WGS Statistics
Organism WGS Record. Vs Total IGHV IGLV IGKV TRAV TRBV TRGV TRDV
Neomonachus schauinslandi NINY00000000.1 (NINY01) 95 7 25 8 35 10 4 6
Vgene Table
Organism Vgene Locus contig Contig Pos. AA sequence
Neomonachus schauinslandi V0 iglv NINY01000246.1 700 SWAQSVLTQPSSVSGALGQRVTISCTGSSSNIGGSYVSWFQQLPGKAPKTVIYWDNSRPSGVPDRFSGSKSGSSGTLTITGLQAEDEAEYYCSSWDNSLS
Neomonachus schauinslandi V1 iglv NINY01000796.1 1728 SWAQSVLTQPSSVSGALGQRVTISCTGSSSNIGGGNGVNWYQQLPGKPPKTMIYGSSGRPSGVPERFSGSRSGSSGTLTITGLQAEDEAEYYCASWDDSLS
Neomonachus schauinslandi V2 iglv NINY01001293.1 790 SWAQSVLTQPPSVSGSLGQTVTISCTGSSSNIRRYAVNWYQQLPGKAPRTIIYGNSNQPSGVPDRFSGSKSGSSGTLTITGLQAEDEPEYYCQSYDSSLS
Neomonachus schauinslandi V3 iglv NINY01002095.1 513 SWAKSVLTQPPSVSGSLGQRVTISCTGSSSNIGGSYVSWFQQLPGKAPRTVIYDNSNRPSGVPDRFSGSKSGSSGTLTITGLQAEYYCSASDSSSS
Neomonachus schauinslandi V6 iglv NINY01002629.1 1520 SWAQSVLTQPPSVSGSLGQRVTISCTGSNSNIGRYGVNWYQQLPGKAPRTVIYYDSNRPSGVPDRFSGSKSGSSGTLTITGLQAEDEAEYYCSALDSSSS
Neomonachus schauinslandi V9 ighv NINY01003903.1 654 VQCEVQLVESGGDLVKPGGSLRLSCAASGFTFSSYAMSWVRQAPGKGLQWVAVISSDGSNTGYADSVKGRFTISRDNGKNTLYLQMNSLRAEDTDAYYCVK
Neomonachus schauinslandi V10 ighv NINY01004529.1 58 VQCEVQLVESGGDLVKPGGSLRLSCAASGFTFSSSAMSWVRQAPGKGLQWVAGISSVGSYTGYADSVKGRFTISRDNGKNTLYLQMNSLRAEDSAVYYCAK
Neomonachus schauinslandi V11 iglv NINY01004542.1 1034 SWAQSVLTQPPSVSGSLGQTVTISCTGSSSNIGGGYAVNWYQQLPGKAPRSVIYGNSNRPSGIPDRFSGSKSGSSGTLTITGLQAEDEAEYYCACWDYSLS
Neomonachus schauinslandi V12 iglv NINY01005849.1 7909 SWAQSVLTQPSSVSGALGQRVTISCTGSSSNIRRYGVSWYQQLPGKAPRTIIYSNSNRPSGVPDRFSGSRSGTSGTLTITGLQAEDEAEYYCSASDSSSS
Neomonachus schauinslandi V13 iglv NINY01006450.1 27546 SWAQSVLTQPPSVSGALGQKVTISCSGSSYNSFLGVNWYQQLPGKAPKLLIYAGSNRPSGVPERFSGSKAGDSGSLTINGLQAEDEADYYCQSFDPSVG
Neomonachus schauinslandi V14 iglv NINY01006450.1 45229 ADSQNVVTQEPSLTVSPGRTVTLTCALSSGSVSMGNYPSWYQQTLGQPPRMIINSTNGCPSGVPDRFSGSISGNKAALAITGAQPEDEADYYCVLYSGGYT
Neomonachus schauinslandi V55 igkv NINY01007707.1 37699653 CGGRLVLTQTPETLAASQDSFISITCRSSEEVGTSMAWYQQKPNEAPRLLIFGASARATGTPLRFRGGGSGSDFSLTIHGVEAEDAGVYYCQ
Neomonachus schauinslandi V56 igkv NINY01007707.1 37708649 ASSEIQMTQSSSSLSASPGDRVTITCWASQNTNRWLAWYQQKPGKAPKPLIYEASKLQTGVPSRFSGSGSGTDFTLTISSLEPEDFAPYYCQQSKS
