTQSPSSAGEKVSISCRSSQSLLGSKSQKNLLSWYQQKPGQSPKLLIYWASTRHTGVPDRFTGSGSGKDYTLSISSVQAEDLAVYYCMQDKSIP
Meriones unguiculatus V1016 iglv NHTI01005790.1 43070 SMGQFQLTQPNSVSGSPGSTVTISCQRSSGNIGDNYVYWYQQRLGRSPTTVIYKDDKRPSGIPDRFSGSIDSSSNSASLRISNVQAEDEADYYCQSYDSSY
Meriones unguiculatus V1017 iglv NHTI01005790.1 20983 SWGQFSLTQPNSVSGSLGSTVSLSCKRSSGDIGSYYVHWYQQHLGRSPTTVIYGDDKRPSGIPDRFSGSIDSSSNSASLTIRNLQAEDEAVYFCLSDDSSY
Meriones unguiculatus V1018 iglv NHTI01005790.1 9817 SWGQFQLTQPHSVSGSPGSTVSLSCRRSSGNIGDYYVYWYQQPEGRSPSLVIYEYDNRPSGIPDRFSGSIDSSSNSASLRISSLKNEDEADYFCQSGDSDN
Meriones unguiculatus V1020 iglv NHTI01005804.1 9605 SMGQFQLTQPNSVSGSPGSTVTISCQRSSGNIGDYYVYWYQQRLGRSPTLVIKYNNERPSGIPDRFSGSTDSSSNSASLRISKLQTEDEGDYFCQSYYSSY
Meriones unguiculatus V1026 igkv NHTI01006087.1 38816 ACADIVMTQSPSSLAVSAGEKVNISCRSSQSLLDSTEQKNYLSWYQQKPGQSPKLLIYWASTRDTGVPDSFTGSGSGTDFTLSISSVQDEDLAVYYCLQEFSTP
Meriones unguiculatus V1027 igkv NHTI01006087.1 31039 SREDIVMTQSPSSLAVSAGEKVTISCRSSQSLLYNKDQKNYLFWYQQKSRQSPKLLISYASTRHTGVPDRFTGSGSGTDFTLSISTVQAEDLAVYYCLQSYSAP
Meriones unguiculatus V1028 igkv NHTI01006087.1 12254 AEGNIVKTQSPEFMFASVGDRITLSCKSIQSVGSYVDWYQQKSGQPPKLLIYDASTRYTGVSDRFIGSGSGTDFTLSISSVQVEDLAVYYCQQRYSCP
Meriones unguiculatus V1030 igkv NHTI01006169.1 44772 TCADIVMTQSPSSLAVSAREKVTISCKSSQSLTSGSSNYLSWYQQKPGQSPKLLISWASTRHTGVPDHFTGSGSGTDFTLSISSVQAEDLTVYYCQQYRSFP
Meriones unguiculatus V1031 igkv NHTI01006311.1 72304 AEGDIVMTQSSEIVSTSVGDRITLNCKSSENVGSSVHWYQQKPGQPPKLLIYYASNRNTGVPDRFTGSRSGTDFTLSISSVQAEDLADYYCQQSSSYP
Meriones unguiculatus V1032 igkv NHTI01006311.1 1613 AEGNIVMTQSPKVMSTSVGDRITLGCKSSQNVYNIVAWYQQKPGQPPKLLIYGASTRPSGVPDRFTGSGSGTDYTLSISNVQAEDLAVYYCQQYYDYP
Meriones unguiculatus V1036 igkv NHTI01006986.1 62116 AEGNIVMSQSPEFMSTYVGDRITLSCKSSQNVYKGVAWYQQKSGQPPKLIIYGASNRQTGVPDRFTGSRSGTDFTLSISSVQAEDLAFYYCQQYNSYP
Meriones unguiculatus V1038 igkv NHTI01007316.1 26413 ADGNIVMTQSPEFISTSIRDRITLSCKSSQSVNKYIAWYQQKSGQPPKPLIYYVSTRHTGVPDRFTGSGSGTDFTLSISNVQAEDPAVYYCHYYDNTP
Meriones unguiculatus V1039 igkv NHTI01007317.1 28066 AEGDIVMTQSPEIMSASVGDRITLNCKSSQNVGSYVHWYQQKPGQPPKLLIYDASNRYTGVPDRFTGSGSGTDFTFSISSVQAEDLADYYCQQHNSYP
Meriones unguiculatus V1040 igkv NHTI01007346.1 38371 AEGNIVMTQSPEFMSTSVGDRITLSCKSSQGVDNYVNWYQQKSGQPPKLLIYGASNRPSGVPDRFTGSGSGTDFTLSISSVQAEDLAVYYCQNGYST
Meriones unguiculatus V1041 igkv NHTI01007372.1 44650 AEGNIVMTQSPEFMPTSVGERISLSCKSSQNVGTAIAWYQQKSGQPPKLLIYSASSRYTGVPDRFTGSGSGTDFTLSISSVQAEDLAVYYCQQYSSYP
Meriones unguiculatus V1044 igkv NHTI01007723.1 47891 TCADILMTQSPTSLAVSAGEKVSISCRSSQSLLYSSNQKNYLSWYQQKPGHSPKLLIYFASTRDTGIPDRFTGSGSGTDFTLSINSVQAEDLAVYYCQQYYSTP
Meriones unguiculatus V1047 trdv NHTI01008031.1 51608 FNVAQKVTQVQSTTSSQYREVTLDCSYETSYYYYHLFWYKQLVTGEMIFLICQSSSSIQNERNGHYSFTLKKSAKSISLVISASQLEDLGMYFCALQEV
Meriones unguiculatus V1048 trav NHTI01008031.1 16680 GVRGAGVEQSPSVLSLQEGTSSALRCNFSTTMKSVQWFRQNPQGSLISLLYVAAGTKENGRLKSTFHFKESYSALHLRDAQLEDSGTYLCAAE
Meriones unguiculatus V1049 ighv NHTI01008193.1 33901 VQCDVQLVESGGGLAQPGKSLKLSCAASGFTFSDYGMHWVRQAPGKGLEWVAYISYNSGTIYYAEAVKGRFTISRDNAKNTLYLQMNSLRSEDTATYYCA
Meriones unguiculatus V1050 ighv NHTI01008193.1 26273 VQCDVQLVESGGGLVQSGKSLKLSCAASGFTFSDYSMNWVRQAPGKGLEWVAYISYNSGSIHYADAVKGRFTISRDNAKNTLYLQMNSLRSEDTATYYCAR
Meriones unguiculatus V1052 ighv NHTI01008782.1 43641 ILSQVQLQESGPELVKPTQSLLLTCSVTGYSITTSGSYWHWIRKFPGNKLEWLGCIDYSGDPTYNPSLKILISITTDTSKNQFFLQLSSVTTEDTATYYCTG
Meriones unguiculatus V1053 ighv NHTI01008782.1 40425 VHCEVQLQQSGAEVGRPGSSVKLSCKASGYSFTSYYMHWVKQSPGQGLEWIGWIYPGSGNTGYNQKFRGKATLTADTSSSTAHMELRSLTAEDSAVYYCARG
Meriones unguiculatus V1054 ighv NHTI01008782.1 30995 VQCEVRLVESGGGLVRPGSSLKLSCAASGFKFSDYWMHWVRQAPGKGLEWVALIKYKPDNYGTVYAESVKGRFTISRDDSTSSLYLQMNSLRAEDTAFYYCAR
Meriones unguiculatus V1055 igkv NHTI01008975.1 16078 ACADITMTQSPSFLAVSAGEKVTISCRSSQSLLSSKDQKNDLAWYQQKPGQSPKLLIYYASTWHTGVSDRFTGSGSGTEFTLTISSVQDEDLADYYCQQHYSTP
Meriones unguiculatus V1056 igkv NHTI01008975.1 416 ACAVIVMTQSPSFLAVSAGEKVTISCKSSQSLTLGGLNFLSWYQQKPGQSPKLLIYYASTRHTGVPDRFTGSGSGTDFTLSISSVQVEDLAVYYCMHGKSTP
Meriones unguiculatus V1057 igkv NHTI01008989.1 14221 NIVMTQSPNVMSTSVGDRITLSCKSSQNVGTAVAWYQQRPGQPPKLLIYGASNHPSGVPDRFTGSGSGTDFTLSISSVQCEDLADYYCQNGYSTP
