WGS Statistics
Organism WGS Record. Vs Total IGHV IGLV IGKV TRAV TRBV TRGV TRDV
Spermophilus dauricus AXRT00000000.1 (AXRT01) 406 35 49 139 107 54 6 16
Vgene Table
Organism Vgene Locus contig Contig Pos. AA sequence
Spermophilus dauricus V16 iglv AXRT01004834.1 12677 SLAEVVFTQPQHVSGSLGQKVTISCTRSSGDIGNNYVHWYQQHLGSPPSLLIYKYNQRPSGIPDRFSGSKDSSSNSASLTITGLQPEDEADYYCLSSYDNYY
Spermophilus dauricus V17 iglv AXRT01004835.1 50733 SWAQFELTQPHSVSASPGKTVTISCTRSSGNIGSNYVYWYQQRQGSAPSTVIYKDDKRPSGVPDRFSGSIDSSSNTASLSISGLQIEDEADYYCQSYDGNY
Spermophilus dauricus V18 iglv AXRT01004840.1 11189 VDSQTTVIQESSLSVSPGGTVTLTCGLSSGSVSTGHYPGWYQQNPGLAPRLLIYQTNNRPSGVPDRFSGSILGNKAALTITGALTDDEADYYCLLYMGSG
Spermophilus dauricus V28 iglv AXRT01012952.1 2910 SLSQPVLTQQPSLCIPGASARLTCSLSSGFRVDNSLISWYQQKPENPPHYLLSYYSDSVKDKGSEVPNRFSGSKDASANAGILLISDLQPEDEAGYYCA
Spermophilus dauricus V30 igkv AXRT01015220.1 401 VRCDIMMTQSPSSLSASQGERVTINCRASQGISNSLHWHPQKPGQALKLLITYASTLQSGVPLRFSGSGSGTDFTLTISSLEPEDVASYYCQQYNSYP
Spermophilus dauricus V36 trdv AXRT01016660.1 2369 SSFAQKVTQAQPAIWVHDMEAVSLLCSYDTSAGNYDLLWYKQPSSGEMVFLILQNSYSQQNATEGRYSLNLQKVSKSIQLVISASQQGDSVVYFCALRE
Spermophilus dauricus V44 igkv AXRT01019363.1 15602 TSGDIVMTQTPLSQPITPGQSVSFSCRSSQSLLYSNGNTYLYWVVHKPGQAPQSLIYWVSNRYTGVPDRFSGSGSGTDFTLKISRVEPDDAGIYYCYQAKEYP
Spermophilus dauricus V45 igkv AXRT01019364.1 1054 TSGDIVMTQTPLSQPITPGQSVSFSCRSSQSLLYSNGNTYLYWVVHKPGQAPQGLIYWVSNRYTGVPDRFSGSGSGTDFTLKISRVEPDDAGIYYCYQAKEYP
Spermophilus dauricus V46 igkv AXRT01019364.1 7088 SSGDIVVTQSPLSEPVTSGQPLSISCRSSQSLLHSNGITYLNWVVQKPGQSPQGLIYQVSNRYTGVSDRFSGSGSGTDFTLKISRVEPEDAGVYYCVQSLHVP
Spermophilus dauricus V59 iglv AXRT01027764.1 8330 SWAQSVLSQHPSMSGTPGETVTISCTGSSNNIGIFGVSWYQQLPETAPKLLIYSNSNRPSGVPDRFSGSRSGNSGSLTITRLQPEDEADYYCQSYDSSLSS
Spermophilus dauricus V63 igkv AXRT01029419.1 8623 VRCDITMTQSPSFLPVSRGDRVTLTCRASQGISNYLHWYQQKQGQAPKLLIRYANTLESGVPSRFSGSGSGTDFTLTINSLEPEDVATYYCQQGNSYP
Spermophilus dauricus V68 igkv AXRT01030458.1 23978 ARCDTTMTQSPSSLSKSQGDRVEISCKASQSIGTAVAWYQQKAGQIPKLLIYRATSLQPGVPSRFSGSGSGTDFTFTISSLEPEDAATYYCQLDYN
Spermophilus dauricus V69 igkv AXRT01030716.1 8225 SRCDIQMTQSPSSLSASQGDRVTLICRASQGISNNLHWYQQKPGQAPKLLITYANILQSGVPSRFSGNGSVADFTLNISNLEPEDVAIYFCQQDYSAP
