WGS Statistics
Organism WGS Record. Vs Total IGHV IGLV IGKV TRAV TRBV TRGV TRDV
Acinonyx jubatus LLWD00000000.1 (LLWD01) 131 23 31 9 41 15 6 6
Vgene Table
Organism Vgene Locus contig Contig Pos. AA sequence
Acinonyx jubatus V16 trgv LLWD01000035.1 1929059 GVAAISVEQPAVVVARAGSWATLPCKTSTSVSYIHWYRHQEGTAPKRILMLDMSSSYVTRDGVLTADKVHAKKGKDSTSSNLLLLKLAKSDEGVYYCAVWEDQ
Acinonyx jubatus V17 trgv LLWD01000035.1 1977099 GEAAISLTQQAVVVGRVGSSATLSCQVSTYVSYIHWYLHQEGTAPKRILMLDMSRLYVQRYGGLKADKIDAKKGKESNSCELSVKKLQKSDEGVYYCAAWE
Acinonyx jubatus V110 trbv LLWD01000234.1 3588275 PLDTAVSQTPKYLIAQMGTEKFLQCEQKLSHDAMYWYKQDSKKLLKIMFAYNNKELIHNETVPSRFSPKSPDKARLNLRVSALETGDSAVYLCASS
Acinonyx jubatus V111 trbv LLWD01000234.1 3591807 PGDTAVTQTPKHLVAATGSKETLKCEQRLGHNAMYWYKQSAQRPPKLMFAYSYKELAENDSVPSRFTPKCSDSSHLHLHVAALQPEDSAVYLCASSE
Acinonyx jubatus V112 trbv LLWD01000234.1 3611859 HTGAGVLQSPRHKVTKRGRDVDLRCDPISGHAGLYWYRQAVGQGPEFLVSFQNKHKVDSSGMPSNDRFQVNRSEGSYSILQIKRAEPGDSAVYLCASSP
Acinonyx jubatus V113 trbv LLWD01000234.1 3626744 HTGAGVLQSPRHKVTKRGRDVDLRCDPISGHAGLYWYRQAVGQGPEFLVSFQNKHKVDSSGMPSNDRFQVNRSEGSYSILQIKRAEPGDSAVYLCASSP
Acinonyx jubatus V126 trav LLWD01000259.1 1142706 GLRAQSVSQPDQVTVAEGDPVTVKCNYSVSGSPYLFWYVQHRNQGLRFLLKYITGANLVKGNYGFEAEFNKSQTSFHLKKPSVLGSDSAVYFCEVT
Acinonyx jubatus V127 trav LLWD01000259.1 1145219 GTGAQSVTQPDVHITVSEGAPLELRCNYSSSVQVYLFWYVQHPNQGLRLLLKYISGDILVKGTEGFEAEFRKSEKAFHLRKPAVQWSDAAKYFCAVS
Acinonyx jubatus V128 trav LLWD01000259.1 1150227 TLSLAKTTQPVFIESYEGQEVNIPCNHTKIATNEYIHWYRQFPNQGPQFVIQGYKTNVENEVASLFISADRTSSTLNLPRAALRDTAVYYCTVSD
Acinonyx jubatus V129 trav LLWD01000259.1 1151955 GVRGMDVEQTPAALSLQEGASSTLRCNFSSSVTNVQWFRQNPGGGSLTRLFYIASGMKQDGRLNCTVNTKDRHSSLHIRASQQEDSATYLCAVQ
Acinonyx jubatus V130 trav LLWD01000259.1 1157789 MSRGEEVKQHPSFLSVWEGDSFVINCTYTDSASTYFFWYKQQPGKGLQLLIYTVSSMDKKQEQRLTVLLNKKDKHLSLQVTRTHPGDSATYFCAVR
Acinonyx jubatus V131 trav LLWD01000259.1 1177964 DTSAQSVTQLDGHVTVSEKAHLELRCNYSYGATPNLFWYVQYPNQGLQLLLKYFSGPPNVLVQGIKGFQAEFRKNETSFHLRKHSAHWSDSAKYFCAAS
Acinonyx jubatus V132 trav LLWD01000259.1 1182707 GSKGDSVTQMEGQMTLSERASLTVNCSYETTQYPALFWCVQDPGEGPQLLLKALKANEKGSSKGFEATYHKEPNSFHLKKSSVQVSDSAVYYCALR
Acinonyx jubatus V133 trav LLWD01000259.1 1199451 GVRGMDVEQTPAALSLQEGASSTLRCNFSSSVTNVQWFRQNPGGGGLTRLFYIASGMKQDGRLNCTVNTKDRHSSLHIRASQQEDSATYLCAVQ
Acinonyx jubatus V134 trav LLWD01000259.1 1205222 LSRGENVEQSPSTLSVQEGNSSVITCSYSDSASYYFPWYKQELGKGPQLIIDIRSSVAKKEDQRLTVLLNKTAKHLSLHIAAAQPADSAVYFCAAS