Meriones unguiculatus V1062 igkv NHTI01009610.1 8313 SILPGCFSKRKGLHQLQVQSESFIQCNQKNLLSWYQQKLGQSPKMLIYYASTWLTGVPDRFTGSGSGTDFTLSISSVHAEDLAVYYCQQGISTP
Meriones unguiculatus V1065 ighv NHTI01009794.1 32582 VQCDVQLVQSGGGLVQPGKSLKLSCVASGFTFSNYYMYWVRQAPGKGLEWVSWIRYDGGSTAYADAVKGRFTISRDNAKNTLYLQMNSLRSEDTATYYCAR
Meriones unguiculatus V1066 ighv NHTI01009794.1 12015 GVWCDVQLMDSGGGLVQPGKSLKVTCAAAGFTFRDYSMHWVQQAPEKGLEWVVYISYNCGTMYYANAVKGRFTISRDNAKNTLYLKMNSLRSEDTATYYCAR
Meriones unguiculatus V1067 ighv NHTI01009794.1 1498 VQCDVQLVDSGGGLVQPGKSLKLSCVASGFTFSSSYWMHWVRQVPGKGLEWVAAIHTGGGSTAYADAVKGRFTISRDNAKNTLYLQMNSLRSEDTATYYCAR
Meriones unguiculatus V1069 ighv NHTI01009851.1 14201 VQCEVQLVESGGGVVQPGASLKLSCVASGFTFSSYWMSWVRQAPGKGLEWVGEINPNGGTTNYAPSLKDRFTISRDNAKNTLYLQMSKVRSEDTATYYCT
Meriones unguiculatus V1070 ighv NHTI01009851.1 4716 ILSQVQLQESGPELVKPTQSLLLTCSVSGYSITTRNSYWHWIRKFTGNKLEWMGCIGYSGGTSYNPSLKNRISITRETSKNQFFLQLSSVTTEDTATYYCAS
Meriones unguiculatus V1071 igkv NHTI01009874.1 7163 AEGNIVMTQSPEFMSISTGDRITISCKSSQSVKSYVAWYQQKLGEPPKLLIYGASTRPSGVPDHFTGSGSGTDYIFTISSVQPEDSAVYYCQQGYRT
Meriones unguiculatus V1073 trav NHTI01010209.1 23679 RIHGNSVIQKQGQVTLSEDSVLFINCTYSSTGYPTLFWYVQYSEESPELLLKVTTAGEKGSSRGFEATYDRGTTSFHLQKASVQESDSAVYYCALR
Meriones unguiculatus V1074 trav NHTI01010209.1 18102 SSNGDSVTQTEGLVTVTEGMPVMLNCTYQTTYSGPSLFWYVQYLNEAPQLLLRSSTDKKRTEHRGFHATLHKSSSNFHLQMSSVQLSDSALYYCAVR
Meriones unguiculatus V1075 trav NHTI01010209.1 9853 VKGQQVEQSPVSLVLQEGESATLQCNFSTAITQVQWFYQSPGGPLLSLLSNPSGTKHSGRLTSTTVPVKRRSSLYISSSQSTDSGTYLCAVIHIA
Meriones unguiculatus V1076 ighv NHTI01010547.1 27027 VQCDVQLVESGGGLVQPGKSLKLSCAASGFTFSDYYMHWVPQAPGKGLEWVAEISGGSSDISYADAVKGRFTISRDNAKNTLYLQMNSLRSEDTATYYCAR
Meriones unguiculatus V1077 ighv NHTI01010547.1 10669 VQCDAQLVESGGGLAQPGKSLKLSCAASGFTFSDYYMHWVRQAPGKGLEWVAYISSSSSYIYYADAVKGRFTISRDNAKNTLYLQMNSLRSEDTATYYCAR
Meriones unguiculatus V1078 igkv NHTI01011572.1 19449 TCADMVMTQAPSSLAVSAGEKVTISCKSSQSLTSGSSYYLSWYQQKPGQSPKLLIYYASTRHTGVTDCFTGSGSGTDFTLSISSVQDEDLAVYYCQQHYEYP
Meriones unguiculatus V1079 igkv NHTI01011772.1 2877 TEGNIVMTQTPEFMSTSVGERITLSCKSSQSVSGWVAWYQQKPWQPPKLLIYGASNRYTGVPDHFTGSGSGQITLSSVQAEDLAVYYCQQYDYTP
Meriones unguiculatus V1080 trav NHTI01011774.1 23153 ESRGEQVKQHPSSLNVQEGDSAVINCTYTDSASVYFPWYKQEPGKGPQFIIGIHLNMERKQNQRLSLLLDKKEKHLSLHVTATQPGDSAIYFCTAD
Meriones unguiculatus V1081 igkv NHTI01011910.1 12190 AEGNIVMIQSPEFMSTSVGDRITLSCKSSQSVSGYVAWYQQKPGKPPKPLIYDASNRYTGVPDHFTGSGFGTDFTVSISSVQAADLAVYYCQQYDNTP
Meriones unguiculatus V1082 igkv NHTI01011910.1 9155 AEGNIVMTQSPEFMSTSVGDRITLSCKSSQSVSGWVAWYQQKPGKPPKLLIYDASNRYTGVPDRFIGSGSGTDYTLTISSVQAEDLAVYYCQQYDSTP
Meriones unguiculatus V1085 ighv NHTI01012721.1 17315 VHSQVQLQQSGAEVGRPGASVKLSCKASGYTFTDHAVHWVKHRLGQRLEWIAYIYPGSGSTTFNEKFKGKATLTADSSSSTAYMELRSLTSEDSAVYYCA
Meriones unguiculatus V1086 ighv NHTI01012721.1 11202 VLSQITLKESGPGLLQPSETLSLTCTFSGFSLSTTNIGVGWIRQPPGKGLEWLAHIWWDDDKRYNPSLKSRLTISKDSSNNRVFLKLASVDTADSATYYCVRR
Meriones unguiculatus V1087 ighv NHTI01012721.1 7670 VLSQVTLKESGPGLLQPSETLSLTCTFSGFSLSTTYMGVGWIHQPPGKGLEWLANIWWDDGKRYNPSLKSRLTISKDSSNNRVLLKLASVDTADSATYYCAQR
Meriones unguiculatus V126 trav NHTI01000259.1 4870 VKGQQVEQRPATLALQEGENATLKCNFSSTAAQLQWFYQSPGGPLLSLFSNPSGTKQSGRLTSTTVTMELRSSLYISSSQTTDSGTYLCAVEPQCS
Meriones unguiculatus V127 trdv NHTI01000259.1 12333 FSTAQKVSHVQPAINKQEGEQVTMDCSYETSMNFYQLYWYKQHPSGDMIFLIRQVSSSHHNESSGRYSVIFQKSAKSISLIISASQVGDSMNYFCALVEP
Meriones unguiculatus V128 trav NHTI01000259.1 29772 TSMAQKVTQAQTSVSVMEEKTVTLDCVYETRESAYSLFWYKQTTSGEMVFLIRQDSYQKENATEGHYSLNFQKSESSIGLIISATQIEDSAVYFCAMRE
Meriones unguiculatus V129 trav NHTI01000259.1 35816 VKGQQVEQSPVSLVLQEGESATLQCNFSTAITQVQWFHQSPGGPLLSLLSNPSGTKHSGRLTSTTVPVKRRSSLYISSSQSTDSGTYLCAVGAQCS
Meriones unguiculatus V130 trav NHTI01000259.1 55050 ASRGERVDQSPSHLSVQEGASTVITCTYTDDNSYYFSWYKQEPGAGLQFFTNVISGVDRKEKQGLIVLLNKKEKHLSLNITAARPGDSATYFCAAS
Meriones unguiculatus V131 trav NHTI01000259.1 56281 KSNGNSITQTEGPVTLAARTPLVLNCTYQTTYSNPSLFWYVQYLNEAPQLLLRSSTDNKRTEHRGFHATLHKSSSSFHLQTSSAQLSDSALYYCAVR
Meriones unguiculatus V132 trav NHTI01000259.1 75763 GNRAQSVTQPDAYITVSEGASLELRCSYSYRATPYLFWYFQYPGQSLQLLLKYVTGDTLVKGVHGFEAEFRKSNSSFNLRKSPARWSDSAKYFCALS