Neomonachus schauinslandi V57 igkv NINY01007707.1 37726164 SSGEIVMTQTPLPLPVTPGESVSISCRASQSLLHSNGNTYLNWFRQKPGQSPQLLIYLVSNCFTGVPDRFSGSGSGTDFTLRISRVEADDVGVYYCGQNLQS
Neomonachus schauinslandi V58 igkv NINY01007707.1 37737814 SSGDVVMTQTPLSLPVTLGEPASISCRASQSLLHSNGYNYLHWYLQKPGQSPQLLIYAASHRFTGVPDKFSGSGSGTDFTLRISRVEADDVGVYYCQQSIHAP
Neomonachus schauinslandi V59 igkv NINY01007707.1 37760556 SSGEVVMTQTPLSLPVTPGEPASISCRASQSLLHSDGKSYLNWYLRKPGQSPQPLIYEASKRFSGVPDRFSGSGSGTDFTLRISRLEAEDFGVYYCQQSIHVA
Neomonachus schauinslandi V60 igkv NINY01007707.1 37779117 SHGEIVLTQSPDFLSKATKEKVTITCRASQSISTSLHWYQQKHNQALKLLIKYASQTISGVPSRFSGSGSGTDFTLTISSLEPEDFATYYCQQSKSYP
Neomonachus schauinslandi V61 igkv NINY01007707.1 37792371 ASGNAGLTQSPAFLTVSLRESVSITCRANESISDYLSWYLQKPGQAPKLLIYDADNLMSGVPDRFSAIQSDTEFILKISTVEAEDAASYYCQQDYTV
Neomonachus schauinslandi V170 trbv NINY01007728.1 12216269 IGAQTIHQWPPVRVQLVGSLLYLECTVKGTSSPYLYWYWQFLGGTPQLLFSSVSVDQIVRETQQNFTAFRPQDGQFILSSEKLLLSDSGFYLCAWS
Neomonachus schauinslandi V184 trdv NINY01007733.1 11824734 KGVLCDQVAQSPPDQTVASGSKVTLLCTYSTTQSNPDLYWYRIRPDRSFQFILYRDNTESQNADFTQGRFSVLHNQSRRTFHLVISPVEPEDSASYYCSMD
Neomonachus schauinslandi V320 iglv NINY01007811.1 72571 SMAAYVLTQPPSMSVSLGQTARITCGGDNIGSNYASWYQQKPGQAPVTIIYGDSSRPSGIPDRFSGTNSGNTATLTISGARAEDEADYYCLSSASSAD
Neomonachus schauinslandi V321 iglv NINY01007811.1 96627 SMASYVLTQPRSKSVNLGQPARITCGGDNIGSKNAYWYQQKPGQAPVLIIYEDSKRPSGIPDRFSGTNSGNTATLTISGARAEDEADYYCQVWDSSAK
Neomonachus schauinslandi V322 iglv NINY01007811.1 100985 SVASSGLTQPPCVSVALGQTATITCPGEDLEDINGRWYQQKPGQAPVLVVYEASVWSSEIPTKFSGSKSGNTATLTISGARAEGEADYYCQSSDSGAD
Neomonachus schauinslandi V323 iglv NINY01007811.1 121995 SMAAYVLTQPRSMSVSLGQTARITCGGDNIGSKYAYWYQQKPGQAPVTIIYKDSKRPSGIPDRFSGTNSGNTATLTISGARAEDEADYYCLGWDSNAD
Neomonachus schauinslandi V324 iglv NINY01007811.1 1267927 SQPGLAQPDALLVFPGQVAQLSCMLSPRHATVGEHGVSWYQQRAGSAPRYLLYYRSEDNYHRPPDIPDRFSAATDAAHNACILTISPVQPEDDADYYCSVG
Neomonachus schauinslandi V353 iglv NINY01000456.1 1106 SWAQSVLTQPPSVSGALGQRVTISCTGSSSNIGRGNYVSWIQQLPGKAPKTVIYGTSSRPSGVPDRFSGSTSGNSATLTITGLQAEDEAEYYCSAGDSSLK