Acinonyx jubatus V135 trav LLWD01000259.1 1231945 QTHGDSVTQMEGPVTLFEGEPLTINCTYSTAVSPTLFWYVQYPGEGPQLLLKALRDKEKGSHKGFEATYDGKSKSFHLEKASVQASDSAVYYCVLR
Acinonyx jubatus V136 trav LLWD01000259.1 1247998 QTHGDSVTQMEGPVTLSEREYLTINCTYSTTGTPTLFWYVQYPGEGPQLLLKAFRDTEKGSHKGFEATYDGKSKSFHLEKASVQASDSAVYYCVLR
Acinonyx jubatus V137 trav LLWD01000259.1 1257217 GVRGMDVEQTPAALSLQEGASSTLRCNFSSSVTNVQWFRQNPGGGGLTQLFYIVSGMKQDGRLNCTVNTKDRHSSLHIRASQQEDSATYLCAVQ
Acinonyx jubatus V138 trav LLWD01000259.1 1274566 QTHGDSVTQMEGPVTLSEREYLTINCTYSTTGTPTLFWYVQYPGEGPQLLLKAFRDTEKGSHKGFEATYNRKSKTFHLEKSSVQVSDLAVYYCALT
Acinonyx jubatus V139 trav LLWD01000259.1 1289573 GVRGMDVEQTPAALSLQEGASSTLRCNFSSSVTNVQWFRQNPGGSGLTRLFYIASGMKQDGRLNCTVNTKDRHSSLHIRASQQEDSATYLCAVQ
Acinonyx jubatus V140 trav LLWD01000259.1 1293498 LSRGENVEQHPSTLSVQEGNSSVITCSYSDSASYYFPWYKQELGKGPQLIIDIRSSVAKKEDQRLTVLLNKTAKHLSLHIAAAQPADSAVYFCAAS
Acinonyx jubatus V141 trav LLWD01000259.1 1315697 GVRGMDVEQTPAALSLQEGASSTLRCNFSSSVTSVQWFRENPGGGSPTRLFYITSGMKQDGRLNCTVNTKDRHSSLHIRASQQEDSATYLCAVE
Acinonyx jubatus V142 trav LLWD01000259.1 1324085 LSRGENVEQSPSTLSVQEGNSCVITCSYSDSASNYFPWYKQELGKGPQLIIDIRSSVAKKEDQRLTVLLNKTAKHLSLHIAAAQPADSAVYFCAAS
Acinonyx jubatus V143 trav LLWD01000259.1 1328437 SSISQKVTQAPPAMLVQEKEAVILECTYDTSDPNYSLLWYKQPSRGEMIFLVRQDSHNQQNATEGRYSLNFQKARKSIHLVISASQLEDSAVYFCALRS
Acinonyx jubatus V144 trav LLWD01000259.1 1341271 RTHGDSVAQMEGRVTIPERKSLTINCTYSTTWTPTLFWYVQYPREGPQLLLKALRDKEKGSHKGFEATYDGKSKSFHLEKASVQASDSAVYYCVLR
Acinonyx jubatus V145 trav LLWD01000259.1 1348782 VSGKNQVEQHPPSQIIQEGENCTFQCNYTVSPFSHLKWYKQGTGRSPAFLIIVTDDDSKNPGGRYTVTLDATSKHSSLHITAAQLSDSAVYICVVS
Acinonyx jubatus V146 trav LLWD01000259.1 1360960 MRSHQNEVKQSPVPLTVLEGVTAFLNCSYSDSASQYFVWYRQYSGKGPEFLMHMYSNGEKEEGRFTGLLNKASRYLSLFIRDSQLSDSATYLCAV
Acinonyx jubatus V147 trav LLWD01000259.1 1364915 GTGAQSVTQPDAQVLVSEGARLELKCNYSSSGTTYVFWYVQYPNQGLQLLLKYISGDTLVKGINGFEAEFKKSETSFHLRKSPALGSDAAKYFCAVS
Acinonyx jubatus V148 trav LLWD01000259.1 1370751 GTRAQTVTQPEDHLSVFTGDPVQVKCNYSYSGSPVLFWYVQYPKQGLQLLLKHISGGSVKGFTASLNQGEMSFHLKKPSAQEEDSAMYYCVLG
Acinonyx jubatus V149 trav LLWD01000259.1 1375560 VNSQQEQDHQTLSIQEGENATMNCSYKTSINYLQWYKQDSGRGLVLLILIRLNEREKNSGRLRVTLNSSLKSSSLSITASQTADTATYFCATD
Acinonyx jubatus V150 trav LLWD01000259.1 1382021 GINGDSVTQTEGSVTLFEGTPLTLNCTYQSSYTVFVFWYAQYQNKAPQLLLKSLSENQRAEHHGFHASLVKSDSSFHLQKRSVRMSDSAVYYCVLG
Acinonyx jubatus V151 trav LLWD01000259.1 1396827 ASMAQKVTQAQPAISMPEKEAVTLDCVYEASGYTYYLFWYKQPPSGEMILLIYQESYSEQNATEGRYSLNFQKPDRSISLTITALQLRDSAVYFCALR