Meriones unguiculatus V133 trav NHTI01000259.1 115026 VGTQQLEQSPQFLSIQEGQDFTLYCNSSSTLPQLYWYRQVPGEGPAMLMTLARSGEVKEQKRITAKFGEARRGSSLSIIRTQPGDAGIYFCAG
Meriones unguiculatus V135 trav NHTI01000259.1 182780 VKGQLLSQSAQYLSIPEGKDASMSCNSSSTLNSFLWYKQDPKEGLVLLVALYKTGELVRNGKVTAEFGGSRKDSVLTISASEPADTSTYFCAG
Meriones unguiculatus V137 trav NHTI01000259.1 245056 ASMAQTVTQPQQEKSVQEAESATLDCTYDTSDTSYYLFWYKQQGGRMTLVILQESYRQQNARQNRFSVNFQKAAKSFSLEISDSQLRDTATYFCALME
Meriones unguiculatus V138 trav NHTI01000259.1 260379 LTGEKTVEQNPLFLSIWEGTNSTIYCNYSSSATDRLSWYRQDPGKSPEFLFVLLWNGAVTRDRRLTASLDSKAHVSTLHFSGLQHSHSATYLCAV
Meriones unguiculatus V139 trdv NHTI01000259.1 345534 VSLDIILEPVDKTLTVVAGNPATFYCTVTGGDLKNYQMSWYKKSENNALILVYKLNNHSMDDLMGNFKGKINVLKSQFILDIQKATTKDAGTYYCGSD
Meriones unguiculatus V209 trbv NHTI01000534.1 457572 PGDPRIIQKPKHLVTVMGSERTLICEQYQGHNAMYWYRQSATQSLELMFSYNYQKLFENQTLTNRFRPHSREKSHLDLQITALQPDDSATYFCASSQ
Meriones unguiculatus V210 trbv NHTI01000534.1 459030 HTGPNVVQIPSHQVKDVNQTVTFSCDPVSNHLYFYWYKQILGQQMEFLVSFYSGKVLDKSELFKDRFSVERPDGSYFTLKIEPTNLKDSAVYFCASSL
Meriones unguiculatus V211 trbv NHTI01000534.1 467329 PLETAVLQTPKYLVTQVGNNVSLKCEQNLGHDAMFWYKQDYELKIMFSYNNKQRILNKTVPSRFSPQAPDKAHLNLHVKTVELDDSAAYFCASSY
Meriones unguiculatus V212 trbv NHTI01000534.1 471022 LTNTKVTQTPRYLVMGRASKKSLKCEQHLGHNAMYWYKQNAEKPPELMFSYNVRKLIENATVPIRFLPECPDSSHLLLHLSAPEPEDSAVYFCASSQ
Meriones unguiculatus V213 trbv NHTI01000534.1 505934 SVNAGIIQTPKSLLLKTGQHMIMRCTQDMKHDSMFWYRQDPGLGLRLIYYSHEVDIISKGDVPDGYNVSRPRTEDFPLTLKSASPSQTSVYFCASSY
Meriones unguiculatus V214 trbv NHTI01000534.1 538017 DMEAAVTQSPRNKVTVTGGNVTLSCYQNNNHDYMYWYRQDMGNGLRLIHYSYGAGKTEKGDVPDGYKASRPRLEDFSLMLELASPSQTAVYFCASSD
Meriones unguiculatus V215 trbv NHTI01000534.1 541888 AASTGVVQSPRHIIKEKGGRSILKCIPISGHYNVLWYQQTQGRELKFLIQHYEKMEREKGSIPNRFSVQQFSDYHSEMNMSALELEDSAVYFCAS
Meriones unguiculatus V216 trbv NHTI01000534.1 551049 AASTGVVQSPRHIIKEKGGGTILKCIPISGHDNVLWYQQTQGQELKFLIQHYEKMEREKGSIPNRFSVQQFSDYHSEMNMSALELEDSAVYFCAS
Meriones unguiculatus V217 trbv NHTI01000534.1 560519 AASTGVVQTPKHIIKEKGGGSILKCLPISGHNYVFWYQQTPGQELKFLIQHYETLEGEKGSIPNRFSVQQFSDYHSEMNMSALELEDSAVYFCAS
Meriones unguiculatus V218 trbv NHTI01000534.1 568394 AASTGVVQSPRHIIKKKGGGSILKCIPISGHNSVLWYQQTPGRELKFLIQHYEISEGEKGTIPNRSSVQQFSDYHSEMNMSALELEDSAVYFCAS
Meriones unguiculatus V219 trbv NHTI01000534.1 571871 DMEATVTQSPRNKMTVTGGKVNLSCHQTNNHNYMYWYRQDMGNGLRLIHYSYGAGITEKGDVSDGYKASRPRTEDFSLVLELASPSQTAVYFCASSD
Meriones unguiculatus V220 trbv NHTI01000534.1 579414 AASSGVVQTPKHIIKEKGGGSILKCIPISGHNSVLWYQQTPGRELKFLIQHFEKMMREKGSIPNRFSVQQFSDYHSEMNMSALELEDSAVYFCAS
Meriones unguiculatus V221 trbv NHTI01000534.1 583092 DMEATVTQSPRNKVTVTGGNVTLSCHQNNNHNNMYWYRQDMGHGLGLIHYSYVAGKTEKGDVPDGYKASRPRTEDFSLVLELASPSQTAVYFCASSD
Meriones unguiculatus V222 trbv NHTI01000534.1 588102 LSEAGVTQSPRYAIIQERQPVSFQCDPISGHITLYWYQQPKDQGPQLLVYFQNKDVGDDSQLPKDRFSAVRSNGVDSTLKIQSAKLGDSATYLCASSL
Meriones unguiculatus V223 trbv NHTI01000534.1 608205 PTNAGVTQTPKNKVTVKGQEVTLSCEPISGHSNIFWYRQTTVQGLEFLINFRNQAPIDDTGMPKERFSVQMPSKNLSTMKIQPTQPQDSAVYLCASSL
Meriones unguiculatus V224 trbv NHTI01000534.1 637378 TTHGGITQTPKFLISQSGQKLTLKCEQNFNHDTMYWYRQDSGKGLQLIYYSITEKDLQKGELSEGYDASREKKPFFHLTVTSAQKNQMAVYLCASSI
Meriones unguiculatus V226 trbv NHTI01000534.1 653696 AMDTGVIQNPKHLVKGKEQKARMDCSRKKGHSYVYWYYKKLGEELKFLVYFQNEEILEKTDMIDKNISAKCPTDKPCFIEIQSSKLTDSAVYFCASSL
Meriones unguiculatus V227 trbv NHTI01000534.1 666714 SLGGQIIQTPRHLFKGNGQKANMSCTPEKGHTFVYWYQQKQNKELRFLISFQRQDVRDSIDLVKERFLAECPVNLPCSLEIQSSEVEDTALYLCASSL
Meriones unguiculatus V228 trbv NHTI01000534.1 670061 SFDAAVTQTPRHLIKTKGQKAKMNCTPEKEHNAVFWYQQTQSRELKFLIYFQNQRPVDQIDMVKERFSAECPSSSLCSLEIKTCEAEDTALYFCASSQ
Meriones unguiculatus V229 trbv NHTI01000534.1 672052 SFDAKVTQTPRYLIKEKGQKANMSCFPEKGHTAFYWYHQDQKREVKLLINFRNEDIIEQTDVVKKRFSAKCPSNSPCSLEIQSSEAGDSALYLCASS
Meriones unguiculatus V230 trbv NHTI01000534.1 727727 LVDMKVTQTPRYLIKRMGENVLLECTQDMNHERMYWYRQDPGLGLRLIQFSYDVDSNDKGDIPDGYRVSRKKREHFSLILDSAEANQTSVYFCASSI
Meriones unguiculatus V231 trbv NHTI01000534.1 734864 SVFSVHVYQKPNRDICQSGTSLKIQCVVDSQVTVMLWYRQFQGQSLELMATANQGREATYENGFRNDKFPISFPNLTFSTLTVNSMRPEDSSVYFCSAE
Meriones unguiculatus V303 ighv NHTI01001035.1 489162 TLKESGPGLLQPSETLSLTCTFSGFSLSTTHMGVGWIRQPPGKGLEWLANIWWDDGKRYNPSLKSRLTISKDSSNNRVFLKLASVDTADSATYYCARR
