WGS Statistics
Organism WGS Record. Vs Total IGHV IGLV IGKV TRAV TRBV TRGV TRDV
Psammomys obesus NESX00000000.1 (NESX01) 234 41 17 79 60 23 7 7
Vgene Table
Organism Vgene Locus contig Contig Pos. AA sequence
Psammomys obesus V0 igkv NESX01000001.1 19659 AEGDIVMTQSPEIMSTSVGDRITLNCKSSQNVGSSVHWYQQKPGQPPKLLISYASDRYTGVPDRFTGSGSGTDFTLSISSVQAEDLADYYCQQSSSNP
Psammomys obesus V12 trgv NESX01001037.1 125749 GQTSSSLEARIKSITKTRGSIAKITCDTHTADKYIHWYRFQKGSAPQHLLYYSVSTSTTVVDSGFDSKKYHVYEGTDNSYIFVLLNVEESDSALYYCATWT
Psammomys obesus V13 trgv NESX01001038.1 7834 GLGKLEQPEVSVSRAKDESAQISCKVSINSFKSVAIHWYRQKPNQGLEFLLYVIATPTRILINEKFKKMEASKNTSASTSTLTIYSLEEEDEAIYYCSYS
Psammomys obesus V14 trgv NESX01001039.1 2335 GSIPTSRLETYVTKKKGNTAFLRCQIKTGVLNHNTYIHWYQEKPGQPLKRMLYISSKENIVYEKGFSEERYEVKKWQSDLSSILRIHYVTEEDTGTYYCACWG
Psammomys obesus V15 trgv NESX01001039.1 4713 GDSWISQDQLSFTRKPNKTVHISCKLSGVPFQNTIVHWYQLREGEPLKRIFYGSSKTYKQDNPHSRFETDEKNDGTFYLIINNVIKSDEAMYYCACWD
Psammomys obesus V16 trgv NESX01001039.1 75433 GLGQLEQTEMSVTGLTGESVQIPCKVSLSDFGNRYIHWYRQKTNQEVEYLLYVKNNYHQLSLEGKNKKIEAGKDFVTSTSTLKVNFLKKEDEATYYCAAWIL
Psammomys obesus V17 trgv NESX01001039.1 79263 GLGQLEQTEMSVTGLTGESAQISCKVSLSDFGNIYIHWYRQKTNQEFEHLLYVKNSYDQLYLDGKNKKIEAGQDFLTSTSTLKVNFLKKEDEATYYCAVWIL
Psammomys obesus V83 igkv NESX01012226.1 812 TEGNIVMTQSPEFMSTSVGVRITLSCKSSQSVSGYVAWYQQKQGQPPKLLIYSASNRYTGVPDRFTGSGSGTDFTLSISSVQAEDLADYYCQQHYSTP
Psammomys obesus V84 igkv NESX01012231.1 3629 AEGNIVMTQSPEFMSTSVGDRITLSCKSSQSVSGWVAWYQQKPGNPPKLLIYDASNRYTGVPDRFTGSGSGTDYTLSISSVQDEDLAVYYCQQYDNTP
Psammomys obesus V85 igkv NESX01012232.1 5862 AEGNIVMTQSPELMPTSVGDRITLGCKASQSVSNDVHWYLQKSGQPPKLLISYASNRPSGVRYCFTGSGSGTDFTLSISSVQAEELAVYYCLQ
Psammomys obesus V86 igkv NESX01012233.1 37841 AEGNIVMTQSPEFMSTSIGDRITISCKSSQSVKSYVAWYQQKSGQPPKLLIYGASTRPSGVPDRFTGSGSGTDYTFTISSVQPEDSAVYYCQQGYRT
Psammomys obesus V87 igkv NESX01012237.1 19533 AEGNIVMTQSPEFMSTSVGDRITLTCKSSRNVYKGVAWYQQKSGQPPKLVIYGASNRQTGVPDRFTGSGSGTDFTLSISSVQAEDLAVYYCQQGYSYP
Psammomys obesus V88 igkv NESX01012237.1 42922 AEGNIVMTQSPEFMFASVGERITLSCKSSQSVGSYVAWYQQKSGQPPKLLIYDASTRYTGVPDRFTGSGSGTDFTLSISSVQAEDLAVYYCQQHYSYP
Psammomys obesus V89 igkv NESX01012240.1 6051 AEGNIVMTQSPELMSTSVGERISLSCKSSQNVGTAIAWYQQKSGQPPKLLISSASSRYTGVPDRFTGSGSGTDFTLSISSVQAEDLAVYYCQQYSSYP
Psammomys obesus V220 trbv NESX01030356.1 2544 DMEAAVTQSPRNKVTVTGGNVTLSCHQTNNHEYMYWYRQDMGHGLRLIHYSYGAGKTEKGDVPDGYKASRPRQEDFSLMLELASPSQTAVYFCASSD
Psammomys obesus V221 trbv NESX01030357.1 3534 DMEAAVTQSPRNKVTVTGGNVTLSCHQTNNHDYMYWYRQDMGHGLRLIHYSYVAGKTEKGDVPVGYKASRPRTEVFSLMLELASPSQTAVYFCASSD
Psammomys obesus V222 trbv NESX01030357.1 7643 LSEAGVTQSPRYAIIQERQAVSFQCDPVSGHITLYWYQQPKDQGPQLLVYFQNKDVVDDSQLPKERFSAVWSNGVESTLKIQSAKLGDSATYLCASSL
Psammomys obesus V223 trbv NESX01030359.1 1091 PTNAGVTQTPRHKVTVKGQEVTLSCEPISGHSSISWYRQTTVQGLEFLINFRNQAPIDDTGMPKERFSVQMPSKNLSTVKIQPTQPQDSAVYLCASSL
Psammomys obesus V224 trbv NESX01030359.1 25901 TTHGGITQTPKFLISQPGQKLTLKCEQNFNHDAMYWYRQDSGRGLQLIYYSITEKDLQKGELSEGYDASREKKLFFHLTVTSAQKNQMAVYLCASSI
Psammomys obesus V226 trbv NESX01030360.1 12088 AVDTGVIQNPRHLVKGKEQKARMDCSRIKGHSYVYWYYKKLGEELKFLVYFQNEEILEKTDMFDKNISAKCPTDKPCFIEIQSSKPTDSAVYFCASSL
Psammomys obesus V227 trbv NESX01030361.1 89 SLGGQIIQTPRHLFKGNGQKANMSCTPEKGHTFVYWYQQKQDKELRFLISFQRQDVRDSIDLVKERFLAECPVNSPCSLEIQSSEAGDTALYLCASSL
Psammomys obesus V228 trbv NESX01030361.1 3301 SFYAAVTQTPRHLIKMKGEKAKMNCTPEKEHTAVFWYQQTQSRELKFLIYFQNQRPVDQIDMIKERFSAECPSSSLCSLEIKTSEAEDTALYFCASSR
Psammomys obesus V229 trbv NESX01030361.1 5280 SFDAKVTQTPRYLIKEKGQKANMSCFPEKGHTAFYWYQQDQKRELKLLINFRNEDIIEQTDVVKKRFSAKCPSNSPCSLEIQSSEAGDSALYLCASSQ
Psammomys obesus V230 trbv NESX01030364.1 18683 LVDMKVTQTPRYLIKRMGENVLLECIQDMNHERMYWYRQDPGLGLWLIQFSYDVDSNDKGDIPDGYRVSRKKREHFSLILESAEANQTSVYFCASSI
Psammomys obesus V231 trbv NESX01030364.1 33198 SVFSVRVYQKPNRDICQSGTSLKIQCVVDSQVTVMLWYRQFQGQSLELMATANQGREATYENGFTNDKFPISFPNLTFSTLTVNSMRPEDSSVYFCSAR
Psammomys obesus V307 trav NESX01041689.1 194357 ASGQGVEQPATLMSVEGSFVQINCTYSTSGFNGLSWYQQREGRAPIFLSYAVLDGLKDSGPFSTFLRRSDGYSYLLLTELQIKDTASYLCAVR
Psammomys obesus V309 trav NESX01041691.1 2826 ASRGERVNQSPSHLSVQEGASAVITCTYTDDNSYYFSWYKQEPGAGLQFFINVISGMDRKQEQGLIVLLNKKEKRLSLNITAARPGDSATYFCAAS
Psammomys obesus V310 trav NESX01041691.1 16973 GTRGMQVEQSPSVLSLHEGTSFALRCNFSTTMTTVQWFRQNPQGSLINLFYLALGAKENGRLKSTFDSKESYSTLHIRDAQLEDSGTYLCAAE