Spermophilus dauricus V94 trgv AXRT01038571.1 1359 SQTSSSLERRMMSVTSSPGSNVVITCDLSSAYIHWYQFKEGQVPRRLLSYNNYNYKVVVDSGISSMKYDAQITDGSHQLIIQNLGDSDSAVYYCAYWT
Spermophilus dauricus V95 trgv AXRT01038575.1 13696 SDTSSSLERGMMSVISQPGSYVPITCDFNKASNYIHWYQFKEGQAPRHILYYNFLQSKVVVSSGIISGKYNAIKGPDGRCIFVVQNVEESDSAVYYCAYWT
Spermophilus dauricus V96 trgv AXRT01038580.1 35108 VLGELEQPDISISREKDKSVQMSCKAILQSFKSIDIHWYREKPNQGLEHLIYVRTKYNQRTLGGKNKKFEASKYAPTSTSVLTVNFLGKEDEATYYCACWT
Spermophilus dauricus V112 trav AXRT01044042.1 3832 KSHGDSVTQTAGLVTLVEGAPMILNCTYQTIYSVFTLWYVQYLDKAPQLLLKSATENQKTESRGFHATLVKKENSFHLQKPAVQPSDSAVYYCALR
Spermophilus dauricus V113 trav AXRT01044042.1 13734 SSMSQKVTQDQAAISMLEKETVTLNCAYNATSFSYYLLWYKQPPSGEVILLMDQESYREENVTEGQFSLNLQKPVSSISLTISALELQDSAVYFCALRE
Spermophilus dauricus V115 trav AXRT01044044.1 20016 VSRGEKVEQHPSFLSVQEGDSAVTHCTYTDSASTYFFWYKHEPGAGLQLLMQILSSMERKQDQRLTVLLSKKDKHLSLNITAAHPRDSATYFCAAR
Spermophilus dauricus V116 trav AXRT01044044.1 26105 ADGQKVEQHPQVCSIQEGENASLTCHYTNYSPESFQWYRQDPGEGLFFLILVRENEGEKQNGSLRVTFDTTTKQSALHISASQPADSATYLCAL
Spermophilus dauricus V117 trav AXRT01044045.1 4160 VKGGNQVEQSPPSLRPWEGDSTSMSCTYSVSVFNGLQWYRQDSGTGLRHLFSMYSAGDVQQKGRLRATLLKGGSSLNITAVQHGDSAAYLCAV
Spermophilus dauricus V118 trav AXRT01044046.1 1314 GVRGQQVEQSPSALRLQEGTSPTLRCNFSTTMNSVQWFRQNPKGGLISLFFLASGAKQEGRLKATANPKERYSTLNISTSQLEDSGTYLCAG
Spermophilus dauricus V119 trav AXRT01044048.1 3980 VSQEEKVEQHPSTLSVQEGDSAVINCTYSESGSSYFPWYKQEDGKGPQMIIDIRSNKEINQIQRYIVVLDKKAKHFSLNITATQPGDSAVYFCAAD
Spermophilus dauricus V120 trav AXRT01044048.1 6702 VSQGEKVEQHPSTLNIQEGDSAVINCTNSDSASSYFPWYKYKQEVGKGPQHIIDIISNKEINQIQRLIVVLDKRAKHFSLNITAAQPGDSAVYFCAAR
Spermophilus dauricus V121 trav AXRT01044048.1 13704 SSFAQKVTQAQPAMWVQEKEAVSLLCSYDTSAGSYDLLWYKQPSRGEMVFLILQNSYSQQNATEGHYSVNLQKASKSIQLVISASQLGDSAMYFCALRDR
Spermophilus dauricus V122 trav AXRT01044048.1 33347 GVRGQQVEQSPSALRLQEGTSPTLRCNFSSNMQSVQWFRQNPGGSLISLFLLTPGTKQEGRLKATMNFQERYSTLHILTSQLDDSGTYLCAV
Spermophilus dauricus V123 trav AXRT01044051.1 4283 VSRGEKVEQHPSILSVQEGDSAVINCTYSDSTSVYFPWYKQETGKGLQMIIDIRSNKEISQIQRFIVVLDKKAKHFSLNITATQPGDSAVYFCAAD