Meriones unguiculatus V304 ighv NHTI01001035.1 501169 VHSQVQLQQSGAELGRPGSSMKLSCKASGFTFTSYIIQWVKQRPGQGLEWIGWIYPGSVGTKYNQKFRGKATLTADTSSSTAHMELRSLTAEDSAVYYCARD
Meriones unguiculatus V305 ighv NHTI01001035.1 527878 VHSQVQLQQPESEVGRPGSSVRLSCKASGFTFTDHAVHWVKQSPGQGLEWIGWIYPGSGNTGYNQKFRGKATLTVDTSSSTAHMELRSLTAEDSAVYYCARD
Meriones unguiculatus V370 igkv NHTI01002285.1 12872 AEGNIVRTQTPEFMSTSVGERITLSCKSSQSVSGWVAWYQEKPGKPPKLLIYGASNRSTGVPDRFTGSGSGTDYTLTISSVQDEDMAVYYCQQNCDYP
Meriones unguiculatus V371 igkv NHTI01002285.1 72081 VEGNIVMTQSPEFMTTSVGDRITLSCKSSQNVDSAVAWYQQKSGQTPKLLIYDASTRYTGVPDRFTGSESGTDYTLSICSVQAEDLAVYYCQQHYAYP
Meriones unguiculatus V372 igkv NHTI01002285.1 94041 AEGNIVMTQSPKVMSTSVGDRITISCKSSQNLDNYVAWNQQKPGQPPKLLIFYASNQHTGVPDHFTGSGSGTDFPLSISSVQAEDLAVYYCQQHYDYP
Meriones unguiculatus V373 igkv NHTI01002285.1 125957 AEGNIVMTQSPEFISTSVGDRITLSCKSSQNVGTAVAWYQQKPGQSPKPLIYWASNRYTGVPDRFTGSGSGTDFTLSISSVQAEDLAVYYCQQGSSYP
Meriones unguiculatus V374 igkv NHTI01002285.1 189617 AEGSIVMIQSPEFMSTSVGDRITLSCKSSQSVSGWVAWYQQKPGKPPKPLIYDASNRYTGVPDRFIGSGSGTDYTLSISSVQAEDLAVYYCQQYDNTP
Meriones unguiculatus V375 igkv NHTI01002285.1 203280 AEGNIVMTQSPEFMSTSVGDRITLGCKASQSVSNEVHWYLQKSGQPPKLLISYASNRPSGVPDRFTGSGSGTDYILSISSVQAEDLTVYYCLQSYSY
Meriones unguiculatus V376 igkv NHTI01002285.1 254717 AKGDIVMIQSPEIMSTSVGDRITLNCKSSQNVGSSVHWYQEKPGQPPKLLIYGASNGYTGVPDRFTGSGYETDFTLSISSVKAEDLADYYCQQSYSDP
Meriones unguiculatus V428 ighv NHTI01004357.1 4586 VQAQVQLVQTGSELKKPGESVKISCKASGYTFTDYAMNWVKQAPGKGLQWMGWINTNTGNPTYAEDFKGRFVFSLDTSVSTAFLQINSLKNEDTAMYYCA
Meriones unguiculatus V429 ighv NHTI01004357.1 33596 VHSQVQLQQSGAEVGRPGSSVKLSCKASGYTFTNSYMHWVKQRSGQGLEWIGRIDPEDGSTKYAQKFQGKATLTADTSSSTAYMELRSLTAEDSAVYYCA
Meriones unguiculatus V430 ighv NHTI01004357.1 42598 AAGGVWRRLGEAWSSLILSCAASGFTFDDAYMHWVRQAPGKGLEWVATSRNQADSFATEYSLFVEDRFTISRENSQNILYLQMNSLRVEDTATYYCRGE
Meriones unguiculatus V431 ighv NHTI01004357.1 70059 VQCEVQLVESGGGVVQPGGSLKLSCVTSGFTFSGYWMDWVRQAPGKGLEWVGEINQNSDTIRYAPSVNNRFTISRDNAKNTLYLQMSKVKPEDTATYYCAR
Meriones unguiculatus V432 ighv NHTI01004357.1 102168 VQCDVQLVESGGGLVQPGKSLKLSCAASGFTFSDYGMDWVRQAPGKGLEWVSWIRYDGGDTAYADAVKGRFTISRDNAKNTLYLQMNSLRSEDTATYYCAR
Meriones unguiculatus V433 ighv NHTI01004357.1 113015 VQSDVQLVESGGGLVQPGKSLKLSCAASGFTFSSYSMDWVRQAPGKGLEWVAVISSGGTIYYAYAVKGRFTISRDNAKNTLYLEMNSLKSEDTATYYCA
Meriones unguiculatus V434 ighv NHTI01004357.1 118068 ALSQVQLKESGPGLVQPSQPLSLTCTVSGFSLSSYHVHWVRQPPGKGLEWMGAMWSGGGTAYNSALKSRLSISRDTSKSQVFLKMNNLQTEDTAKYYCAR
Meriones unguiculatus V450 igkv NHTI01005181.1 70521 AEGNIVMTQSPEFMSTSVGDRITLTCKSSQNVYKSVAWYQQKSGQPPKLLIYGTSYRPTGVPDSLTGSGSGTDYTLSISSVQAEDLAVYYCQQSVSTP
Meriones unguiculatus V453 igkv NHTI01005460.1 29201 ACADIVMTQSPSSLAVSAGEKVTISCKSSQSLYYSNNQKNLLSWYQQKPGQSPKLLIYWASSRHTGVPDRFTGSGSGTDYTLSISSVQAEDLAVYYCMQGYFP
Meriones unguiculatus V454 igkv NHTI01005460.1 67373 ACADIVMTQSPSSLAVSAGEKVSISCRSSQSLLDSKDQKSYLSWYQQKPGQSPKLLIYWALTQHTGVPDRFIGSGSGTDFTLTISSMQAEDLAVYYCQNVYSTP
Meriones unguiculatus V455 igkv NHTI01005615.1 5902 SRGDIVMTQSPSSLAVSAGEKVTISCRSSQSLLYNKDQKNYLFWYQQKPRQSPKLLISYASTQHTGVPDRFTGSGSGTDFTLSISTVQAEDLAVYYCLQSYSAP
Meriones unguiculatus V456 igkv NHTI01005615.1 44240 SCADIVMTQSPSSLAVSAGEKVTISCRSSQSLLYSVNQKNYLAWYQQKPGQSPKPLIYHTTTRHTGVPDHFTGSGSGTDFTLSISSVQAEDLAVYYCLQYDSYP
Meriones unguiculatus V462 ighv NHTI01006031.1 2188 VHSQVQLQQSGAELVRPGSSVRLSCKASGYNFASYYMSWVKQSPGQGLEWIGYIYGNGGSISYNQKFQGKATLTVDSSSSTAYMTLSSLTSEDSAVYYCARH
Meriones unguiculatus V463 ighv NHTI01006031.1 26614 VQCEAQLVESGGDVVQPGGSLKLSCVSSGFTFTSYWMHWVRQAPGKGLEWVARINENGDTIHYAPSLKDRFTISRDNAKNTVYLQMSKVRSEDTATYYCAR
Meriones unguiculatus V464 ighv NHTI01006031.1 33492 VHSQVQLQQSGAEVGRPGSSVRLSCKASGYTFASYYMSWVKQSPGQGLEWIGYVYGNDGSISYNQKFQGKATLTVHSSSSTAFMTLSSLTAEDSAVYYCARQ
Meriones unguiculatus V465 ighv NHTI01006031.1 49130 VQCEAQLVESGGSVVQPGGSLKLSCVASGFTFTSYWMHWVRQAPGKGLEWVARINENGDTTHYALSLKDRFTISRDNAKNTVYLQMSKLRSEDTATYYCAR
Meriones unguiculatus V468 igkv NHTI01006169.1 66548 ACADIVMTPSSLAVSAGEKVSISCRSSQSLYHSSNKKNLLYWYQQKPGQSPKQLIYHASTRNTGVPDCFTGSGSGTDYTLSISSVQAEDLAVYYCLQGISAP
Meriones unguiculatus V469 igkv NHTI01006361.1 51558 ACADIVMIQSPSSLAVSAGEKVTIRCRSSQSLLSTGNQKNYLAWYQQKPGQSPKLLIYWASTRYTGVPDRFIGSGSGTDFTLSISSVQAEDLAVYYCMQHYDYP