Acinonyx jubatus V152 trav LLWD01000259.1 1422142 VSSKQEVMQSPEALNVQEGDSVVLNCSYTGSTFYSLQWFRQDPGKGLTVLLLIQSAQREETSGRIKASLDKPSKHSALYIAASQPSDSATYLCAIE
Acinonyx jubatus V153 trav LLWD01000259.1 1438175 GTGAQSLTQTDGHITVSEGARLELSCNYSSSGTTYLFWYVQHPNQGLQLLLKYFSGPSDALVQGIKGFEAEFKKSEKAFHLKKHSAHWSDSAKYFCAVS
Acinonyx jubatus V154 trav LLWD01000259.1 1443767 VTGLMVKQSPPDLSLQEGLSCTLQCNFSTSVTRVQWFRQNPGGHLIHLFYIPSGTKQNGRLRSTTVVEDRRSLLYISSLRTTDSAIYFCAGAE
Acinonyx jubatus V155 trav LLWD01000259.1 1451465 KSGQEQVKQGPPSLIVQEGAFSTLNCTYENTAFDYFVWYRQYPGQGPALLLAVFSVKRTKEDGRFTVFVSESAKQFSLHIMACQPGDSATYFCAAAS
Acinonyx jubatus V156 trav LLWD01000259.1 1472869 VNGQEIKQIPQFLLLQEGENFTIYCNSSRTLNSLHWYKQRPGGSPILLITLVKSGDVKQERLTAWFGDTRKNSLLHMVATQTADSGVYFCTGAQC
Acinonyx jubatus V157 trav LLWD01000259.1 1475224 GTGAQSVTQPDAQVLVSEGARLELKCNYSSSGTTYVFWYMQYPKQGLQLLLKYISGDILVKGLNGFEAEFRRNENSFHLRKSPAFGSDAAEYFCAVS
Acinonyx jubatus V158 trav LLWD01000259.1 1492408 VRVQMNVEQSPGVLNLQEGRNTFMMCNYSSIITSVQWFQQNPEGHLVSLSYITSGMQRKGRLIFTLNFQERNSHLHITDSQPGDSGTYFCTVE
Acinonyx jubatus V159 trav LLWD01000259.1 1498012 VNSQQNADQQQVKQTPSLSVQEREISILNCDYNNKMFDYFIWYKKYPAKSLEFVISIRSTVDKNEDERFTVYLNESAKHLSLHIAASQPGDSALYFCAAN
Acinonyx jubatus V160 trdv LLWD01000259.1 1515818 SGMAEKVIQMQNTIIIQEGKAATMECKYETSWSNYYTLYWYKQPPSGRMHFLIYQDESKPNAKQGRLSMNFQKTEKSIALTISLVQLADSAVYFCALSS
Acinonyx jubatus V161 trav LLWD01000259.1 1518947 IMSDAETTQPNAMESTEEESVRLPCNHSTISGSEYIHWYRQIPHHGPEYLIHGLKDNVTNGMASLTIAKDRKSSTLVLPRVTLRDAAVYYCITR
Acinonyx jubatus V162 trav LLWD01000259.1 1528573 VSSQELEQSPHSLIIQEGEDFTINCSSSKTFYTLGWYRQKNGEGLSSLMMLQKSGEEKSHEKITAKLDEKKQQTSLHITASQPSHSGIYLCAGD
Acinonyx jubatus V164 trav LLWD01000259.1 1542273 VSSEDKVIQSPPSLVVQEEDSATLNCSYQVTNFQSLLWFQQQENAPTFLFRQISNGIQKSGRLKGTLDKKALLSTLHITATQLGDSATYLCAVE
Acinonyx jubatus V165 trav LLWD01000259.1 1561718 SSMAQKVTQTQPEMSVHEAETMTLDCTFDTRVSNYYLFWYKQPPSGEMVLIIRQEANKQENATNNRFSVNFQRADKSFSLRISAAQLEDAAMYLCALME
Acinonyx jubatus V166 trav LLWD01000259.1 1568924 SSMAQKVTQTQPEMSVHEAETVTLDCMFDTSDSNYYLFWYKQPPSREMVLIIRQEANKQENATNNRFSVNFQRADKSFSLRISAAQLEDAAMYLCALME
Acinonyx jubatus V167 trav LLWD01000259.1 1601426 ASGKNGVEQSPQSLTAQEGNFVTINCSFSVGMTTLHWLQQNPGGGIVSLVILSLEMKKKGRIRATINTEELHSSLYITASQPRDSAIYLCAVE
Acinonyx jubatus V168 trdv LLWD01000259.1 1639526 SSNTQSVTQTPGPVNKQEGESVSLHCSFTLSYTYYVMSWFRQLSNGKMTEIIYLYSDSTNTKKGRYSVSHQKGNKALSLTITGLMPTDSGVYFCAVGEA
Acinonyx jubatus V169 trdv LLWD01000259.1 1654230 SSNTQSITQSPSSVQEKEGESVTLDCRFTLNFDYYVMSWYQQLSNRKMTEIIYLVSTRTNTREGRYSVSHWARDKTLRLTITGLMPTDSGIYFCALGKA