Neomonachus schauinslandi V356 iglv NINY01000782.1 1079 SWAQSVLTQPSSVSGALGQTVTISCTGSSSNIGGSYVSWFQQLPGKAPKTVIYWDNSRPSGVPDRFSGSKSGSSGTLTITGLQAEDEAEYYCSAWDNSLS
Neomonachus schauinslandi V359 iglv NINY01003171.1 2040 SWAQSVLTQLPSVSGALGQRVTISCTGSSSSIGGNYVSWYQQLPGKAPRTIIYDNSDRASGVPDRFSGSKSGSSGTLTITGLQAEDEAEYYCASWDDSLS
Neomonachus schauinslandi V360 ighv NINY01003558.1 77629 VQCEVQLVESGGDLVKPGGSLRLSCAASGFTFSSYCMSWVRQAPGKGLQWVTAISSDGSTYYTDSVKGRFTISRDNGKNTLYLQMNSLRDEDTAMYYCAK
Neomonachus schauinslandi V361 ighv NINY01003558.1 59899 VQSEVQLMESGGELVKPGGSLRLSCAASGFTFSSYYMSWVRLAPGKGLQWVAWISYDASSTSYADSVKGRFTISRDNGKNTLYLQMNSLRDEDTAVYYCVK
Neomonachus schauinslandi V362 ighv NINY01003558.1 29681 VQSEVQLVESGGDLVKPGGSLRLSCAASGFTFSDYGMGWVRQAPGKGLQWVAAISDDGSSTSYADSVKGRFTISRDNGKNTLYLQMNSLRAEDTAVYYCAT
Neomonachus schauinslandi V363 ighv NINY01003558.1 6142 VQCEVQLVETGGDLVKPGGSLRLSCAASGFTFSSYWMSWVRQAPGKGLQWVGEIKDDGSSTYYADSVKGRFTISRDNGKSTLYLQMNSLRLEDTAVYYCAR
Neomonachus schauinslandi V365 iglv NINY01003996.1 623 SWAQSVLTQPSSVSKALGQTVTISCTGSSSNIRRYGVNWYQQLPGKSPKTMIYDSTTRPSGVPERFSGSTSGSSGTLTITGLQAEDEAEYYCSVWDDSLS
Neomonachus schauinslandi V366 iglv NINY01004300.1 1725 SWAQSVLTQPPSVSGSLGQRVTISCTGSSSNIGGSYVVNWFQQLPGKAPRTIIYGNSNRASGVPDRFSGSTSGSSGTLTITGLQAEDEAEYYCQSYDSSLS
Neomonachus schauinslandi V368 ighv NINY01005496.1 1173 VQCEVQLVESGGDLVKPGGSLRLSCAASGFTFSSYYMNWIRQAPGKGLQWVAAISYDGSSPYYADSVKGRFTISRDKGKNTLYLQTNSLRDEDTAVYYCAK
Neomonachus schauinslandi V370 iglv NINY01006065.1 614 SWAQSVLTQPSSVSGALGQRVTISCTGSSSNIGGAYGVSWYQQLPGKAPRTIIYSNSNRPSGVPDRFSGSRSGSSGTLTITGLQAEDEAEYYCSALDSSSS
Neomonachus schauinslandi V371 iglv NINY01006295.1 1812 SWAQSVLTQPSSVSGALGQRVTISCTGSSSNIGGGYVSWYQQLPGKAPRNVIYSNSNRPSGVPDRFSGSKSGSSGTLTITGLQAEDEAEYYCSAWDSSLK
Neomonachus schauinslandi V372 iglv NINY01007255.1 1262 SWAQSVLTQPSSVSGALGQRVTISCTGSSSNIGGNSVYWYQQLPGKAPRTIIYGNSNRPSGVPDRFSGSKSGSSGTLTITGLQAEDEAEYYCQSYDSSLS
Neomonachus schauinslandi V374 iglv NINY01007365.1 1271 SWAQSVLTQPPSVSGALGQRVTISCTGNSSNIGGNSVSWFQQLPGKAPRTIIYYDSNRPSGVPDRFSGSKSGSSGTLTITGLQAEDEAEYYCASWDDSLNG
Neomonachus schauinslandi V417 igkv NINY01007707.1 37771916 VSGDIVMTQSPGNLTKAVRESVAINCKSSQSLLYSSNQKNYLVWYQQKPGQAPKLLMYWASTRASGVPDRFSGSGSGTDFTLTISNLQAEDVADYYCQQHYSYL