Meriones unguiculatus V470 igkv NHTI01006361.1 58960 SSGDIVLTQSPSSLAVSVGEKVTISCKSSQSLLNTGNQKNYLAWYKQKPGQSPKLLIYLASTRYTGVPDRFTGSGSGTDFTLSISSVQAEDLAFYYCLQTYSYP
Meriones unguiculatus V479 igkv NHTI01007247.1 13199 AEGNIVMTQSPEFMSTSVGDSITLGCKSSQSVSNDVHWYQQKSGQPPKLLMSYASNRPSGVPDRFTGSGSGTDFTLTINSVQVEDLAVYYCQQGYSYP
Meriones unguiculatus V480 igkv NHTI01007247.1 35289 AEGNIVMTQTPEFMSTSVGDRITLSCKSSQNVDNYVAWYQQKSGQPPKLLIYDASTRYTGVPDRFTGSGSGANFTLGISSVQAEDLAVYYCQQRNSYP
Meriones unguiculatus V481 igkv NHTI01007317.1 32777 AEGDIVMTQSPEIMSASVGDRITLNCKSSQNVGSYVHWYQQKPGQPPKLLIYDASNRYTGVPDRFTGSGSGTDFTFSISSVQAEDLADYYCQQHNSYP
Meriones unguiculatus V482 igkv NHTI01007346.1 42045 AEGNIVITQSPEFMSTFVGDRITLGCKASQSVSNEVHWYQQKSGQPPKLLIYYASNRPSGVPECFTGSRSGTDFTLTINSVQAEDLAVYYCQQVYSCP
Meriones unguiculatus V484 igkv NHTI01007377.1 20853 AEGNIVMTQSPEFMSTLVGERITLGCKSSQSVSNVVYWYQQKSGQPPKLLMYRASNRPSGVPDRFTGSGSGTDFTLTISSVQAEDLAVYYCQQGYSYP
Meriones unguiculatus V485 igkv NHTI01007377.1 59638 DEGNIVMTQTPEFMSTSVGERISLSCKSSQSVSGLVSWYQQKPGKPLKLLIYDASDRYTGVPDRFTGSGSGTDYTLSISSVQAEDLAVYYCLQYDSYP
Meriones unguiculatus V487 trav NHTI01007532.1 521 RSNGDSVTQTEGLVTVTEGMPVMLNCTYQTIYSNPSLFWYVQYLNEAPQLLLRSSTDNKRTEHRGFHATLHKSSSSFHLQASSAQLSDIALYYCAMG
Meriones unguiculatus V488 trdv NHTI01007532.1 13096 CNVAQKVTQVQSTASSQYGEEVTLDCSYETSQYLYYLFWYKQLVTGEMIFLIRQISSSIQNERNGHYSVTLQKSAKSFSLVISASQIEDSGTYFCALQEL
Meriones unguiculatus V489 trav NHTI01007532.1 25727 VSSQLKVEQIPESLSVPEGAMASLNCTFSDSTSQYFWWYRQLSGQGPKALMSIFSNGDKEENRFTAHLNKASLHVSLHIRDSQPSDSAVYLCAV
Meriones unguiculatus V490 trav NHTI01007532.1 37116 AVQTQSVTQSDAQVTVFEGESVELKCNYSYGGALYLFWYIQHRGRGPQLLLRYYSGDPVVHGINGFEAEFNKKDSSFNLRKAPVHWSDSAVYFCALS
Meriones unguiculatus V491 trav NHTI01007532.1 45688 ESNGDSVTQTEVHVTLSEGSSMTVNCSYETKQYPSLFWYVQFPGEGPQLLFRVSKANDKGSSRGFEATYDKETTFFHLQKASLQESDSAVYYCALS
Meriones unguiculatus V497 trav NHTI01008008.1 3767 RTHGDSVTQTESQVVLSEDEFLTIHCNYSASGYPTLFWYVQYPGEGPQLLFRASKANDKGSNKGFEATYDKETKSFHLQKASVQESDSAVYYCALS
Meriones unguiculatus V498 trav NHTI01008008.1 29162 VSSQQKVQQNPESLSVPEGAMASLNCTFSDSASQTFWWYRQHSGKGPQALMSIFSNGDKEEGRFTVHLNRASLHVALHIRDSQPSDSAVYLCAV
Meriones unguiculatus V499 trav NHTI01008008.1 43166 VKGQKVEQGPATLVLQEGENATLHCNFSTAISQMQWFHQSPGGHLISLFYNPFGTKQSGRLTSTTVPAERRSSLYISSSQTTDSGTYLCAVDPQCS
Meriones unguiculatus V500 igkv NHTI01008166.1 9239 TCADIVMTQSPSSLAVSAGEKVTISCKSSQSLTLVGLNFLSWYQQKPGQSPKLLIYWASNRYTGVPDRFTGSGSGTDYTLSISSVQAEDLAVYYCMQGKSTP
Meriones unguiculatus V501 igkv NHTI01008166.1 27732 ACADIVMTQSPSFLAVSAGEKVTIRCRSSQSLLHTLIRENVLSWYQQKPGQSPKLLIYRASNRYTGVPDRFTGSGSGTDFTLSISSVQAEDLAVYYCQQHYAYP
Meriones unguiculatus V502 trav NHTI01008473.1 2645 GVRGAGMEQSPSVLSLQEGTSSALRCNFSTTMRSVQWFRQNPQGSLISLLYVAAGTKENGRLKSTFDFKESYSALHIRDAQLEDSGTYLCAAE
Meriones unguiculatus V504 trav NHTI01008738.1 20680 MSQGEQVEQHLSILRVQEGARAVINCTYTDSASNYFPWYKQEPGKGPQFIMDIRSNVDRKQNQRLTVLLDKKAKHFSLHITDTQPGDSALYFCAAS
Meriones unguiculatus V506 trav NHTI01008873.1 3370 GVRGAEVEQSPSVLSLQEGTSSALRCNFSTTMRSVQWFRQNPQGSLISLFYVAAGIKENGRLKSTFHSKESYSTLHIRDTQLEDSGTYLCAAE
Meriones unguiculatus V509 igkv NHTI01008989.1 36548 AEGNIVMTQSPEFMFASVGERITLSCKSSQSVGSYVAWYQQKSGQPPKLLIYDASTRYTGVSDRFIGSGSGTDFTLSISSVQAEDLAVYYCQQRYSYP
Meriones unguiculatus V513 igkv NHTI01009217.1 20199 AEANIVMTQSPEFMSTSVGERITLSCKSSQNVGTAIAWYQQKSGQPPKLLIYSASSRYTGVPDRFTGSGSGTDFTFSISSVQAEDLAVYYCQQYSSYP
Meriones unguiculatus V515 igkv NHTI01009610.1 30653 TCADIMMTQSPSSLAVSAGDKVTISCKSSQSLTLGRLNYLAWYQQKPGHSPKLLIYWASSRQTGVPDCFTGSGSGTDFTLSISSVQAEDLAFYYCQQYLLYS
Meriones unguiculatus V517 igkv NHTI01009659.1 13937 STRNIVLTQFPASLAVSLGQKVTISCKASESVNKFGINLMHWYQQKPGQPPKLLIFNVYSLESGIPARFSGDEDELNFTLTIHPVEADDVATYYCQQGL
Meriones unguiculatus V518 igkv NHTI01009659.1 29046 AQGNIVMTQSPKVMSTSVGDRITLSCKSSQNVDNYVAWYQQKSGQPPKVLISYASNQHTGVPYRFTGSGSGTDFTLSISSVQTEDLAVYYCQQHYDYP
Meriones unguiculatus V519 trav NHTI01009715.1 6795 VKGQKVEQRPATLVLQEGENATLQCNFSTAISQMQWFYQSPGGHLISLFYNPFGTKQSGRLTSTTVPAERRSFLYISSSQTTDSGTYLCAVDPQCS
Meriones unguiculatus V520 trdv NHTI01009715.1 15426 QKVTEVQPAIHKQEGKQVIMDCSYETSMSFYQLYWYKQRPSGDMIFLIRQVSSSYHNESSGRYSVIFQKSAKSISLIISASRVEDSLKYFCALEEPAPGV