Psammomys obesus V311 trav NESX01041693.1 4135 ESRGEQVKQHPSSLSVREGDSAVINCTYTDSASAYFPWYKQEPGKSPQFIFDIRSNMERKQNPRLSLLLDKKEKHLSLHVTATQPGDSAIYFCTAD
Psammomys obesus V312 trav NESX01041693.1 19846 RIHGDSVTQKQDQVTLSEDSVLFINCTYSSTGYPTLFWYVQYSGESPELLLKVTTAGEKGSSRGFEATYDKGTTSFHLQKASVQESDSAVYYCALR
Psammomys obesus V313 trav NESX01041693.1 24615 VSSQPKVQQNPESLSVTEGAMASLNCTSSDRNSQYFWWYRQHSGQDPKALMSIFSNGDKEEGRFTAHLNRASLHVSLHIRDSQPSDSAVYLCAV
Psammomys obesus V314 trav NESX01041694.1 7960 ESLREQVEQHPSSLSIGEGGSAVINCTYTDSASSYFPWYKQEAGNGPHLVIDILGNVDRKQNQRLTILLDKKAKHFSLHITDTQPEDSAVYFCAA
Psammomys obesus V315 trav NESX01041695.1 7518 VSSQQKVQQNPEALSVPEGAMASLNCTSSDSASYNFWWYRQLSGKGLELLMSIVSNGDKEEGRFTAHLNRASLHAALHIRDSQPSDSAVYLCAV
Psammomys obesus V316 trav NESX01041697.1 7197 VKGQQVELSPVSLVLQEGENATLQCNFSSTAITQLQWFYQSPGTSPQPAFHSFWNKAQWKTDIHDSPCGATQLFLYISSSQSTDSGTYLCAVD
Psammomys obesus V317 trav NESX01041700.1 9403 VSSQQKVQQIPEALSVPEGAMASLNCTFSDGVSNIFSWYRQHCGKGLELLVSIFSNGNKEEGRFTAHLNKASLHVSLHIRDSQPSDSAVYLCAV
Psammomys obesus V318 trav NESX01041700.1 17465 SSNGDSVMQTEGLVTVTEGLPVMLNCTYQTTYPNPFLFWYVQYLNEAPQLLLRSSTDNKRTEHRGFHATLHKSSSSFHLQTSSVQLSDSALYYCAL
Psammomys obesus V319 trav NESX01041700.1 28016 VKGQKVEQRPATLVLQEGESATLQCNFSSTAVTQLQWFYQSPGEPLLSLLSNLSGTKRSGRLTSTTVPVELGSSLYISSSQTTDSGTYLCAMD
Psammomys obesus V320 trdv NESX01041700.1 40686 CNVAQKVTQVESTTSSQFGEKVTLDCSYETSYYNYQLFWYKQLVTGEMIFLIRQISTSFQNERNGRYSVTLKRSAKSFSLVISALQLEDSGMYFCALCEL
Psammomys obesus V321 trav NESX01041700.1 50250 RIHGESVTQKQSQVTLSEDSVLFINCTYSATGYPTLFWYVQYPGEGPQLLLKVITAGEKGSSRGFEATYDKGTTSFHLQKSLVQESDFAVYYCALR
Psammomys obesus V322 trav NESX01041700.1 53542 VSSQLKVEQIPEFLSVPEGAMASLNCTFSDRNSQYFWWYRQHSGKGLEALMFIVSNGDKEEGRFTAHLNRASLHVSLHIRDSQPSDSAVYLCAV
Psammomys obesus V323 trav NESX01041700.1 67194 AVQTQSVTQSDAQVTVFEGESVELKCNYSYGGALYLFWYIQHRGHGPQLLLRYYSGDPVVHGMNGFEAEFSKKDSSFNLRKAPVHWGDSAVYFCALS
Psammomys obesus V324 trav NESX01041701.1 6388 ESLGEQVEQHPSSLSIGEGGSAVINCTYTDSASSYFPWYKQEAGNGPHFVIDIPGNVDRKQNQRLTVLLDKKAKRFSLHITDTQPGDSAMYFCAA
Psammomys obesus V331 igkv NESX01042479.1 2565 VCADIVMTQSPSSLAVSEGEKVSISCRSSQSLYYSDNQKNLLSWYQQKPGQSPKLLVYWASTRYTGVPDRFTGSGSGTDFTLSISSVQAEDLAVYYCMQYRSYP
Psammomys obesus V332 igkv NESX01042484.1 7879 ACADIVMTQSPSFLAVSAGEKVSISCRSSQSLYHSSSKKNFLSWYQQKPGQSPKLLIYHASTRYTGVPDRFTGSGSGTDFTLSISSVQDEDLATYYCLQDISA
Psammomys obesus V385 trdv NESX01049071.1 6965 YNVAQKVTQIQSTASSQYGEEVTLDCSYETSQYLYRLFWYKQLVTGEMIFLISQLSSTQNERNGRYSVTLQKSAKSFSLVISASQLEDSGTYFCALREL
Psammomys obesus V408 trav NESX01051301.1 1490 TSMAQKVTQAQTSVSVMEEKTVTLDCVYETRESTYYLFWYKQTASGEMVFLIRQDSYQKENATEGHYSLNFQKSESSIGLIISATQIEDSAVYFCAMRE
Psammomys obesus V409 trav NESX01051301.1 7849 VRGQQVEQRPATLVLQEGENATLQCNFSTAITQLQWFYQSPGGRLISLLSNPSGTKQRGRLTSTTVPVERRSSLYISSSQTTDSGTYLCAVDPQCS
Psammomys obesus V410 trav NESX01051306.1 17831 ASRGERVDQSPSHLSVQEGASAVITCTYTEDNSYYFFWYKQEPGAGLQFFTNVISGVDRKQEQGLIVLLNKKEKRLSLNITAARPRDAATYFCAAS
Psammomys obesus V411 trav NESX01051306.1 19095 KSTGNSITQTEGPVTLAARTPLVLNCTYQTTYSNPFLFWYVQYLNEAPQLLLKSSTDNKRTEHRGFHATLRKSSSSFHLQKSSVQLSDSALYYCAVR
Psammomys obesus V412 trav NESX01051307.1 15773 GNKAQSVTQPDAYITVSEGASLELRCSYSYGATPYLFWYFQYPGQSLQLLLKYVTGDTLVKGVHGFEAEFRKSNSSFNLRKSPARWSDSAKYFCALS
Psammomys obesus V413 trav NESX01051308.1 15465 VGTQQLEQSPQFLSIQEGQDFTLYCNSSSTLPQLYWYRQVPGEGPAMLMTLARSGEVKEQKRITAKFGEARRGSSLSIIRTQPGDAGIYFCAG
Psammomys obesus V414 trav NESX01051309.1 32657 IVGDAKTTQPELMESTEGETVQLPCSHSTISGNEFIYWYRQVPLQGPEYVIHGLEENTTNRMASLAITSDRKSSTLVLPRVSLSDAAVYHCILIV
Psammomys obesus V416 trav NESX01051310.1 7156 VKGQLLSQSTQYLSIPEGKDASMSCNSSSTLNNFLWYKQDPKEGLVLLVALYKTGELARNGKVTAEFSGSRKDSVLTISASEPADTSTYFCAG
Psammomys obesus V418 trav NESX01051310.1 57792 ASMAQTVTQPQQEKSVQEAESATLDCTYDTSDTSYYLFWYKQQGGRMTLVILQEAYRQQKARQDHFSVNFQKAAKSFSLEISDSQLRDTVTYFCALME
Psammomys obesus V419 trav NESX01051310.1 80945 ASMAQTVTQPQQEKSVQEAESATLDCTYDTSDTSYYLFWYKQQGGRMTLVILQEAYRQQKARQDHFSVNFQKAAKSFSLEISDSQLRDTVTYFCALME
Psammomys obesus V420 trav NESX01051311.1 382 LTGEKTVEQNPLFLSIWEGTNSTIYCNYSSSATDRLSWYRQDPGKSPEFLFVLLWNGAVTRDRRLTASLDSKAHVSTLHFSGLQHRHSATYFCAV
Psammomys obesus V421 trdv NESX01051311.1 85243 VSLDVILEPVDKTLTVVAGNPATFYCTVTGGDLKNYQMSWYKKNENNALILVYKLNNHSTDDLMGNFKGKINVLKSQFILDIQKATTKDAGTYYCGSD
Psammomys obesus V425 igkv NESX01051954.1 8241 AEGDIVMTQSPETMSTSVGDKISLSCKSSQSVGSYVAWYQQKPGQSLKRLIYYASTRDTGVPDRFTGSASGTDFTLSISSVQAEDLAVYYCQQGYSIP