Acinonyx jubatus V170 trdv LLWD01000259.1 1666838 SSNTQSVTQYPSSVHKQEGESANLFCRFTLSYTYYVMSWFQQPSNGKMTEIIYLYSDSTNTKKGRYSVSYQARDKALRLTITGLMPTDSGVYFCAVGEA
Acinonyx jubatus V171 trav LLWD01000259.1 1750120 GSCKTEIIQSSNITAIIGTDVEFPCQYNIPDKNFESVYWYLQRADQRFTYIGHTSQGTVELEHYQLFVNRKLLSSTLTIKHVQPRDKAIYYCAV
Acinonyx jubatus V172 trdv LLWD01000259.1 1756516 VSLDIVLKPDTDTLTVLVGEPATFRCSITGGDWKNYQVSWYKKNEDNSLTLVYRLSNSSNANISSNYKGNIDALKGQCILDIQRATIKDTGTYYCASD
Acinonyx jubatus V256 igkv LLWD01000514.1 1623909 ACGAITMTQSPGSLAGSPGQQVTMNCRASQSVSSYLAWYQQKSGQRPKLLIYSASTRASGVPDRFSGSGSGTDFTLTISNLQAEDVASYYCQQYDSSP
Acinonyx jubatus V294 trgv LLWD01000624.1 33026 SWAAISLGQPSMVVAQAGRSATLWCKASTKVSYIHWYHHQEGAAPKRLLRLDMSGTFVQRDGGLKADKVNAKRGKDSNSCDLSVLKLEKSDEGMYYCAAWE
Acinonyx jubatus V295 trgv LLWD01000624.1 178257 GEAAISLTQQAVAVGRVGSSATLSCQARASVSYIHWYLHQEGTDPKRILMLDMSRLYVERYGGLEVDKIDAKKGKESNSCELSVKKLQKSDEGVYYCAAWE
Acinonyx jubatus V329 iglv LLWD01000768.1 1718816 SWAQSVLTQPPLVSGALGQTVTISCTVSDSSFWGGEFIHWYQQLPGAAQKLLIYGNNNRPSGVPSRFSGSKSGNSHSLTITGLQPEDEADYYCQYFDDRVI
Acinonyx jubatus V383 ighv LLWD01001112.1 37416 VLSQLTLRESGPGLVKPSQSLSLTCVVSGGSVTSSYYWNWIRQRPGRGLEWLGYWSGSTSYNPAFQGRISITADTAQSQFSLQLSSMTTEDTAVYYCAR
Acinonyx jubatus V386 ighv LLWD01001175.1 11279 VQCDVQLVESGGHLVKPVGSLRLTCVASGFTFSSNSMNWVCQALGKGLQWVAYIYDDGRSTNYADSVKGRFTISRDNAKNTLYLQMNSLKTEDTATYYCAR
Acinonyx jubatus V390 trdv LLWD01001256.1 731888 RGVLCDQVTQSPPYQTVASGSKVTLFCTYHTTYSNPDLYWYRIRPDRSFQFILYRDNTRSKDADFTQGRFWVWHSQSQKTFHLVISVEPEDSATYYCAIY
Acinonyx jubatus V393 ighv LLWD01001311.1 2358 VQCDVQLVESGGNLVKPGGSLRLTCVASGFTFSSYWMHWVRQAPGKGLQWVANIYTDGSSTNYADSVKGRFTISRDNSKNTLYLQMNNLKTEDTATYYCAR
Acinonyx jubatus V395 iglv LLWD01001341.1 39348 FMASSEVTQPPSVSVALGQTARISCSGDMMEKKYTNWHQQKPGQAPIQIIYKDSERPSGIPDRFSSSSSGKTVTLTISGARAEDKADYYCQSYDISSD
Acinonyx jubatus V396 ighv LLWD01001353.1 6949 VHSQVLLVQSGAEVRKPGASVKIFCKASGYSFTDYYMHWVRQAPAQGLEWMGRIDPEDGSTSYAQKFQGRLTLTADTSTNTAYMELSSLRSTDTAVYYCAR
Acinonyx jubatus V397 iglv LLWD01001358.1 12616 SVASYVLTQPPSVSVSLGQTARITCGGNNIESKSVHWYQQKSGQTPVLIIYSDSNRPSGIPDRFSGTNSGNTATLTISGAQAKDEADYYCQVWDSSSD
Acinonyx jubatus V398 iglv LLWD01001358.1 24900 SVASYELTQPPSVLVNLGQMARITCGGNNIGNKDAYWYQQKSGQAPMLIIYEDSKRPSGIPDRFSGTNSGNMATLTISGARAEDEADYYCQVWDSSSD
Acinonyx jubatus V399 iglv LLWD01001358.1 32579 SVTSNRLTQPPSISVALGEMARITCEGNNIGNTYVSWYQQKPNQVPLMIIYRDSNRPSGIPDRFSGSNSGNTATLTVSGARAEDEADYYCLSADSSSN