Neomonachus schauinslandi V513 trav NINY01007721.1 15368949 TSDEDFQVTQPESSVSVRAGEILTLGCNVSARSPAGPVLWFRENGQERHLIYNFNGSQFPRVTQVENTEFNQTDYSIRISDVSPKDVGTYYCVKLTI
Neomonachus schauinslandi V551 trbv NINY01007728.1 12404544 SVDTGVTQIPKHLVTGTGRKVALECKQNLGHNAMYWYKQSAQKPPKLMLAYNVKDLVQNETVSSRFSLQRPNTSELDLHVSPVEPEDSAVYLCASSK
Neomonachus schauinslandi V552 trbv NINY01007728.1 12386559 PLNAGITQTPKFQVLGTGQSMTLECDQDTNHNFMYWYRQDRGHGLRLIHYSVSARTSEKGEVPDGYSASRSNIKNFLLKLLSTTPSQTSTYFCATYFC
Neomonachus schauinslandi V553 trbv NINY01007728.1 12355902 HMDAGITQSPRYETARTRKEVTLRCHQTENYDYMYWYRQDLGHGLRLIYYSINIGHTEKGEVSDGYTVSRSNMEDFQLTLLSVASSQTSVYFCANS
Neomonachus schauinslandi V554 trbv NINY01007728.1 12330351 HMGAMVIQSPRYQVTSVGKPVNLSCSQNLNHENMYWYQQKLSQAPKLLLYHYDINLNREADTSDNFQSTRPNNSFCSLSILSPGLGDSAVYLCASSK
Neomonachus schauinslandi V555 trbv NINY01007728.1 12326385 TLNAEVTQTPGHLVKGKGQKAKMHCVPIKGHRYVFWYQQIPAKEFKFLTSFQDGIIFDKTGMPEKRFLAACSQNSNCSLEIKPTELQDSAVYFCASSE
Neomonachus schauinslandi V556 trbv NINY01007728.1 12315006 PMNAGVTQNPRHLVRRTGQEANLTCSPEKGHSYFYWYQQPLGEGLKFMVSLQNEKTIDNSGMPKKRFSTEFSKEGFSILNIQMAELGDSAVYFCASSL
Neomonachus schauinslandi V558 trbv NINY01007728.1 12294593 SMDAGITQTPRNGIIKTGKNILLECSQTKGHNSMYWYRQDPGLGLRLIYYSYINDINEGEVSSGYRASRKGLVNFSLSLEPAIPNQTALYFCASSD
Neomonachus schauinslandi V559 trbv NINY01007728.1 12288545 LMDASVSQTPRHCVSGTGKKIALECSQTMGYDNMYWYRQDPGKALQLIHYSYDVNTTEKTEFSSGSTVSRIKKEHFTLTLESASPSQTSLYFCAISE
Neomonachus schauinslandi V560 trbv NINY01007728.1 12274707 PMEAEVTQTPRYFITGTGRQLTLHCFQDMNHDAMYWYRQDPGLGLKLIYYSRNVEFVEDGDVPHGFTALRKEKKNFPLTLKSAGTNQTSLYLCAISE
Neomonachus schauinslandi V580 trav NINY01007733.1 12407546 AEGKDQVFQPSAVAASEGSVVEISCNHSISTAYNFFWYLHFPGRVPRLLIKGSGPSQQGRYNMTYERFSSSLLILQLQVADAAIYYCALEGTE
Neomonachus schauinslandi V581 trav NINY01007733.1 12403869 GLRAQSVSQPNQVTVAEGDPLTVNCTYSVSGSPYLFWYVQYPNQGLQFLLKYITGNNLVKGSYGFEAEFNNSQTAFHLKKPSVLWSDSAVYFCAVA
Neomonachus schauinslandi V582 trav NINY01007733.1 12389958 GTRAQSVTQPDAHVTVSEEAALELRCNYSSVVQPYLYWYVQYPNQGLQLLLQYFSGDTLVKGIKGFEAEFRKTETSFHLRKPSARGGDAAKYFCAVS
Neomonachus schauinslandi V583 trav NINY01007733.1 12387780 VRGMEVEQSPSALSLQEGASSTLKCNFSQTASSLQWFRQNPWGGGLTWLFYINIASGMKQSGRLNCTVNAKERSSTLHITASQLEDSATYLCAAQ