Meriones unguiculatus V521 trav NHTI01009715.1 31611 TSMAQKVTQAQTSVSVMEEKTVTLDCVYKTESAYYLFWYKQTTSGEMIFLIRQDSYQKENATEGHYSLNFQKSESSIGLIISATQIKDSAVYLCAMRE
Meriones unguiculatus V522 trav NHTI01009715.1 34623 RSNGDSVTQTEGLVTVTEGMPVMLNCTYQTTYSDRVLFWYVQYLNEAPQLLLRSITDNRRTEHLGFHATLHKSSSSFHLQTSSVQLSDSALYYCALG
Meriones unguiculatus V523 ighv NHTI01010064.1 19562 VHSQVQLQQSGAEVGRPGSSVKLSCKASGYNFASNNMHWVKQSPGQGLEWIGWIYPGNGNTGYNQKFRGKATLTADTSSSTAHMELRSLTAEDSAVYYCARG
Meriones unguiculatus V524 ighv NHTI01010064.1 32818 VHSEVQLQQSGAEVGRPGSSVKLSCKASGYSFTSYYMGWVKQSPGQGLEWIGWIYPGSDDTSYNQKFRGKATLTADTSSGTAHMELRSLTAEDSAVYYCARD
Meriones unguiculatus V527 igkv NHTI01010516.1 22722 ILMTQTPSSLAVSTEEKVTISCRSSQNLYYSGNQKNYLAWHQQKPGQSPKLLIYWASTLHTGVPDRFTGSGSGTDFTFSISSVQDDDLAVYYCQQGISDP
Meriones unguiculatus V532 igkv NHTI01010922.1 23220 AEGNIVMTQSPEFMSTSVGDRITLSCKSSQNVNKYVAWYQQKPGQPPKPLIYYASNRYTGVPDRFTGSGSGTDFTLSISSVQAEDLAVYYCQQYNSYP
Meriones unguiculatus V534 trav NHTI01011317.1 13047 TGSLAKTTQPLSMDSYEGREVNVSCSHANIATSEYIYWYRQVPREGPHFIIQGYKDNVANEVASLFISADRKFSTLSLPLVSLGDSAVYYCIVA
Meriones unguiculatus V535 trav NHTI01011317.1 19353 ASRGERVDQSPSHLSVQEGASAVITCTYTDDNSYYFSWYKQEPGAGLQFFTNVISGMDRKEEQGLIVLLNKKEKHLSLNITAARPGDSATYFCAAS
Meriones unguiculatus V537 trav NHTI01011414.1 20677 RIHGYSVTQKQGQVTLSEGNFLLINCTYSATGYPTLFWHVRYPGEGLQLLLKVITAGEKGSSRGFEATYDKRTTSFHLQKALVQESDLAVYYCALS
Meriones unguiculatus V538 trav NHTI01011414.1 23977 VSSQLKVEQIPESLSVPAGAMASLNCTFSDRNSQYFWWYRQHSGKGLEALMSVFSNGDKEEGRFTAHLNKARLHVALHIRDSQPSDSAVYLCAV
Meriones unguiculatus V539 igkv NHTI01011466.1 1727 ACADIVMTQSPSSLAVSEGEKVSVSCRSSQSLYYIGNQKNLLSWYQQKPGKSPKLLIYWASIRHTGVPDRFTGSGSGTDYTLSISSVQAEDLAVYYCQQGIS
Meriones unguiculatus V540 igkv NHTI01011581.1 24185 ACADIVMTQSPSSLAVSAGEKVSISCRSSQSLYHSSSKKNLLAWYQQKPGQSPKLLIYHASTRYTEVPDRFTGSGSGTDYTLSISSVQDEDLAIYYCQQGISYP
Meriones unguiculatus V542 trav NHTI01011862.1 18667 MSQGEQVEQQPSILRVQEGARAVINCTYTDSASNYFPWYKQEPGKGPQFIIDIRSNVDRKQNQRLTVLLDKKAKHFSLHITDTQPGDSAMYFCAAS
Meriones unguiculatus V543 trgv NHTI01012013.1 13282 GLGQLEQTEMSVTGLTGESAQIPCKVSLPDFGNTYIHWYCQKTNRKFEYLLYVKTSYNQLTLNGKNKKIEGSKDFQTSTSTLKVNFLKKEDEATYYCAAWIL
Meriones unguiculatus V544 trgv NHTI01012013.1 17184 GLGQLEQTEMSVTGLTGESAQIPCKVSLPDFGNRYICWYRHKTKQQVEYLMYVRMGYNQLPLEGKNKKIEGTKDFQTSTSTLKVNFLKKEDEATYYCAVLIL
Meriones unguiculatus V547 ighv NHTI01012759.1 6145 VQCEVQLVESGGGLVQPGKSLKLSCVASGFTFSNYYMHWVRQAPGKGLEWVAYINKDGGSTYYADAVKGRFTISRDNAKNTLYLQMNSLRSEDTATYYCAR
Meriones unguiculatus V550 igkv NHTI01013122.1 15601 TCADIVMTQSPSSLAVSAGEKVSISCRSSQSLLGSKSQKNLLSWYQQKPGQSPKLLIYWASTRHTGVPDRFTGSGSGTDYTLSISSVQAEDLAVYYCMQDKSIP
Meriones unguiculatus V553 igkv NHTI01014136.1 2869 ACADIVMTQSPSSLAVSQGEKVSISCKSSQNLLGSKSQKNVLSWYQQKTGQSPKLLIYYASTRHTGVPDRFTVSGSETDFTLSISSVQAEDLAVYYCMQGKSTP
Meriones unguiculatus V554 igkv NHTI01015873.1 2443 AEGNIVMTQSPEFMSTSVGDRITLSCKSSQNVHKYVAWFQQKSGQPPKLLIYDTSTRHTGVPDRFTGSRSGTDFTFTISSVQDDDMAVYYCQQHNSYP
Meriones unguiculatus V555 trav NHTI01015999.1 4097 MSQGEQVEQHPSILRVQEGASAVINCTYTDSFSNYFPWYKQEPEKGPQFIIDIRGNVDRKQNQRLTVLLDKKAKHFSLHITDTQPGDSAMYFCATS
Meriones unguiculatus V556 trav NHTI01016009.1 9443 ERVDQSPSHLSVQEGASAVITCTYTDGNSYYFSWYKQEPGAGLQFFTNVISGVDRKEEQGLIVLLNKKEKHLSLNITAARLGDSATYFCAASVQCPP
Meriones unguiculatus V557 trav NHTI01016437.1 3847 ESRGEQVKQHPSSLSVQEGDSAVINCTYTDSASAYFPWYKQEPGKGPQFIIDIRPNMERKQNQRLSLLLDKKEKHLSLQVTATQPGDSAIYFCTA
Meriones unguiculatus V558 igkv NHTI01016632.1 7590 ASADIVVTQSPSSLAVSAGEKVTISCRSSQRLSYSKDPKNFVAWYQQTPGQSPKLLIYYTSSLEKGVFDRFIGSGSERDFTLTIRRVQAEDLAVYYCQRGYNNV
Meriones unguiculatus V560 igkv NHTI01018615.1 2135 TCADIMMTQSPSSLAVSAGEKVTISCKSSQNLTSGGSNFLSWYQQKPGQSPKLLISWASTRHTGVPDRFTRSGSGTDFTLSISSIQDEDLAVYYCQQYYSNP
Meriones unguiculatus V561 trav NHTI01018642.1 273 MSQGEQVEQHPSILRVQEGARAVITCTYTDSASDYFPWYKQEPEKGPQYIMDIRGNVDRKQNQRLTVLLDKKAKHFSLHITDTQPGDSAMYFCAVS
Meriones unguiculatus V562 ighv NHTI01019477.1 1870 VQCDVQLVESGGGLVQPGKSLKLSCLASGFTFSSYWMHWVRQAPGKGLEWVANIKYDGSSTNYANAVKGRFTISRDNAKNTLYLQMNSLRSEDTATYYCAR
Meriones unguiculatus V566 igkv NHTI01020059.1 3804 AEGNIVMTQTPEFMSTSVGERITLSCKSSQSVSGWVAWYQQKPGQPPKLLIYRASNRYTGVPDRFTGSGSGTDYTLAISSVQAEDLAVYYCQQYSNYP