Acinonyx jubatus V400 iglv LLWD01001358.1 52057 SVASSELTQPPSVSVALGQTATITCSGDVLSEKYSSWYQQKPSQAPMLVIYKDSERPSGIPDRFSASSSGKTVTLTISGAQAEDEADYYCRSSDSANK
Acinonyx jubatus V401 iglv LLWD01001358.1 59410 SVASSGLTQPPSVSVALGQTTTITCSGDVLRERYAYWYQQKPGQAPVLLTTKNTEWPSGIPDRFSGSNSGNTATLTISRTRAEDEADYYCQSYDSSGN
Acinonyx jubatus V402 iglv LLWD01001358.1 74082 SMASYVLTQPPSVSVNLGQTARITCGGNNIGSKNAYWYQQKPGQAPMLVIYYSSNRPSGIPDRFSGTNSGNTATLTISGAQAEDEADYYCQVWDGSSD
Acinonyx jubatus V403 ighv LLWD01001368.1 9257 VQCDVQLVESGGALVKPGGSLRLTCVASGFTSSGYYMNWVRQAPGKGLQWVARIYDDGSSTSYTDSVKGRFTISRDKAKNTLYLQMNSLKTEDTATYYCVR
Acinonyx jubatus V404 ighv LLWD01001368.1 10020 VQCDVQLVESGGNLVKPGGSLRLTCVASGFTSSGYYMNWVRQAPGKGLQWVAYIYTDGSSTNYADSVKGRFTISRDNSKNTLYLQMNSLKTEDTATYYCAR
Acinonyx jubatus V405 iglv LLWD01001376.1 10125 SWAQSVLTQPSSVSGSLGQRVTITCTGSSSNIGSNYVSWYQQLPGKTPKTIIYWDDSRPSGVPERFSGSKSGSTGTLTITGLQAEDEADYYCSAGDDSLR
Acinonyx jubatus V406 iglv LLWD01001376.1 19186 SWAQSMLTQPPSVSGALGQTVTISCSGSTNSIGIYGVNWYQQLPGEAPKLLIYGNSNRPSGIPDRFSGSKSGSTGSLTITGLQAEDEADYYCQT
Acinonyx jubatus V407 iglv LLWD01001376.1 33597 SWAQSVLTQPPSVSGALGQRVTISCTGSSSNIGGGNYVSWYQQLSGTAPKLLIYGNSNRPSGVPDRFSGSKSGSTGSLTITGLQAEDEADYYCSAWDSSLS
Acinonyx jubatus V408 iglv LLWD01001376.1 115937 SWAQSGLTQPSSVSGALGQRVTISCTGVGNYVGWYQQIPGMAPKTIIYSDSNRPSGVPDRFSGTKSGSTGTLTITGLQAEDEADYYCSSWDYSLN
Acinonyx jubatus V409 iglv LLWD01001376.1 122292 IWAQSGPNQPSSVSGALGQRVTISCTRVGSWVDWYQQMPGMAPKTIIYVNSNRPSGVPDRFSGSKSGSTGTLTITGLQAEDEADYYCSSWDYSLN
Acinonyx jubatus V410 ighv LLWD01001405.1 23396 VQCDVQLVESGGDLVNPGGSLRLTCVASGFTFSSYHMHWVRQAPGKGLQWVAYIRYDGSSTYYADSVKGRFTISRDNAKNTLYLQMNNLKTEDTATYYCAEGT
Acinonyx jubatus V414 ighv LLWD01001461.1 11665 VQCDVQLVESGGDLVKPGGSLRLTCVASGFTFSSYYMNWVRQAPGKGLQWVAYINTDGSSTSYADSVKGRFTISRDNAKNTLYLQTNNLKTEDTATYYCAK
Acinonyx jubatus V417 iglv LLWD01001717.1 3924 IWAQSGLNQPSSVSGALGQRVTISCTGVGSYVGWYQQIPGMAPKTIIYRNSNRPSGVSDRFSGSKSGSTATLTITGLQAEDEAEYYCSSWYSGGSA
Acinonyx jubatus V418 iglv LLWD01001717.1 9226 IWAQSGPNQPSSVSGALGQRVTISCTGVGSYVHWYQQMPGMAPKTIIYDNSNRPSGVPDRFSGSKSGSTGTLSITGLQAEDEADYYCSSWDNSVK
Acinonyx jubatus V421 ighv LLWD01001994.1 1088 VQCDVQLVESGGDLVQPGGSLRLTCVASGFTFSSASMSWVRQAPGKGLQWVAAISGSGGSTYYADSVKGRFTISRDNAKNTLYLQMNNLKTEDTATYYCAR
Acinonyx jubatus V422 ighv LLWD01002128.1 2465 VQCDMQLVESGGDLVKPGGSLRLTCVASGFTFSSYSMHWVRQAPGKGLQWVAAISGSGGSTYYADSVKGRFTISRDNAKNTLYLQMNSLKTEDTATYYCA
Acinonyx jubatus V449 ighv LLWD01000049.1 383485 VHSKVLLVQSGAEVRKTWASVKIFCKAFGYSFTDYYMHWMLQAPAQGFEWMGSIDPEDGATSYAQKFQGRLTLTADTSTNTAYMELSSVRSADTAMYYCAR