Spermophilus dauricus V124 trav AXRT01044052.1 3354 VSRGEKVEQHPSTLSVQEGDSAIINCTYSDSTSVYFPWYKQETGKGLQMIIDIRSNKEISQIQRFIVVLDKKAKHFSLNVTATQPGDSAVYFCAAD
Spermophilus dauricus V125 trav AXRT01044052.1 6245 SSFAQKVTQAQPAMWVQEKEAVSLLCSYDTSETNYGLLWYKQPSSGEMVFLILQNSYSQQNATEGRYSVNLQKASKSIQLVISASQLGDSAVYFCALRE
Spermophilus dauricus V126 trav AXRT01044052.1 15683 RTHGDSVTQTAGHVTMSEGALLIINCTYSTTTIAYPVLFWYVQYPGEGLQLFLKAVKANDKVSNEGFEATYKKHTSSFNLEKASVQESDSAVYYCALG
Spermophilus dauricus V127 trav AXRT01044052.1 26036 GVRGQQVEQSPSALRLQEGTSSTVRCNFSTTMNRVQWFRQNPGGGLISLFYLTSGTKQEGRLKATADAKERYSTLHISTSQLEDSGTYLCAAE
Spermophilus dauricus V128 trav AXRT01044054.1 4072 VSQGEKVEQYPSTLSVQEGDSIVINCTYSDSASKYFPWYKQEAGKGPQHIIDIISNKEINQVQRFTVVLDKKAKHFSLNITATQPGDSAIYFCAAS
Spermophilus dauricus V129 trav AXRT01044055.1 1352 SSFAQKVTQAQPAMWVQEKEAVSLHCSYDTSETSYGLLWYKQPSSGEMVFLILQNSYSQQNATEGRYSVNLQKASKSIQLVISASQLGDSAVYFCALRE
Spermophilus dauricus V130 trav AXRT01044055.1 3892 SSFAQKVTQAQPAMWVQEKEAVSLLCSYDTSETSYGLLWYKQPSSGEMVFLILQNSYSQQNATEGRYSVNLQKASKSIQLVISASQLGDSAVYFCALRE
Spermophilus dauricus V131 trav AXRT01044055.1 9695 WTRGESVTQTESQVTISEGSFLTINCNYSSSGYPNLFWYVQYPGEGPQLLLKAMKANDMGSEKGFEATYKKETTSFHLKKTTVQESDSAVYYCALS
Spermophilus dauricus V132 trav AXRT01044055.1 26947 VHSQQKAVEQSPTALSVPEGSVASLNCTYSNSLSQYLFWYRQYPGKGPKLLISIFSNGKKGEGRFTAQLDTAKRHLFLHIRGSQLSDSATYLCAV
Spermophilus dauricus V133 trav AXRT01044057.1 818 GSGAQSVTQPDHHVLVSEGAPLQLRCSYSSSVSPSLFWYQQRPSQGPQLLLKYVSGATLVTGISGFQAELRKNETSFHLRKPSAHWSDSAEYFCALG
Spermophilus dauricus V134 trav AXRT01044057.1 8794 VNSQQGEASPQVLSIQEGENATLNCSYKTDITNLQWYRQDSGKGPALVILICSNEREKHSGRLTATLDTSTQRSILSITAPQAADAATYFCATD
Spermophilus dauricus V135 trav AXRT01044059.1 2774 RSNGDSVTQTAGLVTRVEGAPVILNCTYQTTYSGSFLFWYVQYPDKAPQLLLKSATESQRTESRGFHATLVKKENSFHLQKPAVQPSDSAVYYCALR
Spermophilus dauricus V136 trav AXRT01044059.1 12663 RSNGDSVTQTAGLVTLVEGAPVILNCTYQTTYSGSFLFWYVQYPDKAPQLLLKSATESQRTESRGFHATLVKKENSFHLQKPAVQPSDSAVYYCA
Spermophilus dauricus V137 trav AXRT01044059.1 16292 RSNGDSVTQTAGLVTRVEGAPVILNCTYQTTYSGSFLFWYVQYPDKAPQLLLKSATESQRTESRGFHATLVKKENSFHLQKPAVQPSDSAVYYCAVK