Neomonachus schauinslandi V584 trav NINY01007733.1 12382046 MSKGEEVQQHPSFLTIWEGDSFVINCTYTDSASDYFFWYKQEPGKGLQLLIYTLSNVVKKQEQRLTVLLNKKDKHLSLHDTATHPGDSATYFCATR
Neomonachus schauinslandi V585 trav NINY01007733.1 12368679 TSGDTVTQTEGSVTLREGTPLTLNCTYQSSYSVFAFWYVQYPNKGPELLLKSSSENQRVEHHGFQADLKSDKSFHLEKRSVQMSDSAVYYCVLR
Neomonachus schauinslandi V586 trav NINY01007733.1 12318667 QTHGDSVTQMEGPVTLSEEASLTINCTYSTTGSVTLFWYVQYPGEGLQLLLNAFSDKKKNKKGFEATYDRDSKSFHLQKGSVQASDSAVYYCVMS
Neomonachus schauinslandi V587 trav NINY01007733.1 12308383 VRGLEVEQSPSALSLQEGASSTLKCNFSSTVNNVQWFRQNPGGGGLTSLFYIASEMKQSGRLNCTVNAKERSSTLHITASQLEDSATYLCAAQ
Neomonachus schauinslandi V588 trav NINY01007733.1 12298403 QTHGDSVTQTEGQVTLSEKAFLTVNCTYSASGYPALYWYVQYPGEGPRLLLKALKDKEKGSKKGFEATYDRDSKSFHLQKGSVQATDSAVYYCVMS
Neomonachus schauinslandi V589 trav NINY01007733.1 12295022 QTHGDSVTQMEGPVTLSEEASLTINCTYSTTGSVTLFWYVQYPGEGLQLLLNAFSDKKKNKKGFEATYDRDSKSFHLQKGSVQASDSAVYYCVMS
Neomonachus schauinslandi V590 trav NINY01007733.1 12286323 VRAMKVEQSPSALSLQEGASSTLKCNFSSTPDSVQWFQQNFGGGGLTRLFYIVSGMKQSGRLNCTVNAKEQSSTLHLTDSQLEDSATYLCAVQ
Neomonachus schauinslandi V591 trav NINY01007733.1 12269603 VRAMKVEQSPSALSLQEGASSTLKCNFSSTPDSVQWFQQSFGGGGLTQLFYIASGMKQSGRLNCTVNTRERSSTLHFTDSQLEDSATYLCAVE
Neomonachus schauinslandi V592 trav NINY01007733.1 12265264 QTHGDSVTQMEGQLTLLEEASLTVNCTYSTTRSPTLFWYVQYLGEGPELLLKALRDKEKGSKKGFEATLDSKSKSFHLEKGSVQASDSAVYYCVMS
Neomonachus schauinslandi V593 trav NINY01007733.1 12260897 VRGLEVEQSPSALSLQEGASSTLKCNFSSTVNNVQWFRQNLEGGGLTRLFYIASGMKQSGRLNCTVNAKERSSTLHIMASQLEDSATYLCAVE
Neomonachus schauinslandi V594 trav NINY01007733.1 12256574 QTYGDSVTQTEGQVTLLEEASLTINCTYSTTGYSTLFWYVQYPGEGLHLLLSSLRDQEKKSKKGFEATLDSKSKSFHLEKGSVQTSDSAVYYCVMS
Neomonachus schauinslandi V595 trav NINY01007733.1 12227143 QTHGDSVTQLEGPVTLSEEALLMVNCTFSTTWSPTLFWYVQYTGEGLELLLKASRDKDTKHNKGFEATLDSKSKSFHLEKGSVQASDSAVYYCVMS
Neomonachus schauinslandi V596 trav NINY01007733.1 12216059 QTHGDSVTQTEGQMTLSEEAFLTINCTYSTTGYPTLFWYVQYPGEGPELLLKALRDKEKASKKGFEATLNSKSKSFHLEKGSVQASDSAIYYCVMS
Neomonachus schauinslandi V597 trav NINY01007733.1 12206574 QTHGDSVTQMEGPVTLSEEDSLTINCTYSTIGYPTLFWYVQYPGEGPELLLKASRDKETKHNKGFEATPDSKSKSFHLEKGSVQASDSAVYYCVMS