Psammomys obesus V426 igkv NESX01051957.1 26595 AEGDIVMTQSPEIMSTSVGERISISCKSSQSVYSNVAWYQQKSGQPPKLLIYGASYRQTGVPDRFTGSGSGTDFTLSISSVQAEDLAVYYCQQYYDYP
Psammomys obesus V427 igkv NESX01051958.1 13047 AQGNIVMTQSPEFMSTSVGDRITLSCKSSQNVDKYVAWFQQKSGQPPKLLIYDTSTRHTGVPDRFTGSRSGTDFTFTISSVQDDDLAVYYCQQHSSYP
Psammomys obesus V428 igkv NESX01051959.1 3158 KCADIMMTQSSSSLAVSAGDKVTISCNSSQRLTLGSLNYLVWYQQKPGQSPKLLIYWASTRQTGVPDRFTGSGSGTDFTLSISSVQAEDLAVYYCQQYGSTP
Psammomys obesus V429 igkv NESX01051964.1 48014 AWADIVMTQSPSSLAVSEGEKVTISCRSSQSLLDSGNQKNYLAWYQQKPGQSPKRLIYYASTRHTGVPDRFTGSGSGTDFTLTISSVQNEDLADYYCQQHLSAP
Psammomys obesus V474 igkv NESX01057367.1 3655 ACADILMTQSPSSLAVSAGEKVSISCRSSQSLYYSGNQKNYLSWYQQKPGQSPKLLVYWASTRHTGVPDRFTGSGSSTDFTLSISSVQDEDLAVYYCQQHYSTP
Psammomys obesus V475 igkv NESX01057368.1 3894 IMMTQSPSSLAVSAGEKVSISCRSSQSLYYKDYLLQKNLLSWYQQKPGQSPKLLIYHASTRQTGVPDRFTGSGSGTDFTLTISSVQAEDLAVYYCQQGISTP
Psammomys obesus V477 igkv NESX01057563.1 4849 ACADIVMTQSPSSLAVSAGEKVSINCKSSQSLYYNSNQKNYLAWYQQKPGQSPKLMIYWASTRDTGVPDRFTGSGSGTDFTLSISSVQAEDLAVYYCMQHYSYP
Psammomys obesus V482 trbv NESX01058368.1 18334 PVDPRIIQKPKHLVTVMGSERTLICEQYQGHNAMYWYRQSATQSLELMFSYNYQKLFENQTLTNRFQPHNLEKSYLDLQITALQPDDSATYFCASSQ
Psammomys obesus V483 trbv NESX01058368.1 19781 HTGPNVVQIPSHQVKDVNQTVTLSCDPVSNHLYFYWYKQILGQQMEFLVSFYSGKVLDKSELFKDRFSVERPDGSYFTLKIQPTNLKDSAVYFCASSL
Psammomys obesus V484 trbv NESX01058368.1 28051 PLETAVLQTPKYLVTQVGNDVSLKCEQNLGHDAMFWYKQDYELKIMFSYNNKQRILNETVPSRFSPQAPDKAHLNLHVKSVERDDSAAYFCASSY
Psammomys obesus V485 trbv NESX01058368.1 31807 LTNTKITQTPRYLVMGRASKKSLKCEQHLGHNAMYWYKQNAKKPPELMFLYNVRKLIENTTVPIRFLPECPDSSHLLLHMSALEPEDSAVYFCASSQ
Psammomys obesus V486 trbv NESX01058368.1 56285 SVNAGIIQTPKSLLLKTGQHVIMRCTQDMKHDSMFWYRQDPGLGLRLIYYSYDVDAISKGDVPDGYNVSRPRTEDFPLTLKSASPSQTSVYFCASSY
Psammomys obesus V487 trbv NESX01058368.1 59035 LTNTGVSQSPMYRVTKRGQYVVLQCDPISGHTHLYWYRQKPRQGPEFLVYFQGEVLIDKSGMPSDRFSAVRPLGFFSSLMIQSTDHEDSGIYLCASNL
Psammomys obesus V488 trbv NESX01058369.1 1127 LTDAGITQTPRYGITQTARKKVLECSQNMNHNWMFWYRQDAGQGLRLIHYSGSVGSSTEGDVPEGYTASRNKKEHFLLTLESTSPNQTASYFCASS
Psammomys obesus V489 trbv NESX01058370.1 6284 DMEAAVTQSPRNKVTVTGGNVTLSCHQNNNHEYMYWYRQDMGHGLRLIHYSYGAGSTEKGDVPDGYKASRPRTEDFSLMLELASPSQTAVYFCASSD
Psammomys obesus V490 trbv NESX01058370.1 12655 AESTEVVQSPRHIIKEKGGGTILKCIPISGHDNVLWYQQTQGRELKFLIQHYQTSEGEKGTIPNRFSVQQFSDYHSEMNMSALELEDSAVYFCAS
Psammomys obesus V491 trbv NESX01058370.1 15067 DMEAAVSQSPKNKVTVTGGNVTLSCHQTNNHNNMYWYRQDMGHGLRLIHYSYGAGSTEKGDVPDGYKATRLIQQNFSLMLELASPSQTAVYFCASSD
Psammomys obesus V492 trbv NESX01058372.1 3300 DMEAAVTQSPRNKVTVTGGNVTLSCHQTNNHEYMYWYRQDMGHGLRLIHYSYGAGSTEKGDVPDGYKASRPRTEDFSLMLELASPSQTAVYFCASSD
Psammomys obesus V494 igkv NESX01058956.1 3945 ACADIVMTQSPSFLAVSAGEKVSISCRSSQSLYHSSSKKNLLSWYQQKPGQSPKLLINDASTQDTGVPDRFTGSGSGTDFTLSISSVQAEDLAVYYCLQGISTP
Psammomys obesus V495 ighv NESX01059197.1 971 VQCEVQLVESGGGLVQPGKSLKLSCVASGFTFSNYYMNWVRQAPGKGLEWVADISGDSSDINYADAVKGRFTISRDNAKNTLYLQMNSLRSEDTATYYCAT
Psammomys obesus V496 trav NESX01059244.1 1789 RTHGDSVTQTESQVVLSEDEFLTIHCNYSASGYPTLFWYVQYPGEGPQLLFRASKANDKGSSRGFEATYDKETKSFHLQKASVQESDSAVYYCALS
Psammomys obesus V497 trav NESX01059245.1 9262 VSSQQKVQQNPESLSVPEGAMTSLNCTFSDSASQTFWWYRQHSGQGPKALMSIFSNGDKEEGRFTGHLNKASLHVSLHIRDSQPSDSAVYLCAV
Psammomys obesus V498 trav NESX01059247.1 1057 VKGQKVEQRPATLVLQEGENATLQCNFSTAVTQLQWFYQSPGGRLISLFYNPSGTKQSGRLTSTTVPVERRSSLYISSSQTTDSGTYLCAIIHSA
Psammomys obesus V499 trdv NESX01059247.1 8450 FSTAQKVTQVQPAIKKQEGEQVTMDCSYETSMSFYQLYWYKQRPSGDMIFLIRQVSSSHHNESSGRYSVIFQKSAKSINLIISASQVEDSMNYFCALVEP
Psammomys obesus V501 igkv NESX01059614.1 4107 AEGDIVMTQSPEIMSTSVGDSITLNCKSSQNVGSNVHWYQQKPGQPPKLLIYDASNRYTGIPDRFTGSGSGKDYTLSINSVQAEDLAVYYCQQGYSYP
Psammomys obesus V502 igkv NESX01059615.1 2886 AEGDIVMTQSPEIMSTSIGERITLNCKSSQNVGSNVHWYQQKPGQPLKLLIYGASNRYTGVPDRFTGSGSGTDYTLSISSVQAEDLAVYYCQQGYSYP
Psammomys obesus V503 igkv NESX01059736.1 23584 AEGNIVMTQSPELMSTSGDRITLGCKSSQSVSNNVHWYLQKSGQPPKLLISYASNRPSGVPDRFTGSGSGTDFTLKINSVQAEDLAVYYCLQSYSSP
Psammomys obesus V504 igkv NESX01059737.1 3681 AEGDIVMTQSPETMSTSIGDRITLNCKSSQNVGSNVHWYQQKPGQPPKLLIYGASNRYTGVPDRFTGSGSGTDFTLSISSVQAEDLADYYCQQGSSYP
Psammomys obesus V505 ighv NESX01059970.1 2450 GLAQPGKSLKLSCAASGFTFSSYWMSWVCQAPGKGLEWIAAISYNSDTIYYADAVKGRFTISRDNAKNTLYLQMNSLRSEDTATYYCARDTVSECC
Psammomys obesus V506 igkv NESX01060083.1 5945 MVMTQSPSSLAVSAGEKVNISCRSSQSLYYKGYLLQNNLLSWYQQKPGQSPNLLVYWASTQQTGVPDRFTGSGSGTDFTLSISSVQAEDLAVYYCLQSVSTP