Spermophilus dauricus V138 trav AXRT01044059.1 23076 SSMSQKVTQDQAAISMLEKEAVTLNCAYNATSFSYYLFWYKQPPSGEVILLMDQESYREEKVTKGRFSLNLQKPVSSISLTISALELQDSAVYFCALRE
Spermophilus dauricus V139 trav AXRT01044062.1 407 VKGGNQVEQSPPSLRPWEGDSTSMSCTHSVSDFNGLHWYRQDSGTGLRHLFSMYSAGDVQQKGRLRATLLKGGSSLNITAVQHGDSATYLCAV
Spermophilus dauricus V140 trav AXRT01044064.1 15575 DSRAQSVTQPDRQVTISEGNSLELACNYSYGGSFSLFWYVQYPNQGLQSLLKFISGNTLVQGIKGFEAEAKKSESSFNLRKPSVHWSDSAEYFCVLV
Spermophilus dauricus V141 trav AXRT01044064.1 30614 RSNGDSVTQTEGQVIISEGTSLTVNCSYETSQYPALFWYVQYTGEGPQLLFRVSKANEKGSNKGFEATYNKETSSFHLKKASIQESDSAVYYCALG
Spermophilus dauricus V142 trav AXRT01044065.1 2499 GVRGQQVEQSPSALRLQEGTSPTLRCNFSTTMNKMQWFRQKPDGGLISLFFLTQGTKQEGRLKATMNFQERYSTLHISTSQQEDSGTYLCAAE
Spermophilus dauricus V143 trav AXRT01044066.1 5128 GVRGQQVEQSPSALRLQEGTSPTLRCNFSTTMNKMQWFRQKPDGGLISLFFLTQGTKQEGRLKATMNFQERYSTLHISTSQQEDSGTYLCAAE
Spermophilus dauricus V144 trdv AXRT01044066.1 13874 SSFAQKVTQAQPAMWVQEKEDVSLLCSYDTSFANYDLLWYKQPSSGEMVFLILQNSYSQKNAAKGRYSVNFQKASKYIQLVISASQLGDSAVYFCALR
Spermophilus dauricus V145 trav AXRT01044066.1 19704 SSFAQKVPQAQPAMWVQEKEDVSLLCSYDTSFANYDLLWYKQPSSGEMVFLILQNSYSQKNAAKGRYSVNFQKASKYIQLVISASQLGDSAVYFCALR
Spermophilus dauricus V146 trav AXRT01044066.1 26924 GTHGDSVTQIEDKMTVSEGSFRTINCTYTATGYPSLFWYFQYPGEGLQLLFRVSKANEKGSNRGFQATYNKEATSFHLEKDCVQESDSAVYYCALG
Spermophilus dauricus V161 trav AXRT01047578.1 7142 GVRGQQVEQSPSALRIQEGTSPTLRCNFSTSMDRVQWFQQKPGGGFISLFFLASGTKQEGRLKATMNFQERYSTLHISTSQLEDSGTYLCAG
Spermophilus dauricus V162 trav AXRT01047578.1 13815 GVRGQQVEQSPSALRIQEGTSPTLRCNFSTSMDSVQWFQQKPGGGFISLFSLASGTKQEGRLKATMNFQERYSTLHISTSQLEDSGTYLCAG
Spermophilus dauricus V163 trav AXRT01047579.1 6980 GVRGQQVEQSPSALRLQEGTSPTLRCNFSITMTSVQWFRQNPRGSLISLFYLASGTKQEGRLKATAHAKERYSTLHLSTSQLADSGTYLCAVE
Spermophilus dauricus V173 igkv AXRT01051610.1 2109 ARCDITMTQSPSSLPVSHGDRVTITCRASQNINNWLAWYQQKPGQAPKLLIYRASSLQSGIPSRFSGSGFGTDFTLTISSLEPEDFATYYCQQDSSYP
Spermophilus dauricus V174 igkv AXRT01051612.1 37236 VRCDIMMTQSPSSLPVSHGDRVTITCRASQGISNNLNWHQQKPGQAPKLLIKYANTLESGVPSRFSGSGSGTDFTLTISSLEPEDVADYYCQQSKSSP