Neomonachus schauinslandi V598 trav NINY01007733.1 12198908 VSGKNQVEQNPPSLVILEGENCTIQCNYTVNPFSNLRWYKQGTERGPAALIFVVYSDSKTSDGRYTTTLDTTSKHSSLHITAAQLSDSAFYICAVS
Neomonachus schauinslandi V599 trav NINY01007733.1 12185746 MRSQQKGVEQSPGSLSVLEGATASLNCNYSDSASQYFMWYRQYSGKGPELLMYMYSKGDKKEGRFWGQVDAAKQYVSLLIRDSQSSDSATYLCAV
Neomonachus schauinslandi V600 trav NINY01007733.1 12182173 GTGAQSVTQPDAHVTVSEEAFLELRCNYSYSGAPYLYWYVQHPNQGLQLLLQYVSGNTKVQGIKGFEAEFKDSETSFHLKKPSAHWNDSAVYFCAVS
Neomonachus schauinslandi V601 trav NINY01007733.1 12175826 GTGAQTVTQPEDHISVFEGNFVQVKCNYSYSGSPVLFWYVQYPKQGLQLLLKHISGESIKGFTASLNRDETSFHLKKQSAQEEDSATYYCALR
Neomonachus schauinslandi V602 trav NINY01007733.1 12165528 GASGDTVTQTEGSVTLREGTPLTLNCTYQSSYSVFAFWYVQYPNKGPELLLKSSSENQRVEHHGFQADLKSDKSFHLEKRSVQMSDSAVYYCVLR
Neomonachus schauinslandi V603 trdv NINY01007733.1 12153842 SSMTQKVTQAQPAISMLENEAVTLDCVYEVSGSSYYLFWYKQPPSGEMIFLIHQESYREQNATEGRYSLNFQKSDRSISLMITALQPVDSAVYFCALR
Neomonachus schauinslandi V604 trav NINY01007733.1 12139359 VSSKQEVKQIPEALNICEQDSVVLNCSYTDGALYSLQWFRQDPRKGLTFLLLIQSNQRELTSGRIKVSLDTSARQSTLYIAASEPSDSATYLCAV
Neomonachus schauinslandi V605 trav NINY01007733.1 12126124 GTRAQAVTQPDAHVTVPEESPLELRCSYSSFLPSLYWYVQHPNQGLQLLLQYVSGNTKVQGPKGFQAEFKDSETSFHLKKPSAHWNDSAVYFCAVN
Neomonachus schauinslandi V606 trav NINY01007733.1 12100587 VGSVLNVEQNPPWLHVQEGENTNFTCRFPSSTFYSLHWYRWEPAKSPTFLFSVTLNGDEKKKGRVKTTLNTQEGYSSLYIEGSQPEDAVIYLCAM
Neomonachus schauinslandi V607 trav NINY01007733.1 12093477 INGQEIKQNPQFLLLQEGEGFTIYCNSSITLNSLQWYKQRPGGGPVLLITLFKGEVKQERLTARFGETRKDSSLHMEASQTADAGTYFCVGHSALR
Neomonachus schauinslandi V608 trav NINY01007733.1 12072224 ESTQQLEQSPRFLSIQEGENFTAYCNSTSTFSSFQWYRQKPGEGPVHLMTLSKGGEMKKNKSLTTRFGEARKDSSLLIIAAQPGDAAIYLCAG
Neomonachus schauinslandi V609 trav NINY01007733.1 12066336 VRVQMKVEQSPRVLILQEGRNASMICNYSISMTSVQWFQQSPEGRFTSLSYIASGTQQKGRLKFTVNIKERNSRLYITDSQPGDSVTYFCAVA
Neomonachus schauinslandi V610 trav NINY01007733.1 12061008 VNSQQKGDQQQVKQTPSLTVQEGKTSFLNCDYSNDLFDYFLWYKKYPAKSPEFLISIFSVTDKNEDGRFTVLLNKSAKRLSLHIAGSQPGDSGLYLCAAS