Psammomys obesus V507 trav NESX01060204.1 8791 VSSQQKVQQNPESLSVPEGAMTSLNCTFSDSASQTFWWYRQHSGQGPKALMSIFSNGDKEEGRFTGHLNKASLHVSLHIRDSQPSDSAVYLCAV
Psammomys obesus V508 trav NESX01060204.1 22804 VKGQQVEQRPATLALQEGENATLQCNFSSTATQLQWFYQSPGGRLISLLSNPSGTKQRGRLTSTTVPVERRSSLYISSSQTTDSGTYLCAIIHSA
Psammomys obesus V510 trav NESX01060485.1 3010 VSSQQKVQQNPEFLSVLVGAMASLNCTFSDSTSNNFRWYRQHSGQGLELLISIFSNGDKEEGRFTAHLNRASLHVSLHIRDSQPSDAAVYLCAA
Psammomys obesus V511 trav NESX01060486.1 4678 GVRGAEVEQSPSVLSLQEGTSSALRCNFSTTMKSVQWFRQNPRGSLISLFYLAAGTKENGRLKSTFDPKEPYSTLHIRDTQMEDSGTYLCAAE
Psammomys obesus V512 trav NESX01060486.1 11208 MSQGEQVEQHPSILRVQEGASAIINCTYTDSASNYFPWYKQKPGKGPQFITDIRGNVDRKQNQKLTVLLDKKSKHFSLHITDTQPGDSAMYFCAAS
Psammomys obesus V513 trav NESX01060487.1 3104 RTHGDSVTQTESQVVLSEDEFLTIHCNYSASGYPTLFWYVQYPGEGPQLLFRASKANDKGSSRGFEATYDKETKSFHLQKASVQESDSAVYYCALS
Psammomys obesus V515 trav NESX01060757.1 7707 VSSQEKVQQNPESLSVPEGAMASLNCTSSDSASYNFWWYKQHSGKGLELVMSIFSNGDKEEGRFTAHLNRASLHVSLHIRDSQPSDSAVYLCAV
Psammomys obesus V516 trav NESX01060757.1 16338 SSNGDSVMQTEGLVTVTEGLPVMLNCTYQTTYTNTFLFWYVQYLNEAPQLLLRSSTDNKRTEHRGFHATLHKSSSSFHLQTSSAQLSDSALYYCAL
Psammomys obesus V517 ighv NESX01060774.1 2136 VQCEVQLVESGGGLVQPGKSLKLSCAASGFSFSYSDMSWVRQAPGKGLEWVAYISYNSGTIYYADAVKGRFTISRDNAKNTLYLQMNSLRSEDTATYYCAA
Psammomys obesus V518 ighv NESX01060774.1 15345 VQSDVQLVESGGGLVPPGKSLKLSCAASGFTFSNYVMHWFRQAPGKGLEWVAYISERSIKINYADAVKGRFTISRDNAKNTLYLQMNSLRSEDTATYYCAR
Psammomys obesus V520 trav NESX01060900.1 4317 VSSQQKVQQNPESLSVPEGAMASLNCTFSDSASQNFWWYRQHSGQGPKALMSIFSNGDKEEGRFTAHLNRASLHVSLHIRDSQPSDSAVYLCAV
Psammomys obesus V521 trav NESX01060901.1 4374 VKGQKVEQRPATLVLQEGENATLQCNFSTAITQLQWFYQSPGGRLISLFYNPFGTKQSGRLTSTTVPVERRSSLYISSSQTTDSGTYLCAVDPQCS
Psammomys obesus V522 igkv NESX01060960.1 7060 ACADIVMTQSPSSLAVSTGEKVTINCRSSQSLLGSKSQKNLLSWYQQKPGQSPKLLIYWASTRHTGVPDRFTGSGSGTDFTLSISSVQAEDLAVYYCMQGKSTP
Psammomys obesus V523 igkv NESX01060961.1 6647 VCADIVMTQSPSSLAVSAGEKVSISCRSSQSLLYSKDQKNYLAWFQQKSGQSPKLLIYYASTWHTGVSDHFTGSGSGTDFTLSISSVQDEDLAVYYCQQHY
Psammomys obesus V524 igkv NESX01060965.1 14718 TCADIVMTQSPSSLAVSAGEKVSISCRSSQSLYHNRSKKNLLSWYQQKPGQSPKLLMNDASTRDTGVPDRFTGSRSGTDFTLSISSVQDEDLAVYYCMQGASTP
Psammomys obesus V525 trdv NESX01061054.1 717 CNVAQKVTQVQSTTSCQFGEKVTLDCSYETSYYNYQLFWYKQLVTGEMIFLIRQISSSVQNERNGRYSVTLQKSAKSFSLVISASQLEDSGTYFCVLREL
Psammomys obesus V526 trav NESX01061054.1 9140 RIHGESVTQKQSQVTLSEDSVLFINCTYSATGYPTLFWYVQYPGEGPQLLLKVITAGEKGSSRGFEATYDKGTTSFHLQKSLVQESDFAVYYCALR
Psammomys obesus V527 trav NESX01061056.1 3258 AVQTQSVTQSDAQVTVFEGESVELKCNYSYGGALYLFWYIQHRGHGPQLLLRYYSGDPVVHGMNGFEAEFSKKDSSFNLRKAPVHWGDSAVYFCALS
Psammomys obesus V528 ighv NESX01061066.1 11531 PDVIAPSGSLSLTCLVSGFSITTNGYCWHWIRQLPGKGLEWMGCICYEGSTYYSPSFKSRSHISRDTSMSKFSIQLSSVTTEDTAVYYCSRD
Psammomys obesus V529 ighv NESX01061069.1 2769 VQCEVQLVESGGDVVQPGGSLKLSCVGSGFTFTSYWMHWVRQAPGKGLEWVGAINPNDGTTHYAPSLKDRFAISRDNAKSTVYLQMSKVRAEDTATYYCAR
Psammomys obesus V530 ighv NESX01061069.1 5151 VHSQVQLQQSGAEVGRPGSSVKLSCKASGYNFAIYYMHWVKQRPGQGLDWIGYIYGNGGSTSYNQKFQGKATLTVDTSSSTAYMELRSLTAEDSAAYYCARH
Psammomys obesus V531 ighv NESX01061069.1 10784 IHPQVQLLQSEAELGRPGTSVKLSCQVSGYTFTDNAVHWVKHRLGQRLEWIAYIYPGSGSTTFNEKFQGKATLTADTSSSTAYMELRSLISEDSAVYYCA
Psammomys obesus V532 ighv NESX01061069.1 16179 VLSQVTLKESGPGLLQPSETLSLTCTFSGFSLSTSGICVGWIRQPPGKGLEWLARIDWDDDKYYNPSLKSRLTISKDSSNNRVFLKLASVDTADSATYYCARR
Psammomys obesus V533 ighv NESX01061069.1 22109 QVQLVQSGSELKKPGESVKISCKASGYTFTDYGMNWVKQAPGKGLEWMGWINTYTGNPTYAEDFKGRFVFSLDTSVSTAYLQINSLKNEDTAMYYCARRDSVK
Psammomys obesus V534 ighv NESX01061073.1 4431 QVQLVQSGSELKKPGESVKISCKASGYTFTDYGMNWVKQAPGKGLEWMGWINTCTGNPTYAEDFKGRFVFSLDTSVSTAYLQINSLKNEDTAMYYCARRDSVK
Psammomys obesus V535 igkv NESX01061079.1 15343 ACADIVMTQSPSSLAVSAGEKVSISCRSSQSLYHSSSKKNLLAWYQQKSGQSPKLLIYWASTRDTGVPDRFTGSGSGTDFTLTISSVQAEDLAVYYCQQGYSYP
Psammomys obesus V536 igkv NESX01061079.1 33557 ACADIVMTQSPSSLAVSAGEKVSISCSSSQSLLSSKDQKNYLAWYQQKPGQSPKLLIYWASTQDTGVLDRFTGSGSGTDFTLTISSVQAEDLAVYYCLQSISTP
Psammomys obesus V537 iglv NESX01061159.1 16042 AMSQAVVTEESSITTSPGGTVTLTCGSSTGAVTTSNYANWVQQKPYKLPTGLIGGTSNRDPAVPARFSGSLLGDKAALTIIGAHPEDEAVYYCALWFS
Psammomys obesus V538 iglv NESX01061159.1 27286 SWGQFSLTQPNSVSGSLESTVTISCKRSSGNIGSRYVHWYQQHEGRPPTLVIYENNKRTSGIPDRFSGSIDSSSNSASLTISNVLAEDEADYYCQSYDSGY