Acinonyx jubatus V450 ighv LLWD01000049.1 368953 VQCDVQLVESGGDLVKPGGSLRLTCVASGFTFSSYEMNWVRQAPGKGLQWVAYISSSGGSTYYTDSVKGRFTISRDNSKNTLYLQMNNLKTEDTATYYCAR
Acinonyx jubatus V451 ighv LLWD01000049.1 300076 VQCDMQLVESGVDLVKPGGSLRLTCVASGFTFSSYGMIWVCQALGKGLQWVAYITYGGSTYYADSVKSQFTISRHNAKNTLYLQMNMRVEDMATYYCSR
Acinonyx jubatus V452 ighv LLWD01000049.1 279119 VLCDVELVESGGDLVKPRGSLRLTCVASGFTFSSYAMSWVRQAPGKGLQWVAYISNSGGSTYYADSMKGRLTISRDNSKNTLYLQMNNLKTEDTAIYYCVR
Acinonyx jubatus V453 ighv LLWD01000049.1 247880 VQCDVQLGEAGGDLVKPGGSLRLTCVASGFTFNGYWMSWVRQAPGKGLQWVAEISGSGGSTNYADSMKGQFTISRDNSKNTLYLQMNNLKTEDTATYYCAR
Acinonyx jubatus V454 ighv LLWD01000049.1 234700 VQCDVQLVESGGDLVKPGGSLRLTCVASGFTFSSNSMNWVRQAPGKGLQWVAYIRYDGSSTSYADSVKGRFTISRDNAKNTLYLQMNNLKTEDTATYYCAR
Acinonyx jubatus V455 ighv LLWD01000049.1 203280 VQCDVKLVESGGDLVKPGGSLRLTCVASGFTFSSYEMSWVRQAPGKGLQWVTYIYDDGSSTYYADSVKGRFTISRDNAKNMLYLQMNNLKTEDTATYYCAR
Acinonyx jubatus V456 ighv LLWD01000049.1 152930 VQWDVQLVESGGDLVKPGGSLRLTCVASGFTFSRYGMSWVRQAPGKGLQGVAYIYDDGSSTYYADSVKSQFTQNTLYLQMNNLRAEDKATYYCARDKVRG
Acinonyx jubatus V457 ighv LLWD01000049.1 129799 IQCDVQLVESGGDLVKPGGSLRLTCVVSGFTFSSNSMNWVRQAPGKGLQWVTYIRYDGSSTSYTDSVKGRFTISRDNAKNTLYLQMNNLKTEDTATYYCAR
Acinonyx jubatus V458 ighv LLWD01000049.1 102445 VQCDVQLVESGGDLVKPGGSLRLTCVASGFTFSSCWMSWVRQAPGKGLQWVARIYDDGSSTSYTDSVKGRFTISRDNAKNTLYLQMNNLKTENTATYYCAR
Acinonyx jubatus V674 igkv LLWD01000514.1 1746088 SGGWHVLTQAPETLAASRDSFVSITCRSSTEVGTSMAWYQQKPNEAPRLLIFGASARAAGTPSRFRGSGSGLDFSLTIHGVEAEDIGIYYCQ
Acinonyx jubatus V675 igkv LLWD01000514.1 1731241 AGGTAELTQSPTHLSVSLRDSVSLICRANESVSDHLSWYQQKPGQPPKLIIYDADNLESGVSDRFSGIQSDTEFTLKISTVEADDAAVYYCQQDYALP
Acinonyx jubatus V676 igkv LLWD01000514.1 1698561 SSGDIVMTQTPLSLSVTPGEPASISCRASQSLLHSDGNTYLYWYLQKPGQSPRRLIYLVSNRDPGVPDRFSGSGSGTDFTLRISRVEADDVGVYYCGQALQYP
Acinonyx jubatus V677 igkv LLWD01000514.1 1693676 SGGWHVLTQAPETLAASRDSFVSITCRSSTEVGTSMAWYQQKPNEAPRLLIFGASARAAGTPSRFRGSGSGLDFSLTIHGVEAEDIGIYYCQ
Acinonyx jubatus V678 igkv LLWD01000514.1 1683676 SSGDVVMTQTPLSLPVTPGEPASISCRASQSLLHSNGNTYLHWYLQKPGQSPRLLIYKVSNRASGVPDRFSGSGSGTDFTLRISRVEADDIGVYYCLQG
Acinonyx jubatus V679 igkv LLWD01000514.1 1658909 SSGDVVMTQTPLSLPVTPGEPASISCRASQSLLHSNGNTYLHWYLQKPGQSPRLLIYKVSNRASGVPDRFSGSGSGTDFTLRISRMEADDVGVYYCQQA
Acinonyx jubatus V680 igkv LLWD01000514.1 1645652 SSGDVVMTQTPLSLPVTPGEPASISCRASQSLLHSNGNTYLHWYLQKPGQSPRLLIYKVSNRASGVPDRFSGSGSGTDFTLRISRVEADDFGAYYCYQA