Spermophilus dauricus V193 trgv AXRT01055505.1 1397 GLGLSKVEQSEISISKEIKKSVSINCKISSTSFDTEVIHWYWKKPNKTVEHLIQVTSIKSPARGSLNGKGNKIEAKKYSQTSSSVLTIFSIEKEDAAMYYCAGW
Spermophilus dauricus V195 igkv AXRT01056754.1 1459 AKCDITMTQSPSSLSKSQGETVTIRCQASQSIGNELSWYQQKPGQAPKLLVYGANRLHSGVPSRFSGSGSGTDYSLTISSLEPEDFATYYCQQYRSYS
Spermophilus dauricus V196 igkv AXRT01056766.1 15663 AKCDITMTQSPSSLSKSQGETVTIRCQASQGIGNELSWYQQKPGQAPKLLIYYTNRLQSGVPSRFSGSRSGTDYSLTISSLEPEDVATYFCLQDYSFP
Spermophilus dauricus V201 igkv AXRT01057601.1 3968 VRCDITMTQSPSSLPVSRGDRVTLTCRASQGIGSNLNWYQQKPGQAPKLLIYLSTSLQPGIPSRFSGSGSGTDFTLTISSLEPEDFATYYCQQDSSYP
Spermophilus dauricus V212 igkv AXRT01062360.1 2048 SSGDTVMTQTPLSLSVIPGEPASVSCRSSQSLLHNDGNTYLSWYQQKPGQAPKLLIYKVSNRFTGVPDRFSGSGSGTEFTLRISRVESEDAGVYYCLQGTWTP
Spermophilus dauricus V216 trav AXRT01063343.1 727 SSFAQKVTQAQPAMWVQEKEAVSLLCSYDTSDTNYGLLWYKQPSSGEMVFLILQNSYSQQNATEGRYSVNLQKASKSIQLVISASQLGDSAVYFCALRE
Spermophilus dauricus V226 igkv AXRT01065298.1 1446 VRCDITMTQSPSSLPVSRGDRVTLTCRDSQGICSNLNWYQQKPGQAPKLLIYLSTSLQPGIPSRFSGSGSGTDFTLTISSLEPEDFAIYYCQQDSSYP
Spermophilus dauricus V229 igkv AXRT01065306.1 17020 SRCDITMTQSSSFMSKSQGESVTITCQASESIGTSLHWYQQKPGQAPRLMINYATSLESGVPSRFSGSGSSTDFTLTISSLEPEDAATYYCQQSWDSP
Spermophilus dauricus V252 trav AXRT01073606.1 25922 AHTQVVQVNDSMYGFIGTDIVLHCSFANPLPNVKITQVTWQKATNGSKQNVAIFNPAMGVSVLSPYRERVEFLRPSYIDGTIRLSRLELEDEGVYICEF
Spermophilus dauricus V269 igkv AXRT01081110.1 593 VRCDITMTQSPSSLPVSLGDRVTLTCRASQGISNYLHWYQQKPGQAPKLLIYGANNLQPGVPSRFSGSGSGTDFTLTISSLEPEDVATYYCQQGYSSP
Spermophilus dauricus V285 igkv AXRT01089491.1 9889 NSGDIVMTQSSLSKPATPGQAVSLSCKSIQSLLHSNGNTYLHWVVQKPAQAPQGLIYWVSNRYTEVPDRLSSSGSGTEFKLRISRVELDDAGIYYCVQYLQT
Spermophilus dauricus V286 igkv AXRT01089492.1 11657 TSGDIVLTQTPLSEPVTPGQSASISCRSSQSLLQSNGNTYLHWVVHKPGQAPWGLIYRVSNQNTGVPDRFSRTGAGSDFTLKIIKVEPDNAGIYYCHQDKEYP
Spermophilus dauricus V287 igkv AXRT01089493.1 5062 NSGDIVMTQSSLSKPATPGQAVSVSCRSIQSLLHSNGNTYLHWVVQKPAQAPQGLIYWVSNRYTEVPDRLSSSGSGTEFKLRISRVELDDAGIYYCVQYLQT
Spermophilus dauricus V288 igkv AXRT01089495.1 45609 STGDIVLTQTPLSESITPGQSASISCRASQSLLHSDGKTYFYWFVHKPGQAPKRLIYWVSNRDTGVPDRFSGSGSGTEFTLRISRVEAEDAGVYYCSQG