Neomonachus schauinslandi V611 trdv NINY01007733.1 12049239 SSMAEKVIQTQETVIMQEGQAATIYCKYETSWSNYYTLYWYKQLPSREMVFLIYQDESKPNVKQGRFSVNFRKAAKSISLTISPLQLTDSAVYFCALGR
Neomonachus schauinslandi V612 trav NINY01007733.1 12045129 IMSDAKTTQTNAMESTEEKPVHLPCNHSTISGNEYIYWYRQIPNQGPEYMIHGLKGNVTNGMATLIITTARESSTLILPRVTLGDTAVYYCVVRD
Neomonachus schauinslandi V614 trdv NINY01007733.1 11998417 SSTAQTVTQIQPDMRVRETETVTLHCTYDTRDSDYYLFWYKQPPSGEMILIIRQEAYKQENATKDRFSVNFQKPKKSFSLRISDSRLEDAAMYFCALIE
Neomonachus schauinslandi V615 trdv NINY01007733.1 11991716 SSTAQTVTQIQPDMRVRETETVTLHCTYDTRDSDYYLFWYKQPPSGEMILIIRQEAYKQENATKDRFSVNFQKPKKSFSLRISDSRLEDAAMYFCALIE
Neomonachus schauinslandi V616 trav NINY01007733.1 11963769 VSGKTGVEHRPQYLTAQEGDSVTMNCSYSRGMTTLHWLQQNPGGGIVSLFILSLETKKKGRVRATVNTEELHSSLYITAAQPRDSATYLCAVG
Neomonachus schauinslandi V617 trdv NINY01007733.1 11929643 FSNTDKVHQSQSAMSAQEGQSVTLDCSFTLNFNYYVMNWYHQPPHGKMTLIISMFSDKSSNRVGQYELSFQKGNKILKLTITGLISEDTGIYFCAIGEV
Neomonachus schauinslandi V618 trav NINY01007733.1 11899946 GSCRTEIIQSSDLAAMIGTDVTFQCQYNILDGNYDSVYWYLQRADQRLTYINHTSQGTMESERYQLSVNRELSSSTLTIKHVQPRDKAIYYCAL
Neomonachus schauinslandi V636 trav NINY01007737.1 15539898 PHAQVVQVNDSMYGFIGTDVVLHCSFANPLPGVKITQVTWQKATNGSKQNVAIYNPAMGVSVLAPYRERVEFLRPSFTDGTIRLSRLELDDEGVYICEF
Neomonachus schauinslandi V758 trgv NINY01007792.1 5487136 GGAGLKLDQPALVVVRLPLESSATLQCKVDTSVSYVHWYRHQEGTAPKRLLYLDMSRSYVQRDFPMKADKVNAKKGRESNSCILSVMKLEKRDEGVYYCAAWE
Neomonachus schauinslandi V759 trgv NINY01007792.1 5387105 GHAETRLEQPAVVVAHEGSSATLLCTANTKVSYIHWYIHQEGKAPQRLLRLAMDQSDVQWDSVEKVDKVNAIEAKDGYRCALLLLKLEKRDEGLYYCAAWE
Neomonachus schauinslandi V760 trgv NINY01007792.1 5355594 TNADILITQLIPSITKKQGNTAFLECQIKTSGLRNNVYIHWYRQKSDQPLKRILYISSNENVVHEQGVSEERYEARKRQSDLPASLRIHQVNEEDAGLYYCACWD
Neomonachus schauinslandi V761 trgv NINY01007792.1 5326037 GLGQVKLEQPEISISRARDKSAYISCKVSAKDFNDEVIHWYRQKPDQEIEHLTYIQANSVQVSLGGKKNKLEASKNTHTSTATLNVNFLEQEDEAMYYCACWSR
Neomonachus schauinslandi V763 iglv NINY01007794.1 3287613 QSVLTQPSSMSGTLGQRVTISCTGSSSNIGRDNYVSWIQQLPGKSPKTVIYGTSSRPSGVSDRFSGSRSGSSGTLTITGLQAEDEAEYYCST
Neomonachus schauinslandi V778 iglv NINY01007811.1 14226 SWAQSPLTQPSSVSGALGQTVTISCTGTSNDIGKYNYVSWYQQLPGMSPKLLIYDVSSWPSGIPDRFSGSKSGNTASLTISRLQAEDEADYYCSSYAGS