Acinonyx jubatus V681 igkv LLWD01000514.1 1639329 AGGTAELTQSPTHLSVSLRDSVSVICRANESVSDHLSWYQQKPGQPPKLIIYDADNLESGVSDRFSGIQSGTEFTLKISTVEADDAAAYYCQQDYALP
Acinonyx jubatus V713 trgv LLWD01000624.1 162336 GLGQEKLEQPEISISRARGKSAHVSCKMSTEVINRAIHWCRQKPDQEIEHLTLVSTQPVRVSLGGKSDKLEASKNAHTSTATLKINFLEQEDEAVYFCASWDW
Acinonyx jubatus V714 trgv LLWD01000624.1 155191 TNGGIFITQFIPSITKKKGNTAFLECQVKTGVLKKNVNIHWYRQRPDQPLKRILYISSNENVVHEQGISEEKYEARKRQRDLPASLRIHKISEDDAGLYYCACWD
Acinonyx jubatus V794 trbv LLWD01001045.1 505319 PVGAGVTQSPRHLVKGSGGKAVLKCRPMSGHRSVSWYQQAPGQGPQFLIELFDQETREKGNLPSHFSVEQFSDYSSQLNVSSLELGDSALYLCASSL
Acinonyx jubatus V795 trbv LLWD01001045.1 500371 PMDAEITQNPRYKVTGTGKRVILKCDQTENYDYMYWYRQDPGHGLKLIYYSNGFDSINRGDVPDGYTVSRKNMEDFPLVLESATSSQTSVYFCANSY
Acinonyx jubatus V796 trbv LLWD01001045.1 488019 PTDAGVTQTPRHKVTMKGQTVTLRCEPISGHASLYWYRQTSGQGLKQLVYFNNQASIDDSGMPSDRFSAKMPEKSPSTLEIQRTEPGDSATYLCASSL
Acinonyx jubatus V797 trbv LLWD01001045.1 467371 HTGARVIQSPRYQVTGIGKRVPLSCSQNLNHDAMYWYQQKPNQAPKLLLYYYDTNLYTEKDTSDNFKASRANSSFCSLDILLAGFEDTAVYLCASSK
Acinonyx jubatus V798 trbv LLWD01001045.1 444467 GSGLGALVSQDPRTAVRKSGTSVVIQCHSVGIQATTVFWYRQFPEQGLTLMATSNVASKATYEQGFSETEFSISHSNTTFSSLTVMSVKPADSSLYFCSAS
Acinonyx jubatus V799 trbv LLWD01001045.1 437290 SMDTQVTQSPRYLVKGKKQSAKMNCIPVKGHSYVYWYRQKLEEFKFLVYLQSEDIVDKIEKFEDQFSAQCPKNSPCSLKIKSTEPGDSALYFCASSE
Acinonyx jubatus V800 trbv LLWD01001045.1 420734 SVDAGITQTPRNGIIETGKSIVLECSQTMDHAYMYWYRQDPELGLQLVYLSYGTNNINKGEVSNGYSASRKEREKFSLFLETAIPKQTALYFCATRD
Acinonyx jubatus V801 trbv LLWD01001045.1 414906 LVDASVSQTPRHYVSGTGKKITLECSQTMGHENMYWYRQDPGKALQLIHYSYGINTTEEVEASSGSTVSRIRKEHFPLTLQSTSPSQTSLYFCASSE
Acinonyx jubatus V802 trbv LLWD01001045.1 408902 LKDAVVTQFPRHKILGTGKKLTLQCTQYMNHVSMYWYCQDPGSGLQLIYYSTGTEAFEKGDVPEGYHVSRNELPYFPLTLDSASTNQTSVYFCANSL
Acinonyx jubatus V803 trbv LLWD01001045.1 399145 PVVARVTQTPRHLITGTRKRLTVRCSQDMNHDAMYWYRQDPGLGLKLIYYSRNVDFIEKGDVPDGYAVSRKERNFPLTLESTSTSQMPLYLCASSKSS
Acinonyx jubatus V804 trbv LLWD01001045.1 380433 TVFSVLLSQKPHRDICQRGTSVTIHCEVNIQFTLMFWYHQLPGQSLVLMATTNQGLEATYEHGFTKDKFPISRPTLVFSTMTVSNVSLEDSSFYFCSAR
Acinonyx jubatus V833 iglv LLWD01001432.1 237154 SWAQSVLTQPSSVSGSLGQRVTITCTGSSSNIGSNYVSWYQQLPGTTPKTIIYWDNSRPSGVPERFSGSKSGSTGTLTITGLQAEDEADYYCSAWDDSLR
Acinonyx jubatus V834 iglv LLWD01001432.1 191898 ATSQEVVTQETSLSTTPGGTVTLTCGSSTGAVTTSNYASWVQQKPYQRFQGLIGGTSYRNPGVPARFSGSLVGQKAVLTITGAQSEDEAEYYCVLWFSNH