Spermophilus dauricus V289 igkv AXRT01089496.1 3303 STGDIVLTQTPLSESITPGQSASISCRASQSLLHSDGKTYFYWFVHKPGQAPKRLIYWVSNRDTGVPDRFSGSGSGTEFTLRISRVEAEDAGVYYCSQG
Spermophilus dauricus V315 iglv AXRT01096381.1 6268 SWAQFELTQPHSVSASPGKTVTISCTRSSGNIGGYYVHWYQQRLGSAPSTVIYADDQRPSGVPDRFSGSIDSSSNTASLSISGLQIEDEADYYCQSYDGNY
Spermophilus dauricus V316 iglv AXRT01096381.1 39408 SLAQSVVTQQPSLSGTPGQRITISCTGSSNNIGDNYVSWYQQLPEMAPKLLIYYNSNRHSGVPDSFSGSKSGNSASLTITGLQPEDEAVYYCHSYDSSIS
Spermophilus dauricus V317 iglv AXRT01096381.1 54790 NCDPGALTLCVSSGTVTLTCGLSSGSVSTGSVPGWYQQNPGLAPRLLIYSTNNRPSGVPDRFSGSILGNKAALTITGALTDDEADYYCSLYMGSD
Spermophilus dauricus V318 iglv AXRT01096381.1 85708 SWAQFELTQPHSVSASPGKTVTISCTRSSGNIGSNYVYWYQQRQGSAPSTVIYKDDKRPSGVPDRFSGSIDSSSNTASLSISGLQIEDEADYYCQSYDGNY
Spermophilus dauricus V319 iglv AXRT01096383.1 5764 HCDPGALTLCVSSGTVTLTCGLSSGSVSTGSVPGWYQQNPGLAPRPLIYSTNNRPSGVPDRFSGSILGNKAALTITGALTDDEADYYCSLYMGSD
Spermophilus dauricus V320 iglv AXRT01096384.1 8317 SWAQSVLTQQPSLSGTPGQTITISCTGSSNNIGGYYVQWYQQIPETAPKLIIYDYSKRNSGVSDRFSGSKSGNSASLTITGLQPEDEADYYCQSYDSSLA
Spermophilus dauricus V321 iglv AXRT01096384.1 20010 SWAQSVLSQQPSLSGTPGQRVTISCTGNSNNIGGGNYVHWYQQLPETAPKLLIYGNSNRPSGVPDRFSGSKSDNSASLTITGLQPEDEAVYHCQSYDDSLNT
Spermophilus dauricus V322 iglv AXRT01096388.1 24172 TWAQSVLTQQPSLSGTPGQTVTISCTGSNNNIGYSFVNWYQQFPATAPKLLIYGNSNRPSGIPDRFSGSKSGNSGSLTITGLQPDDEADYFCQSYDSSLNA
Spermophilus dauricus V323 ighv AXRT01096719.1 12287 VQCEVQLVESGGGLVQPGGSLRLSCAASGFTFSDYDMDWVRQAPGKGLEWVSGIGTGGSTYYADSVKGRFTISRDNSKNILYLQMSSVRVEDTATYYCAR
Spermophilus dauricus V324 ighv AXRT01096719.1 20222 VLCQVQLQESGPGLVKPSQTLSLTCAVSGFSITTGSYGWSWIRQPPGKGLEYIGLIWYDGDTYYSPSLKSRVSISRDTSKNQFSLQLSSLTTEDTATYYCAR
Spermophilus dauricus V325 ighv AXRT01096719.1 33153 VQCEVQLVESGGGLVQPGGSLRLSCAASGFTFSSYGMSWVRQAPGKGLEWISGISDGGSTYYADSVKGRFTISRDNSKNTLYLQMSSVRAEDTATYYCAR
Spermophilus dauricus V326 ighv AXRT01096719.1 45637 VQCEVQLVESGGGLVQPGGSLRLSCAASGFTFSDYWMYWVRQAPGKGLEWVARIKNKANSYSTAYAASVKDRFTISREDSKNTLYLQMSSLRTEDTATYYCA
Spermophilus dauricus V333 iglv AXRT01100337.1 44599 SWAQSVLTQQPSLSGTPGQKVTISCTGSSNNIGSYDVQWYQQIPEMAPKLLIYYNSNRYSGVPDRFSGSKSGKSASLTITGLQPEDEADYYCESYESSLS