Psammomys obesus V539 ighv NESX01061318.1 9712 ALSQVQLKESGPGLVQPSQPLSLTCTVSGFSLSSYGVHWVRQPPGKGLEWMGAIWSGGGTDYNSALKSRLSISRDTSKSQVFLKMNNLQTEDTAVYFCAR
Psammomys obesus V540 iglv NESX01062123.1 2638 SWGQFSLTQPNSVSGSLGSTVSLSCKRSSGNIGSSYVSWYQQHEGRSPTNVIYEHDKRPSGIPDRFSGSIDSSSNSASLTIRNLQAEDEADYFCLSYDSSY
Psammomys obesus V541 igkv NESX01062582.1 2960 SRGDIVMTQSPSSLAVSAGEKVTISCRSSQSLLYNKDQKNYLAWYQQKPGQTPKLLIYYASTRHTGVPDRFTGSGSGTDFTLSISSVQAEDLAVYYCLQSYSAP
Psammomys obesus V542 igkv NESX01062609.1 342 ACADIVMTQSPSSLAVSAGEKVSISCRSSQSLLYSKDQKNYLSWYQQKPGQSPKLLVYLASTRYTGIPDRFTGSGSGTDFTLSISSVQDEDLAVYYCMQSYSAP
Psammomys obesus V543 igkv NESX01062786.1 889 TCADIVMTQSPSSLAVSAGEKVTISCKSSQSLTLGGTNFLSWYQQKPGQSPKLLIYWASTRHTGVPDRFTGSGSGTDFTLSISSVQAEDLAVYYCLQSKSTP
Psammomys obesus V544 ighv NESX01063048.1 1397 VHSQVQLQQSGAEVGRPGSSVKLSCKASGYNFASYYMSWVKQSPGQGLEWIGWINPANSGTSYNQKFQGKATLTVDKSSSTAYMELRSLTAEDSAVYYCA
Psammomys obesus V546 igkv NESX01000001.1 116435 TEGNIVMSQSPEFMSTSVGDRITLSCKSSQSVGNAVAWYQQKPGQSPKLLIYGASNRYTGVPDRFTGSRSGTDFTLTISSVQAEDLAVYYCQQYNSSP
Psammomys obesus V547 igkv NESX01000001.1 98466 AEGNIVMTQSPKVISTSVGDMITLGCKFSQNVYNNVAWYQQKSGQPPKLLIYSASTQHTGVPDRFTGSISGTDFTLSISSVQAEDLAVYYCQQHNSYP
Psammomys obesus V548 igkv NESX01000001.1 41030 AQGNIVMTQSPKVMSTSVGDRITLTCKSSQNVDNYVAWYQQKSRQPPKVLISYASNQHTGFPDCFTGSGSGTDFTLSISSVQCEDLAVYYCQQHYDYP
Psammomys obesus V549 igkv NESX01000004.1 3248 AEGNIVMTQTPEFMSTSIGERITLSCKSSQSVSGWVAWYQQKPGQPSKLLTYRASNRYTGVPDRFTGTGSGTDYTLAISSVQAEDLAVYYCLQYDSYP
Psammomys obesus V550 igkv NESX01000008.1 3909 AEGDIVMTQSPEIMSTSVGDRITLNCKSSQNVGSYVHWYQQKPGQPPKLLIYDASDRYTGVPDRFTGSGSGTDFTLTISSVQAEDLADYYCQQSNSNP
Psammomys obesus V561 trgv NESX01001039.1 58359 GLGQLEQTEMSVTGLTGESVQIPCKVSLPDFDKIDIHWYRHKTKQQFEYLIYVRMEYNQRPLEGKKKKIEGTKDFVTSTSTLKVNFLKKEDEATYYCAAWIL
Psammomys obesus V570 igkv NESX01003103.1 4779 AEGNIVMTQSPELMSTSVGDKITLGCKSSQSVSNDVHWYQQKSGQPPKLLIYYASNRPSGVPDRFTGSRSGTDFTLTISSVQAEDLAVYYCQQGYSYP
Psammomys obesus V571 igkv NESX01003104.1 11307 ADGSIMMTQSPEFMSTSVGDRITLSCKSSQSVRSYVAWYQQKPGQPPKLLIYRASTRYTGVPDRFAGSGCGTDFTLTISSVQAEDLAVYYCQQYDYTP
Psammomys obesus V661 ighv NESX01016130.1 14396 VHSQVQLQQSGAEVGRPGSSVKLSCKASGYTFTDYYMHWVKQRPGQGLEWIGRIDPENGDTDYNQKFQDKAKLTADTSSSTAYMELRSLTAEDSAVYYCA
Psammomys obesus V662 ighv NESX01016130.1 8532 LVKPGSSLRLSCAASGFSFDDACMHWVRQPPGKGLEWVATSRNQADSFTTEYSLFVEHRFTISRENSQNILYLQMNGLRVEDTVTYYCRGERQ
Psammomys obesus V663 ighv NESX01016133.1 42413 VHSQVQLQQSGSELVRLGSSVKLSCKASGYTFTSYYICWMKQSPGQGLEWIGYIYGNSGTGYNQKFQDKTTLTADSSSSTAFMTLSSLTAEDSAVYYCARQ
Psammomys obesus V664 ighv NESX01016133.1 34051 VQCEVQLVEYGGSLVQPGSSLKLSCAASGFKFSDTWINWVRQAPGKGLEWVALIKHKPDNYGTEYAEPVKGRFIISRDDSTSSLYLQMNSLRAEDTAIYYCVR
Psammomys obesus V665 ighv NESX01016133.1 20896 VQCEVQLVESGGGVVQPGDSLKLSCVGSGFTFTSYWMHWVRQAPGKGLEWVGAINPNDGTTHYAPSLKDRFAISRDNAKSTVYLQMSKVRAEDMGTYYCAR
Psammomys obesus V666 ighv NESX01016133.1 14627 VQCEVQLVESGGDVVQPGGSLKLSCVGSGFTFTSYWMHWVRQAPGKGLEWVGAINPNDGTTHYAPSLKDRFAISRDNAKSTVYLQMSKVRAEDTATYYCAR
Psammomys obesus V667 ighv NESX01016133.1 12266 VHSQVQLQQSGSEVGRPGSSVKLSCKASGYNFASYYMHWVKQRPGQGLEWIVWIGCGGGGTSFNQKFQGKATLTVDTSSSTVYMELRSLTTEDSAVYYCARD
Psammomys obesus V668 ighv NESX01016133.1 4555 VQAQVQLEQSGSELKKPRESVKISCRASGYTFTDYGMHWVKQVPGKGLEWMGAINTYNGNPTYAEDFKGRFVFSLDTSVSTAYLQINSLKNEDTAMYYCA
Psammomys obesus V669 ighv NESX01016134.1 16764 VHSQVQLQQSGAEVGRPGSSVKLSCKTSGYNFASYYMSWVKQSPGQGLEWIGYIYGNGGSISYNQKFQGKATLTVDTSSSTAYMTLSSLTAEDSAVYYCARH
Psammomys obesus V784 trbv NESX01030369.1 43883 VSAQTIHQWPAVKVQPVGSPLFLECTIKGKSNPNLYWYWQATGGPLQLLFYSFNVGEVEPGLPRNLSASRPKDGQFALSAEKLLLSHSGFYLCAWS
Psammomys obesus V798 trav NESX01033153.1 399 MSQGEQVEQHPSILRVQEGASAIINCTYTDSASNYFPWYKQKPGKGPQFIIDIRGNVDRKQNQKLTVLLDKKSKHFSLHITDTQPGDSAMYFCAAS
Psammomys obesus V799 trav NESX01033154.1 17215 VSSQQKVQQNPESLSVPEGAMASLNCTFSNSGSNNFWWYSQHSGQGPKALMSIFSNGDKEEGRFTAHLNRASLHVSLHIRDSQPSDSAVYLCAV
Psammomys obesus V800 trav NESX01033154.1 9932 RSNGDSVTQTEGLVTVTEGLPVMLNCTYQTIYTNTFLFWYVQYLNKAPQLLLRSSTDNKRTESRGFHATFRKSSSSFHLQTSSVQLSDSALYYCALG
Psammomys obesus V801 trav NESX01033154.1 4957 DTRAQSVTQPDAQVTVSKDASLQIRCNYSSSVPPRLFWYVQYPRQGLQLLLSYYSGDPVVHGMNGFEAEFSKRDSSFHLRKAPVHWGDSAVYFCALS
Psammomys obesus V802 trav NESX01033155.1 1790 VAGKTQVEQSPESLVILEGESCVLQCNYSVSPFNNLRWYKQDTGRGPVSLVIMTYAENKRSNGRYSAILDAVAKHSTLHITASLLEDTASYICVVG
Psammomys obesus V862 igkv NESX01039188.1 3415 SRGDIVMTQSPSSLAVSAGEKVTIRCRSSQSLYYSGNQKNYLSWYQQKPGQSPKLLIYYASTRHTGVPDRFTGSGSGTDFTLSISSVQAEDLAVYYCLQSYSAP