Acinonyx jubatus V835 iglv LLWD01001432.1 92095 SWAQSALNQPPSVSGDLGRTVTISCAGSSNDIGRYNYVSWYQQLEGTSPKLLIYRVNSRPSGIPDRFSGSKSGNTASLTISGLQAEDEADYYCCSYASSNT
Acinonyx jubatus V836 iglv LLWD01001432.1 83591 SVASYVLTQPPSVSVNLGKTARITCGGNNIGSKYAYWYQQKPGRAPVMIIYDDSKRSSRTPDRFSGTNSGNTATLTISGAQAEDEANYYCQVWGGNSD
Acinonyx jubatus V837 iglv LLWD01001432.1 49926 SVASYVLTQPPSVSVNLGQTARIMCGGNNIGSYYAYWYQQKSGQAPVLIIYEDSNRPSGIPDRFSGTNSGNTATLTISGAQAEDEADYYCQSYDISSD
Acinonyx jubatus V838 iglv LLWD01001432.1 35572 CPASVSRSVWALGQIITISCSGSNNDIQGYKDVPWYQQLSATSPKLLFYHVHSQASGIPDRFSGSKSGNTASLTISGLRAEDEADYHCSSYAGSSI
Acinonyx jubatus V839 iglv LLWD01001432.1 13441 SMAASELTQPPAVSVALGQTATITCEGDSFESSIINWYQQKPGQAPVLVIYEDSEQPTGIPDRFSGSSSGDAATLTITGAQAEDEADYYCQSYDNSGD
Acinonyx jubatus V840 iglv LLWD01001432.1 2002 SVASYELTQPPSVSVNLGQTARITCGGNNIGSKYAYWYQQKSGQAPVLIIYEDSNRPSGIPDRFSGTNSGNTATLTISGAQAEDEADYYCQSYESNYD
Acinonyx jubatus V841 iglv LLWD01001467.1 86596 SWAQSVLSQPPSVSGALGQTVTIPCTGGANNIDIAGVNWYQQLPGKAPKLLIYDSSDRPSGVPDRFSGSTSGNTGSLTITGLQAEDEADYYCQSLDFTQGA
Acinonyx jubatus V842 iglv LLWD01001467.1 70171 SWAQSRLTQPPSVSGSLGQRVTISCAGSSSNIGGYGVNWHQQFPGMAPKTIIYSDNNRPSGVPDRFSGSRSGNTGTLTITGLQAEDEADYYCSAWDSSGSA
Acinonyx jubatus V843 iglv LLWD01001467.1 46235 SWAQSELTQPPSVSGGLGQTVTISCAGSANNIGIVGVNWYQQFPGKAPKLLISAYSNQPSRVSGRFSGSTSGNTGSLTITGLQAEDEADYYCTSADPIQSA
Acinonyx jubatus V844 iglv LLWD01001467.1 29810 SLSQPVVTQPASLSASLGATARLTCTLSRDINVGGYYIYWYQQNPGSPPRYLLYYYSDSSTQLGPGVPSRFSGSKDASANAGLLLISGLQPEDEADYYCAI
Acinonyx jubatus V845 iglv LLWD01001467.1 3887 SLSQPVVTQPASLSASLGTTARLTCTLSRDINVGSYSIHWYQQNPGSPPRYLLYYYSDSSTQLGPGVPTRFSGSKDASANAGLLLISGLQPEDEADYYCAI
Acinonyx jubatus V847 ighv LLWD01001690.1 3109 VQWDVQLVESGGDLVQPGGSLRLTCVASGFTFSRYAMSWVRQAPGKRLQWVSEISSGGSTSYADSMKGRFPISRDNTKNTLYLQMNNLRAEDKATYYCARGT
Acinonyx jubatus V849 iglv LLWD01001771.1 29325 SWAQSVLTQPPSVSGSLGQRVTISCTGSSSNIGGGNYVSWYRQVPGTAPSLLIYENNKRPSGVPDRFSGSKSGSSGSLTITGLQADDEADYYCASWDDSLS
Acinonyx jubatus V850 iglv LLWD01001771.1 2708 SWAQSVLTQPPSVSGTLGQRITISCTGSSSNIGGGNAVSWYQQVPGMGPKTVIYWDNSKPSGVPDRFSGSKSGSSGTLTITGLQAEDEADYYCSAWDDSLS
Acinonyx jubatus V851 ighv LLWD01001820.1 389 VQCDVQLVESGGNLVKPGGSLRLTCVASGFTFSSSSMSWVRQAPGKGLQWVAYIYTDGSSTYYADSVKGQFTISRDNSKNTLYLQMNSLKTEDTATYYCAR
Acinonyx jubatus V855 ighv LLWD01002108.1 342 VHSQVLLVQSAAEVRKPGASVKIFCKASGYSFTDYYMYWVRQAPAQGLEWMGSIDPEDGATSYAQKFQGRLTLTADTSTNTAYMELSSLRSVYYCAR
Acinonyx jubatus V856 iglv LLWD01003491.1 1795 SWAQSELTQPPSVSGGLGQKVTISCTGSRSNIGIAGVNWYQQLPGKAPKLIIYGSSDRPSGVPDRFSGSTSGNTGSLTITGLQAEDEADYYCLSVDVMQGA