Meriones unguiculatus V567 igkv NHTI01020522.1 1494 AEGNIVMTQSPEFMSKSVGDRITLSCKSSQSVRSYVAWYQQKPGQPPKLLIYGVSNRYTGVPARFTGSGSGTDFTFTISSVQAEDLAVYYCQQYDYTP
Meriones unguiculatus V568 trav NHTI01021181.1 512 DTSAQSVTQPDAQVTVSEDASLQIRCNYSSSVPPRLFWYVQYPRQGLQLLLSYYSGDPVVHGMNGFEAEFLKSDSSFILRKARVHWSDSAVYFCALS
Meriones unguiculatus V569 trav NHTI01021949.1 648 RSNGDSVTQTEGLVTLTEGMPVMLNCTYQTTYTNPSLFWYVQYLNKAPQLLLKSSTDNKRTEQRGFHATLHKSSSSFHLQMSSVQLSDSALYYCALG
Meriones unguiculatus V570 igkv NHTI01022980.1 2490 ACADIVMTQSSSFLAVSAGEKVSISCRSSQSLYYSGNNYLAWYQQKPGQSPKLLVYWASTRHTGVPDRFTGSGSGTDFTLSISSVQAEDLAVYYCQQYFEDP
Meriones unguiculatus V571 iglv NHTI01025007.1 2123 SWGQFQLTQPNSVSASPGSTVSLSCRRSSGNIGDSYVYWYQQRLRRSPSLVIYKDNNRPSGIPDRFSGSIDSSSNSASLRISNLQAEDEADYFCQSGGY
Meriones unguiculatus V572 igkv NHTI01025466.1 3219 ACADIVMTQSPSSLAVSPGEKVSISCRSSQSLYYSSNQKNYLSWYQLKPGQSPKPLVYWASPRHTGVPDRFTGSGSGTDYTLSISSVQAEDLAVYYCMQSVSTP
Meriones unguiculatus V573 ighv NHTI01027439.1 134 ILSQVQLQESGPELVKPTQSLLLTCSVSAYSITTRNSYWHWIRKFTGNKLEWMGYIGYSGGTSYNPSLKSRISITRETSKNQFFLQLSSVTTEDTATYYCAS
Meriones unguiculatus V574 trav NHTI01028633.1 2294 VVGKTQVEQSPESLVVLEGESCVLQCKYSVSPFNNFRWYKQDTGRGPMSLAIMTYAEKKRSNGRYSAILDADAKHSTLHITASLLEDRASYICVVG
Meriones unguiculatus V575 ighv NHTI01028714.1 1944 VQCDVQLVESGGGLVQPGKSLKLSCVASGFTFSSYWMSWVRQAPGKGLEWVAYINTGGGSTYYADAVKGRFTISRDNAKNTLYLQMNSLKSEDTATYYCAR
Meriones unguiculatus V577 trav NHTI01029715.1 2000 RIYGDSVTQKQGKVTLSEGIFLLINCRYSATGYPTLVWYVQYPGEGPQLLLKVITAGEKGSSRGFEATYDRGTTSFHLQKASVQESDSAVYYCALS
Meriones unguiculatus V579 igkv NHTI01032573.1 2151 AEGDIVMTQSPEIMSTSVGDRISLSCKSSQSVGSYVAWYQQKPGQSLKRLNYYASSRDTGVPDRFTGSASGTDFTLSISSVQDEDLEVYYCQQGYSTP
Meriones unguiculatus V580 igkv NHTI01033011.1 528 TCADITMTQSPSFLAVSAGEKVTISCRSSQSLLSSKDQKNYLAWYQQKPGQSPKLLIYYASTRHTGIPDLFIGSGSGTDFTLTISSVQAEDLADYYCQQHYTA
Meriones unguiculatus V581 ighv NHTI01036038.1 1293 VQCEVQLVESGGGLVQPGKSLKLSCVASGFTFSSYSMDWVRQAPGKGLEWVAYISSGSSSIYYAEAVKGRFTISRDNAKNTLYLQMNSLRSEDTATYYCA
Meriones unguiculatus V582 igkv NHTI01036371.1 1893 TSGDIMMTQSPSSLAVSAGEKVTISCKSSQSLLNTGNQKNYLSWYQQKPGQSPNLLIYYASTRHTGVPVRFSGSGSGTDFTLTISSVQAEDLAVYYCQQGYSYP
Meriones unguiculatus V583 igkv NHTI01036425.1 204 AEGDIVMTQSPEIMSTSVGERISISCKSSQSVYNDVAWYQQKSGQPPKLLIYGASTRQTGVPDRFTGSGSGTDYTFTISSVQDDDLAFYYCQQHYTP
Meriones unguiculatus V584 igkv NHTI01036748.1 1127 AYADIVMTQSPSSLAVSAGEKVTISCRSSQSLLDSTEQKNYLSWYQQKPGQSPKLLIYWASTRDTGVPDHFTGSGSGTDFTLSISSVQDEDLAVYYCLQEFSTP
Meriones unguiculatus V585 trav NHTI01038238.1 1203 VKGQQVEQRPATLALQEGENATLQCNFSSTATQLQWFYQSPGGPLISLFYNPSGTKQSGRLTSTTVTMELRSSLYISSSQTTDSGTYFCAVEPQCS
Meriones unguiculatus V589 trav NHTI01040671.1 1247 RTHGDSVTQTEGQVVLSENEFLTIHCNYSASGYPALFWYVQYPGEGPQLLFRASKANDKGSSRGFEATYDKETKSFHLQKASVQVSDSAVYYCALS
Meriones unguiculatus V590 igkv NHTI01041055.1 910 ACADIVMTQSPSSLAVSAGEKVSISCRSNQSLYYSDNQKNLLSWYQQKPGQSPKLLMYWASTRYTGVPDRFTGSGSETDYTLSISSVQDEDMAVYYCQQNYDYP
Meriones unguiculatus V591 trav NHTI01042592.1 651 VSSQLKVEQIPESLSVPEGAMASLNCTFSDRNSVYFWWYRQHSGKGLEVLMSIFSNGDKEEGRFTAHLNKGSLHVSLHIRDSQPSDSAVYLCAVR
Meriones unguiculatus V592 ighv NHTI01046330.1 688 VLSQVQLKESGPALLKPSQPLSLTCAVTGYSISSGYWWSWIRQRPGKGLEWMGHIDYDGATNYNPSLKSRITITVDTAKNQFSLRLSSVTTEDRAVYYCAR
Meriones unguiculatus V1088 igkv NHTI01012948.1 4656 GEGNIGMTQSPEFMSTSVGERISLSCKSSQNVGTAIAWYQQKSGQPPKLLIYSASSRYTGVPDRFTGSGSGTDFTLSISSVQAEDLAVYYCQQYSSYP
Meriones unguiculatus V1089 trav NHTI01013339.1 9018 GTRGMQVEQSPPALSLHEGTSSALRCNFSTTMESVQWFRQNPQGSLINLFYLALGTKENGRLKSTFDSKESYSTLHIRDAQLEDSGSYLCAAE
Meriones unguiculatus V1090 igkv NHTI01013962.1 8112 ACADIVMTQSPSSLAVSAGEKVSISCRSSQSLLYSKDQKNYLVWFQQKPEQSPKRLIYYVSNLDTGVPDRFTGSGSGTDFTLSISSVQAEDLAVYYCLQHYKHP
Meriones unguiculatus V1094 trav NHTI01015860.1 1680 AVQTQSVTQSDAQVTVFEGESLELKCSYVGAPYLFWYIQHRGRGPQLLLRYYSGDSVVHGMNGFEAEFSKKDSSFNVRKAPVHWSDSAVYFCALS
Meriones unguiculatus V1095 igkv NHTI01016317.1 5126 IMMTQSPSSLAVSEGEKVSISCRSSQSLFDSTDQKNYLAWYQQKPGQCPKQLIYWASTRDTGVPDHFTGSGSGTDYTLSISSVQAEDLVVYYCLQTYSDP
Meriones unguiculatus V1097 ighv NHTI01017195.1 4186 VQCDVQLVQSGGGLVQPGKSLKRSCAASGFTFSDYSMNWVRQAPGKGLEWVSWIRYDGGSTAYADAVKGRFTISRDNARNTLYLQMNSLRSEDTATYYCAR
Meriones unguiculatus V1099 igkv NHTI01018005.1 7466 ACADIVMTQSPSSLAVSSGEKVSISCRSSQSLYHSSSKKNLLYWYQQKPGQSPKLLIYHASTRYTGVPDRFTGSGSGTDYTLSISSVQDEDLAVYYCLQGISAP