Psammomys obesus V872 iglv NESX01039882.1 4262 SMGQFSLTQPNSVSGSLGSTVTIPCQPSSGNIGSNYVYWYQQHLGRSPTLVIKYNNERPSGIPDRFSGSTDSSSNSASLRISNLQTEDEGDYFCQSYDSSY
Psammomys obesus V873 iglv NESX01039886.1 24156 SWGQFQLTQPNSVSGPLGSTVSLSCKRSSGNIGSKYVQWYQQHEGRSPTTVIYKDDQRPSGIPDRFSGSIDSSSNSASLTISNVQAEDEAVYYCQSYDSGY
Psammomys obesus V874 iglv NESX01039887.1 20519 AMSQAVVTQESSLTTSPGETVTLTCGSSTGAVTTNNYAIWVQEKPYQVHKGLIGDTNNRVPGVPARFSGSLIGDKAALTITGAQPEDEAVYYCALWFSNH
Psammomys obesus V875 iglv NESX01039890.1 43869 SCGQFVLTQPNSVSGSLGSKVTISCQRSSGNIGSSYVHWYQQHLGRSPTNVIYDNNNRPSEIPDRFSGSIDSSSNSASLTISNVQAEDEADYYCQSYDSSY
Psammomys obesus V876 iglv NESX01039890.1 15057 AMSQAVVTQESSLTTSPGETATLTCGSSTGAVTTNNYAIWVQEKPYHIHKGLIGSTSSRAPGIPARFSGSLLGDKAVLTITGAQPEDEAVYYCALWFS
Psammomys obesus V877 iglv NESX01039894.1 16932 SWGQFRLTQPTSVSGSLGSTVTISCLGSSGNIGDSYVNWYQQHEGRSPTNVIYADDQRPSGISDRFSGSTDSSSNSASLTISNVQAEDEADYYCQSYDSDY
Psammomys obesus V878 iglv NESX01039895.1 6617 AMSQAVVTQESSLTTSPGETVTLTCGSSTGAVTTSNYANWVQEKPYHIHKGLIGGTSNRAPGVPARFSGSLLGDKAALTITGAQPEDEAVYYCALWFS
Psammomys obesus V963 igkv NESX01050663.1 18800 AQGNIVMTQSPKVMSTSVGDRITLSCKSSQNVDNYVAWYQQKSRQPPKVLISYASNQHTGVPVRFTGSGSGTDFTLSISSVQAEDLAVYYCQQHYDYP
Psammomys obesus V964 igkv NESX01050668.1 2994 AEGNIVMTQSPKVMSTSVGDRITLSCKSSQSVGSNVNWYQQKPGQPPKLLIYYASNRYTGVPERFTGSGSGTDFTLSISSVQAEDLADYYCQQDYSYP
Psammomys obesus V968 igkv NESX01051263.1 10781 ACADIVMTQSPSFLAVSAGEKASISCRSSQSLYHSSSKKNLLAWYQQKPGQSPKLLIYWAFTRDTGVPDRFTGSGSGTDFTLSISSVQDEDLATYYCLQDIST
Psammomys obesus V969 igkv NESX01051264.1 22741 ACADIVMTQSPSSLAVSTGEKVTISCRSSKSLLYSKDQKNYLDWYQQKPGQSPKRLIYYASTRDTGVSDRFTGSGSGTEFTLSISSVQAEDLAVYYCLQGYIP
Psammomys obesus V970 igkv NESX01051266.1 4514 ACADIVMTQSPSSLAVSAGEKVSISCRSSQSLYYSSNQKNYLSWYQQKPGKSPKLLIYWASTRYTGVPDRFTGSGSGTDFTLTISSVQDEDLAVYYCMQYYSTP
Psammomys obesus V971 trav NESX01051312.1 12417 KDVLCVTLTQSSRDETLASGSKVTLPCTYDGNLQNPHLFWYRQRPDMSFQFILFRDNTRARDANYVQGRFSVRHSTVARTFHLVISPVSLEDSATYHCALLTYL
Psammomys obesus V973 igkv NESX01051963.1 5297 TSGDIVMTQSPSSLAVSVGEKVTISCRSSQSLLNTGNQKNYLSWYQQKPGQSPKMLIYYASTRHTGVPDRFTGSGSGTDFTLSISSVQAEDLAVYYCMQYYSYP
Psammomys obesus V990 igkv NESX01053911.1 17007 AEGDIVMTQSPEIMSTSVGARITLNCKSSQNVGSCVHWYQQKPGQPPKLLIHDASNRYTGVPDRFTGSGSGTEFTLTISSMQAEDLADYYCQQGNSYP
Psammomys obesus V991 igkv NESX01053913.1 7694 AEGDIVMIQSPEIMSTSVGDRITLNCKSSQNVGSNVHWYQQKPGQPPKLLISYASNQYTGVPDRFTGSGSGKDYTLSINSVQAEDLADYYCQQSNSYP
Psammomys obesus V992 igkv NESX01053914.1 20893 AEGDIVMTQSPETMSTYIGNRITLNCKSSQNVGTSVHWYQQKPGQSPKLLIYYASNRYTGVPDRFTGSGSRTDFTLTISSVQAEDLAVYYCQQSNSNP
Psammomys obesus V993 igkv NESX01053919.1 6325 AEGDIVMTQSPELMSTSVGDRITLSCKSSQIVNGYVDWYQQKPGQPPKLLIYSASSRYTGVPDRFTGSGSGTDFTLSISSVQAEDLAVYYCQQHSSYP
Psammomys obesus V994 igkv NESX01053920.1 10231 AEGNIVMTQSPEFMSTSVGERITLSCKSSQNVNKYVAWYQQKPGQPPKPLIYYASTRYTGVPDRFTGSGSGTDFTLTISSVQAEDLAVYYCMQYDSYP
Psammomys obesus V1005 igkv NESX01054908.1 56987 AEGNILMTQSPEFMSTSVGDRITLSCKSSQSVSGYVAWYQQKPGQPPKLLIYGASTRSSGVPERFTGSGYGTDFTLSISSVQAEDLAVYYCQQYNSYT
Psammomys obesus V1006 igkv NESX01054908.1 29950 AEGNIVMTQSPEFMSTSVGDRITLSCKSSQSVSDYVAWYQQKPGKPPKPLIYDASNRYTGVPDRFTGSGSGTDFTLSINSVQAEDLAVYYCQQGISAP
Psammomys obesus V1007 igkv NESX01054911.1 15594 AEGNIVMTQSPEFMSTSVGERITLSCKSSQSVGGYVAWYQQKPGQPLKLLIYDASNRYTGVPDRFTGSGSGTDFTLSISSVQAEDLAVYYCQQYSSSP
Psammomys obesus V1015 iglv NESX01055842.1 9721 SWGQFSLTQPNSVSGSLGSTVTISCKDSSGNIGSRYVHWYQQHEGRPPTLVIYDDTNRPSGIPDRFSGSIDSSSNSASLTISNMLAEDEAVYYCLSSDSGY
Psammomys obesus V1016 iglv NESX01055844.1 16009 SWGQFQLTQPHSVSGSPGSTVSLSCKRSSGNIGSNYVYWYQQHLGRSPTLVIYNDDKRPSGIPDRFSGSIDSSSNSASLRISSLQNEDEAVYFCQSGYSGN
Psammomys obesus V1017 iglv NESX01055844.1 7977 SWGQFQLTQPNSVSGSPGSTISLPCKRSSGNIGNSYVYWYQQHFGRSPTLVIYNDDKRPSGIPDRFSGSIDSSSNSASLTISNLQAEDEADYFCQSSGY
Psammomys obesus V1018 iglv NESX01055846.1 16660 SWGQFSLTQPNSVSGSLGSTVSLSCKRSSGNIGSYYVHWYQQHKGRSPTLVIYKDNNRPSGIPDRFSGSIDSSSNSASLTISNMLAEDEADYYCQSYDSNY
Psammomys obesus V1019 iglv NESX01055849.1 3589 SWGQFQLTQPHSVSGSPGSTVSLSCKRSSGNIGSNYVYWYQQRLGRSPTLVIYEDDKRPSGIPDRFSGSIDSSSNSASLRISSLQNEDEAVYFCQSGYSGN
Psammomys obesus V1021 ighv NESX01056018.1 2723 VHSQVHLQQSGAELRTPGSSVKLSCKDFDSESFPISYMSWVRQKPGHGLEWIGNILPSIGRTNCEQKFEDRATLGADTMTSTAYIELRSLTAEDSAVYYCARD
Psammomys obesus V1026 igkv NESX01056715.1 17992 ACADITMTQSPSFLAVSAGEKVTISCRSSQSLLSSKDQKNYLAWYQQKPGQSPKLLIYYASIRDTGVPDRFTGSGSGTDFTLSISSAQAEDLAVYYCQQHYSTP