Spermophilus dauricus V334 iglv AXRT01100337.1 45775 SWAQSVLTQQPSLSGTPGQKVTISCTGSSNNIGSYDVQWYQQIPEMAPKLLIYYNSNRYSGVPDRFSGSKSGKSASLTISGLQPEDEADYYCESYESSLS
Spermophilus dauricus V335 iglv AXRT01100338.1 52582 SRAQSVLTQQPSLSGTPGQKVTISCTGSSSNIGSYDVQWYQQLPATAPKLLIYADSNRHSGVPDRFSGSKSGNSASLTITGLQPDDEADYYCQSYDNNLGA
Spermophilus dauricus V336 iglv AXRT01100338.1 56885 SRAQSVLTQQPSLSGTPGQKVTISCTGSSSNIGSYDVQWYQQLPATAPKLLIYADSNRHSGVPDRFSGSKSGNSASLTITGLQPDDEADYYCQSYDNNLGA
Spermophilus dauricus V337 iglv AXRT01100341.1 9671 SWAQSVLTQQPSLSGTPGQKVTISCIGSSTNIGDGYSVQWYQQLPETAPKLLIYGNSNRPSGVPDRFSGSRSGNSGSLTITGLQPEDEAVYYCQSYDKSLK
Spermophilus dauricus V338 iglv AXRT01100345.1 12358 SLSQPVLTQPPSLSASPGASSKLTCTLSSGFSVGSYSIYWYQQKPGSPPKYLLSYYSESSKHQGSGVPSRFSGSKDTSANAGVLQISGLQLEDEADYYCGM
Spermophilus dauricus V339 iglv AXRT01100347.1 7163 SWAQSVLTQQPSVSGTPGQTVTISCIGSSNNIGGNYVHWYQQLQEKPPQLLIYDNSDRPSGVPDRFSGSKSDNSASLTITGLQPEDEAIYHCQSYDDSLSA
Spermophilus dauricus V340 iglv AXRT01100347.1 29634 VDPQNMVTQEPSLSVSSNGTVTLTCGLSSGSVSTGYYPKWCQQMPGQAPYTIIYNTNNRPSGVPDRFSGSILGNKAALTITRAQIDDEADYYCALFMGNG
Spermophilus dauricus V341 iglv AXRT01100347.1 31811 VDPQNMVTQEPSLSVSSNGTVTLTCGLSSGSVSTGYYPKWCQQMPGQAPYTIIYNTNNRPSGVPDRFSGSILGNKAALTITRAQIDDEADYYCALFMGNG
Spermophilus dauricus V342 iglv AXRT01100348.1 11297 SQVHSELIQESSMSASKGEKVTLSCTGNSNNVGSYYVGWYQQILGSAPKTVMLGTTRPSGIPYRFSGSYSGNTATLTITGLQGEDEANYYCLTWDSSLN
Spermophilus dauricus V343 iglv AXRT01100349.1 16356 STSQETSLPTTPGGTVTLTCGSSTGAITTSNYAGWVQQKPYQVSQGLIGSISNRFPGVPASFSGPLLGDKASLTITGAQTEDEATYYCALWFSNH
Spermophilus dauricus V344 iglv AXRT01100350.1 8909 SLSQPLLTQSPPASASLGQTAKLTCTLSSGYNSYWVDWFQQSPGKSPRFVMHVGTSGIVGSKGDGIPDRFSGSGSGLDQYLTIQNIQEEDENIYHCGAGHGSGS
Spermophilus dauricus V345 igkv AXRT01100850.1 6714 VRCEITMIQSPSSLSVSPGDRVKITCRSSEDISSLNNWYQQKPGQAPKLLIYGTNSLESGVPSRFSGSGSGTDYTLTISSLEPEDVAIYFCQQGWSSP
Spermophilus dauricus V359 igkv AXRT01103735.1 534 RCDITMTQSLSSLPVSHGDRVTINCKASQDIGSYLHWYQQKPGQAPKLLIRYATSLESGVPSRFSGSGSGTDFTLTISSLEPEDVATYFCQQ
Spermophilus dauricus V372 igkv AXRT01107878.1 33018 ARCDIKMTQSPSSLSASPGDRVTITCRASQSINSWLAWYQQKPGQAPKCLICKASSLESGVLSRFSGRGSQTYYTLTISSLEPEDVANYFCLVYYSYP