Meriones unguiculatus V1100 igkv NHTI01018005.1 575 ASADIVVTQSPSSLALSAGEKVTISCRSSQRLSYSKDPKNYVAWYQQKPRQSPKLLIYYTSSMEKGVFDSFIGSGSQKDFTLTIRKVQAEDLAVYYCQQGYNNV
Meriones unguiculatus V1104 trav NHTI01021451.1 4164 VSSQQKVQQNPESLSVPEGAMASLNCTSSDPNFQYFWWYRQHSGKGLEALMSIFSNGDKEEGRFTAHLNKGSLHVSLHIRDSQPSDSAVYLCAV
Meriones unguiculatus V1105 trav NHTI01021732.1 470 ESRGEQVKQHPSSLSVQEGDSAVINCTYTDSASAYFPWYKQEPGKGPQFIIGIHSNMERKQNQRLSLLLDKKEKHLSLHVTATQPGDSAIYFCTAD
Meriones unguiculatus V1107 igkv NHTI01023935.1 605 AEGDIVMTQSPEIMSTSVGDRISLSCKSSQSVGSYVAWYQQKPGQSLKQLIYYASTRDTGVPDRFTGSASGTDFTLSISSVQDEDLAVYYCQQGYSTP
Meriones unguiculatus V1108 trav NHTI01024035.1 1194 EGRHDQQQVRQSPQSLTVWEGETTVLNCTYKNSAFDYFSWYRQFPAEGPTLLIAIRSVSNKKEEGQFTVFFSKSDKQLSLHIADSQPGDSATYFCAAR
Meriones unguiculatus V1109 igkv NHTI01025105.1 683 TSGDIMMTQSPSSLAVSAGEKVTISCKSSQSLLNTGNQKNYLSWYQQKPGQSPNLLIYYASTKHTGVPDRFSGSGSGTDFTLIISSVQAEDLAVYYCQQGYSYP
Meriones unguiculatus V1110 trav NHTI01025509.1 1551 RTHGDSVTQTGGQVTISEGKFLIINCTYSTTSIAYPALFWYVQYPGEGPQLLLKVITAGEKGSSRGFGATYDKGTTSFHLQKASVQESDSAVYYCALG
Meriones unguiculatus V1111 trav NHTI01026020.1 723 RSNGDSVTQTEGLVTLTEGMPVMLNCTYQTTYSTHFLFWYVQYLKKAPQLLLRSSTDNKRTEHRGFHATLHKSSSSFHLQTSSVQLSDSALYYCALG
Meriones unguiculatus V1112 igkv NHTI01026780.1 1296 AEGDIVITQSPEIMSTSVGDRITLNCKSSQNVGSYVHWYQQKPGQPPKLLISYASHRYTGFPNRFTGSGSETDFTLSIRDVQAEDLADYYCQQSKSYP
Meriones unguiculatus V1113 igkv NHTI01027718.1 804 TCADIMMTQSPSSLAVSAGDKVTISCKSSQSLTLGRLNYLAWYQQKPGHSPKLLIYWASSRQTGVPDRFTGSGSGTDFTLIISSVQAEDLAFYYCQQYRSTP
Meriones unguiculatus V1115 igkv NHTI01033366.1 535 ACADIVVTQSPSSLAVSEGEEVTISCRSSQSLLYSKDQKNYLGWYQQKPGQSPKLLIYYASTRHTGVPDRFTGSGSGTDFTLTISSVQAEDLAVYYCLQTYSDS
Meriones unguiculatus V1116 trav NHTI01033706.1 579 LSSQQKVQQIPESLSVPEGAMASLNCTFSDRNSLYFWWYRQHSGKGLEAMMSIFSNGDKEEGRFTAHLNKGSLHVSLHIRDSQPSDSAVYLCAV
Meriones unguiculatus V1117 trav NHTI01034007.1 2308 GVRGAEVEQSPSVPSLQQGTSSALRCNFSTTMRGVQWFRQNPQGSLISLLYVAAGTKENGRLKSTFHSKESYSALHIRDTQLEDSGTYLCAAE
Meriones unguiculatus V1118 trav NHTI01036147.1 1542 RSNGDSVTQTEGLVTLTEGLPVMLNCTYQTTYPNPFLFWYVQYLNKAPQLLLRSSTDNKKTEHRGFHTTLHKSSSSFHLQASSAQLSDSALYYCAVR
Meriones unguiculatus V1121 trav NHTI01040860.1 1473 ESRGEQVKQHPSSLSVQEGDSAVINCTYTNSASAYFSWYKQEPGKGPQFIIDIRSNMERKQNQRLSLLLDKKEKHLSLHVTATQPGDSAIYFCTAD
Meriones unguiculatus V1122 trav NHTI01044034.1 393 MSQGEQVEQHPSILSVQEGASAVINCTYTDSASEYFPWYKQEPGKGLQFIMDIRSNVDRKQNQRLTVLLDKKAKHFSLHITDTQPGDSAMYFCAAS
Meriones unguiculatus V1123 trav NHTI01048044.1 1376 AVQTQSVTQSDAQVTVFEGDSVELKCNYSYGGALYLFWYIQHRGRGPQLLLRYYSGDPVVHGVNGFEAEFSKKDSSFNLRKAPVYWSDSAVYFCALS
Meriones unguiculatus V1124 trav NHTI01048432.1 926 VSSQQKVQQNPESLSVPEGAMASLNCTFSDRNSLYFWWYRQHSGQGPKALMSIFSNGDKEEGRFTAHLNKASLHVTLHIRDSQPSDSAVYLCAV
Meriones unguiculatus V1125 trbv NHTI01049965.1 1552 DMEAAVTQSPRNKVTVTGGNVTLSCYQNNNHDYMYWYRQDMGNGLRLIHYSYGAGITEKGDVPDGYKASRPRTEDFSLVLELASPSQTAVYFCASSD
Meriones unguiculatus V1126 trdv NHTI01052477.1 946 CNVAQKVTQVQSTASSQYGEVTLDCSYETSYYYYQFIWYKQLVTGEMIFLISQLSSSTENERNGRYFVTWQKSANSISLVISASQLEDSGTYFCALREL
Meriones unguiculatus V1127 igkv NHTI01053605.1 324 NCADITMTQSPSSLAVSAGEKVTISCRSSQSLLSSKDQKNYLAWYQQKPGQSPKLLIYYASTSYTGVPDRFTGSGSGTDFTLTISSVQAEDLADYYCQQHYSA
Meriones unguiculatus V1129 trav NHTI01056898.1 548 ESQGEQVKQHPSSLNVQEGDSAVINCTYTDSASAYFPWYKQEPGKGPQFIIDIRSNMERKQNQRLSFLLDKKEKHLSLQVTATQPGDSAIYFCTAD
Meriones unguiculatus V1130 trav NHTI01057670.1 632 VAGKTQVEQSPESLVVLEGESCVLQCKYSVSPFNNLRWYKQDTGRGPVSLAIMTYAENKRLNGRYSAILDADAKHSNLHITASLPEDTASYICVVG
Meriones unguiculatus V1131 igkv NHTI01059961.1 557 GCADIVMTQSPSSLALSEGEKVTICCRSSQSLLYSKDQRNYLAWFQQKPGQSPKWLIYYASNLDTGVPVRFTGSGSGTDFTLTIHSVQAEDLAVYYCLQ
Meriones unguiculatus V1133 trav NHTI01066907.1 698 RTHGDSVTQTGGQVTISEGKFLTINCTYSTTSIAYAALFWYVRYPGEGPQLLLKVITAGEKGSSRGFGATYDKGTTSFHLQKASVQESDSAVYYCALS
Meriones unguiculatus V1134 trdv NHTI01066923.1 1038 TSMAQKVTQAQTSVSVMEEKTVTLDCVYETRESAYSLFWYKQTTSGEMVFLIRQESYQKENATEGHYSLNFQKSGSSIGLIISATQIEDSAVYFCAMRE
Meriones unguiculatus V1135 trav NHTI01067010.1 747 RTHGDSVTQTEGQMVLSEDEFLTIHCNYSASGYPALFWYVQYPGEGPQLLLKVITAGEKGSSRGFEATYDRGTTSFHLQKASVQESDSAVYYCALG