Psammomys obesus V1027 igkv NESX01056715.1 2053 TCADIVMTQSPSSLAVSAGEKVTISCKSSQSLTSGSSNYLSWYQQKPGQSPKLLIYWASTRHTGVPDRFTGSGSGTDFTLSISSVQAEDLAVYYCMQ
Psammomys obesus V1028 igkv NESX01056719.1 56929 ACADIVMTQSPSFLAVSEGEKVSISCRSSQSLYYSGNQKNLLSWYQQKPGQSPKRLIYYASTRDTGVPDRFTGSGSGTDFTLTISSVQAEDLAVYYCMQSYSAP
Psammomys obesus V1029 igkv NESX01056719.1 20990 ACADIVMTQSPSSLAVSAGEKVTISCRSSQSLIYNKDQKNYLAWYQQKPGQSPKRLIYWASSRDTRVPDRFTGSGSGTDFTLTISSVQAEDLAVYYCQQGISAP
Psammomys obesus V1031 ighv NESX01057072.1 15090 VQCEVKLVESGGGVVQPVGSLKLSCVASGFTFTSYWMHWVRQAPGKGLEWVGAINPNDGTTHYAPSLKDRFAISRDNAKSTVYLQMSKVRAEDMGTYYCAR
Psammomys obesus V1032 ighv NESX01057073.1 91322 VLSQVTLKESGPGLLQPSETLSLTCTFSGFSLSTTNIGVGWIRQPPGKGLEWLADIWGNDNKYYNPSLKSRLTISKDSSNNQVFLKIASVNTADSATYYCARR
Psammomys obesus V1033 ighv NESX01057073.1 85151 VQAQVQLVQSGSELKKPGESVKISCKASGYTFPNYGMNWVKQAPGKGLEWMGWINTYTGNPTYAEDFKERFVFSLDTSVSTAYLQINSLKNEDTAMYYCA
Psammomys obesus V1034 ighv NESX01057073.1 65741 HLEGVWRGLLQPSETLSLTCACSGFSLSTYGVCVGWIRQPPGKGLEWLARIDWDDDKYYNPSLKSRLTISKDSSNNRVFLKLASVDTADSATYYCAQG
Psammomys obesus V1036 ighv NESX01057073.1 52879 VYSQVQLQQSGAELGRPGASVKLSCKASGYTFTGYYMNWMKQRPGQGLEWIGWIDPGSGSPSYVQKFQGKATLTVDTSSSTAYMELCSLTPEDSSVYYCVRD
Psammomys obesus V1037 ighv NESX01057073.1 32101 VHSQVQLQQSGAVVGSPGASVKLSCKASGYTFIDYYMHWVKQRPGQGLEWIGRIDPEDGSTKYTQKFQDKAKLTADTSSSTAYMELRSLTSEDSAVYYCA
Psammomys obesus V1038 ighv NESX01057073.1 23469 IPCERQLVESGGGLVKPGSSLRLSCAASGFSFDDACMHWVRQPPGKGLEWVATSRNQADSFTTEYSLFVEHRFTISRENSQNILYFQMNSLRVEDTATYYCRGE
Psammomys obesus V1039 ighv NESX01057074.1 10595 VLSQVTLKESGPGLLQPSETLSLTCACSGFSLSTSGVRVGWIRQPPGKGLEWLAQIDWDNDKYYNPSLKSRLTISKDSSNNRVFLKLASVDTADSATYYCARR
Psammomys obesus V1040 trav NESX01057090.1 7644 RTHGDSVTQTGGQVTISEGEFLRINCTYSATSIAFPALFWYVRYPGEGLHLLLKVITAGEKGSSRGFEATYDKGTTSFHLQKASVKESDSAVYYCAMS
Psammomys obesus V1041 trav NESX01057090.1 5323 VSSQQKVQQNPESLSVPEGAMASLNCTSSDSASYNFWWYRQHSGKGLELLMSIFFNGDKEEGRFTAHLNRSSLHVSLHIRDSQPSDSAVYLCAV
Psammomys obesus V1042 trav NESX01057092.1 6310 ENNGESVTQTEGQMTLSEGSSLSVNCSYETKQYPSLFWYVQYPREGPQLLFRVSKANDKGSSRGFEATYDKETKSFHLQKASVQESDSAVYYCALG
Psammomys obesus V1043 trdv NESX01057093.1 25883 CNVAQKVTQVQSTTSSHYGEEITLDCSYETSYYYHQLFWYKQLVTGEMIFLIRQISSSIQNERNGRYSVTLKKSAKSFSLVISASQLEDSGTYFCALWEV
Psammomys obesus V1044 trav NESX01057093.1 16515 ESRGEQVKQHPSSLSVKEGDSAVINCTYTDSASVYFSWYKQEPGKGPQFIIDIRSNMERKQNQRLSLLLDKKEKHLSLQVTATQPGDSAIYFCTAD
Psammomys obesus V1045 trav NESX01057093.1 9778 VSSQLKVEQIPEFLSVPEGAMASLNCTFSDRNSQYFWWYRQHSGKGLEALMFIVSNGDKEEGRFTAHLNRASLHVSLHIRDSKPSDSAVYLCAV
Psammomys obesus V1046 trav NESX01057099.1 4450 MSRGEQVEQQPSILRVQEGASAVINCTYTNSFSEYLPWYKQEPGKGLQFIMDIRSNEERKQNQRLTVLLDKKAKHFSLHITDTQPGDSGLYFCVAS
Psammomys obesus V1047 trav NESX01057099.1 946 RSNGDSVTQTEGLVTVTEGLPVMLNCTYQTTYSDPFLFWYVQYLNEAPQLLLRSSTENKRTEHQGFHATLQKSSSSFHLQTSSAQLSDSALYYCAL
Psammomys obesus V1050 igkv NESX01057201.1 12381 AEGNIVMTQSPEFMSTSIGDRIILSCKSSQSVNKYIAWYQQKSGQPPKPLIYYVSTWHTGVPDCFTGSGSGTDFTLSISSVQAEDLAVYYCQHYDNTP
Psammomys obesus V1051 igkv NESX01057202.1 25824 AEGDIVMTQSPETMSTSIGDRITLNCKSSQNVGSNVHWYQQKPGQPPKLLIYGASNRYTGVPDRFTGSGSGTDFTLSISSVQAEDLADYYCQQSNSNP
Psammomys obesus V1052 igkv NESX01057202.1 2053 AEGNIVMTQTPEFMSTSVGERITLSCKSSQSVSGWVAWYQQKPGQPPKLLIYGASNRYTGVPDCFTGSGSGTDYTLTISHVQAEDLADYYCQQYSSSP
Psammomys obesus V1058 igkv NESX01057897.1 30746 AEGNIVMTQSPEFMSTSVGDRITLSCKSSQNVYKYVAWYQQKPGQPPKPLIYYASNRPSGVPDRFTGSGSGTDYTLTISSVQAEDLAVYYCQQGSSSP
Psammomys obesus V1059 igkv NESX01057897.1 3721 TEGNIVMTQSPKVMSTSVSDRISLDCKSSQNVYNNVAWYQQKSGQPPKLLIYGASNNPSGVPDRFTGSGSGTDFTLSISSVQAEALAVYYCQKHYDYP
Psammomys obesus V1060 igkv NESX01057900.1 97679 AQGNIVMTQSPKVMSTSVGDRITLICKSSQNVDNYVAWYQQKSVQPPKLLISYASNQHTGVPDCFTGSGSGTDFTLSISSVQAEDLAVYYCQQHYDYP
Psammomys obesus V1061 igkv NESX01057900.1 59745 AEGDIVMTQSPEIMSTSVGDRITLSCKSSQSVGSYVHWYQQTPGQPPKLLMYRASNRPSGVPDRFTGSGSGTDFTLSISSVQAEDLAVYYCQNGYSTP
Psammomys obesus V1062 igkv NESX01057901.1 16308 AEGNIVMTQSPKIMSTSVGDRITLGCKASQSVSNNVHWYLQKSGQPPKLLISYASNRPSGVPDRFTGSRSGTDFTLSISSVQAEDLAVYYCQQGYSYP
Psammomys obesus V1063 igkv NESX01057901.1 9175 AEGDIVMTQSPEIMSTSVGARITLNCKSSQNVGSSVYWYQQKPGQPPKLLIYYASNRYTGVPDRFTGSGSGTDFTLSISGVQAEDLAVYYCQQDNSYP
Psammomys obesus V1064 igkv NESX01057905.1 916 AEGNIVMTQSPEYMSTSVGDRITLSCKSSQSVSGYVAWYQQKPGQPPKPLIYSASSRYTGVPDRFTGSGSGTEYTLTISSVQAEDLAVYYCQKHNSSP
Psammomys obesus V1069 ighv NESX01058510.1 3879 VQCEVQLVESGGGLVQPGSSLKLSCAASGFKFSDYWMHWFRQAPGKGLEWVALIKHKPDNYKTFYAESVKGRFIISRDDSTSSLYLQMNSLRAEDTAIYYCVR
Psammomys obesus V1070 igkv NESX01058565.1 9442 AEGNIVMTQSPEFMSTSVGERISLSCKSSQNVGTAIAWYQQKSGQPPKLLIYSASSRYTGVPDRFTGSGSGTDFTLSISSVQAEDLAVYYCQQGYSYP
Psammomys obesus V1073 igkv NESX01058957.1 33167 ACADIVMTQSPSSLAVSAGEKITIRCRSSQSLLHSVLRENLLSWYQQKPGQSPKLLIYWASNRYTGVPDRFTGSGSETDFTLSIGSVQAEDLAVYYCLQGKSTP
Psammomys obesus V1074 igkv NESX01058960.1 7242 TCADIVMTQSPSSLAVSAGEKVTISCKSSQSLTSGSSNYLSWYQQKPGQPPKLLIYDASTRYTGVPDRFTGSGSGTDFTLSISSVQAEDLAVYYCQQGISAP
Psammomys obesus V1075 igkv NESX01059107.1 3251 AEGSIVMTQSPEFMSTSVGERITLSCKSSQNVNKYVAWYQQKPGQSPKPLIYYASNRYTGVPDRFTGSGSGTDYTLSISSVQAEDLAVYYCQQYDNIP
Psammomys obesus V1077 ighv NESX01059309.1 5241 VHSQVQLQQSGAEVGRPGSSVKLSCKASGYNFISYAMHWVKQRPGQGLEWIGFILPANGGTVYNQKFQGKATLTADKSSSTAYMELHSLTPEDSAVYYCARD
Psammomys obesus V1082 ighv NESX01059904.1 22581 VLSQVQLQESGSALLKPSQTLSLTCAVTGYSISSGYWWSWIRQRPGKGLEWMGEIYSDGDTDYNPAFKSRITITVDTAKNQFSLRLSSVTTEDTAVYYCAR
Psammomys obesus V1083 igkv NESX01060082.1 496 ACADIVMTQSPSSLAVSAGEKVSISCRSSQSLYYSSNQKNYLSWYQQKPGKSPKLLIYWASTRYTGVPDRFTGSGSGTDFTLTISSVQDEDLAVYFCMQSVSTP
Psammomys obesus V1086 trav NESX01060403.1 2607 RIHGDSVTQKQDQVTLSEDSVLFINCTYSSTGYPTLFWYVQYSGESPQLLLKVTTAGEKRSSRGFEATYDKGTTSFHLQKSSVQVSDSAVYYCALG
Psammomys obesus V1087 ighv NESX01060416.1 1977 VHSQVQLQQSGAEVERPGSSVKLSCKASGYSFTSYYMSWVKQRPGQGLEWIGWIDPGDGDTDYAQKFQNKAKLTADTSSSTAYMELSRLTAEDSAVYYCA
Psammomys obesus V1088 iglv NESX01060690.1 1351 SWGQFSLTQPNSVSGSLGSTVSLSCKRSSGNIGDSYVSWYQQQEGRSPTTVIYGDDQRPSGIPDRFSGSIDRSSNSASLTIRNLQAEDEAIYFCQSYDSSY
Psammomys obesus V1089 iglv NESX01060692.1 5485 SWSQYELTQSNSVSGSLGSTVSLSCKRSSGNIGSSYVSWYQQHEGRSPTTVIYGDDQRPSGIPDRFSGSIDRSSNSATLTIRNLQTEDEAHYFCQSGGSN
Psammomys obesus V1090 trdv NESX01060934.1 10290 FNVAQKVTQVQTTTSSHYGEEVTLDCLYETSYYYYSLFWYKQLVTGEMIFLIRQLSSSSIQNERNGRYSVTLKKSAKSISLVISASQLEDSGMYFCALQEV
Psammomys obesus V1091 trav NESX01060940.1 4697 RTHGDSVTQTGGQVTISEGEFLTINCTYSATSIAFPSLFWYVRYPGEGLHLLLKVITAGEKGSSRGFEATYDKGTTSFHLQKASVQESDSAVYYCAMS
Psammomys obesus V1092 igkv NESX01061092.1 13926 ACADIVMTQSPSSMAVSAGEKVSISCRSSQSLYHSSSKKNLLSWYQQKPGQSPKLLIYYASTRYTGVPDPFTGSGSGTDFTLSISSVQDEDLATYYCLQGISTP
Psammomys obesus V1093 igkv NESX01061197.1 6366 ACADIVMTQSPSSLAVSAGEKVTISCRSSQSLLHTVLRKNLLSWYPQKPGQSPKLLIYWASNRPSGVPDRFTDSGSGTDFTLSTISVQAEELAVYYCLQGISTP
Psammomys obesus V1094 igkv NESX01061198.1 5162 TCADIVMTQSPSSLAVSAGEKVTISCKSSQSLTSGSSNYLSWYQQKPGQSPKLLIYWASTRHTGVPDRFTGSGSGTDFALSFCSVQAEDLAVYYCQQYRSYP
Psammomys obesus V1095 ighv NESX01061432.1 2199 VLTQVTLKESGPGLLQPSETLSLTCTFSGFSLSTSGVCVGWIRQPPGKGLEWLANIYWDDDKYYNPSLKSRLTISKDSSNNRVFLKLASVDTADSATYYCARR
Psammomys obesus V1096 igkv NESX01061884.1 883 AEGYIVMTQTPEFMSTSVGERITLSCKSSQSVSGWVAWYQQKPGQPPKLLIYGASNRYTGMPDRFTGSGSGTDYILSISSVQAEDLAVYYCQQYSSSL
Psammomys obesus V1097 igkv NESX01062117.1 362 VCADIVMTQSPSTLAMSAGKKVSISCRSSQSLLYSKDQKNYLSWYQQKPGQSPKRLIYYASNEVTGDPDHFTGSGSGTDFTLSISSVQAEDLAVYYCMQHYEHP
Psammomys obesus V1098 ighv NESX01062615.1 13215 VQSDVQLVESGGGLVQPGKSLKLSCVASGITLSNNYMSWVRQAPGKGLEWVAYINTGGGTYYADAVKGRFTISRDNAKNTLYLQMNSLRSEDTATYYCAR
Psammomys obesus V1099 ighv NESX01062884.1 1585 VLSQVQLQESGPALLKPSQTLSLTCAVTGYSISSGYWWSWIRQRPGKGLEWMGQIYSDGDTNYNPAFKSRITITVDTAKNQFSLRLSSVTTEDTAVYYCAR
Psammomys obesus V1100 ighv NESX01063231.1 5437 VLSQVTLKESGPGLLQPSETLSLTCACSGFSLSTSGVGVGWIRQPPGKGLEWLALIYWDDDTRYNPSLKSRLTISKDSSNNQVFLKLASVDTADSATYYCARR
Psammomys obesus V1101 ighv NESX01064644.1 320 VLSQVTLKESGPGLLQPSDTLSLTCTFSGFSLSTSGVCVGWIRQLPGKGLEWLANIWWHDNKYYNPSLKSRLTISKDSSNNRVFLKLASVDTADSATYYCARV
Psammomys obesus V1102 trav NESX01065275.1 4524 MSQGEQVEQHPSILRVQEGASAVINCTYTDSASDYFPWYKQEPGKGLQFIMDIRSNEERKQNQRLTVLLDKKEKHFSLHITDTQPGDSALYFCTA
Psammomys obesus V1103 trav NESX01065275.1 1021 RSNGDSVTQTEGLVTVTEGLPVMLNCTYQTIYSDPFLFWYVQYLNKAPQLLLRSSTDNKRTEYRGFHATLHKSSSSFHLQTSSAQLSDSALYYCALG
Psammomys obesus V1104 ighv NESX01065526.1 1342 VHSQVQLQQSGAEVGRPGSSVKLSCKASGYTFTDYYMSWVKQRSGQGLEWIGRIDPRDSETRYSQKFQGKATLTVDTSSSTAYMELRSLTAEDSAVYYCARE
Psammomys obesus V1105 trav NESX01066802.1 290 GVRGAEVEQSPSVLSLQEGTSSALRCNFSTTMKSVQWFRQNPRGSLISLFYLAAGTKENGRLKSTFDPKEPYSTLHIRDTQMEDSGTYLCAAE
Psammomys obesus V1106 igkv NESX01096416.1 630 AEGNIVMTQSPKVMSTSVGDRITLSCKSSQSVGSNVNWYQQKPGQPPKLLIYYASNRPSGVPDRFTGSGSGTDFTLSISSVQAEDLADYYCQQSGSYP