Spermophilus dauricus V373 igkv AXRT01107879.1 1372 SSGDVVLTQSPLSLSITTGEPASISCRSSQSLLHSNGNTYLDWYLQKPGQAPQLLIYQVSIWYTGVPDRLNGSGSGTEFTPKISRVEAEDAGVYYCYQV
Spermophilus dauricus V380 igkv AXRT01110700.1 3633 ARCDIQMTQSPASLLVSLGDRVTIICRSSQGINYLKWYQKKSGQDLKLLIKYATSLQSGVPLRVSGSGSGTDFTLTISSLEPEDVVTYYCQHHSSSP
Spermophilus dauricus V391 igkv AXRT01112686.1 18622 VRCDIQMTQPTSFLSASQGDRVTITCRASQSIGYALSWYQQKLGQAPKLLIYAANSLQSGVPSRFSGSGSGTDFTLTISSLEPEDFATYYCQQYSSYP
Spermophilus dauricus V399 igkv AXRT01117234.1 1067 VRCDIMMIQSPSSLPVSLGDRVTLTCRASQGISHNLHWYQQKPGEAPKLLIKYANTLKSRVPSSFSGSGYGTDFTPPISSLEPEDVANYYCI
Spermophilus dauricus V406 igkv AXRT01119762.1 5814 ARCDIMMTQSPSSLSASPGDKVTITCRASQNINSWLAWHQQKPGQAPKVLINKASNLQSGVPSRFSGSGSGTDYTLTISSMEPEDVATYYCQQDSSYP
Spermophilus dauricus V407 igkv AXRT01119762.1 15966 ARCDIMMTQSPSSLSASPGDKVTITCRASQNINSWLAWHQQKPGQAPKVLINKASNLQSGVPSRFSGSGSGTDYTLTISSMEPEDVATYYCQQDSSYP
Spermophilus dauricus V408 igkv AXRT01119762.1 21011 ARCDIMMTQSPSSLSASPGDKVTITCRASQNINSWLAWHQQKPGQAPKVLINKASNLQSGVPSRFSGSGSGTDYTLTISSMEPEDVATYYCQQDSSYP
Spermophilus dauricus V409 igkv AXRT01119765.1 298 SGARCDITITQSPSSLSASSGDRVTITCRASQSISSRIAWYQQKSGQDPKPIMYYVSIMESGVPSRFSGSGTGTDFSLTISSLELEDVATYFCQQYSSSP
Spermophilus dauricus V411 igkv AXRT01120175.1 5058 VKCDITMTQSPTSLSKSQGETVTIRCQASQGISNYLNWYQQKPGQAPKLLIYYTNRLQSGVPSRFSGSGSGTDYSLTISSLEPEDFDTYYCQQYRSFP
Spermophilus dauricus V412 igkv AXRT01120179.1 4956 VKCDITMTQSPTSLSKSQGETVTIRCQASQGISNYLNWYQQKPGQAPKLLIYYTNQLQSGVPSRFSGSGSGTDYSLTISSLEPEDFATYYCQQGISFP
Spermophilus dauricus V414 igkv AXRT01121489.1 3532 AKCDITMTQSPSSLSKSQGETVTINCQASEGINSYLSWYQQKPGQAPKLLIYYTNRLQTGVPSRFSGSGSGTDYSLTISSLEPEDFATYYCQQYRSYS
Spermophilus dauricus V420 trav AXRT01123563.1 15782 GSGAQSVTQPDRHVLVSEGAPLQLRCSYSSSVSPYLFWYQQRPSQGPQLLLKYVSGATLVTGISGFQAELRKNETSFHLRKPSAHWSDSAEYFCALG
Spermophilus dauricus V421 trav AXRT01123563.1 23134 GIRAQTVTQPEDHIAVFEGALVQVKCNYSYTGSPVLFWYVQYPGQGLQVLLKHISRDSAKGFTAALDRGEKSFHLQKPSAHLDDSATYYCALS
Spermophilus dauricus V422 trav AXRT01123563.1 30650 VKSQQQEESSWVLSIQEGENATMNCSYKTSTTNLQWYRQDSGKGPALVILIRSNEREKHSGRLTATLDTSTQRSILSITASQAADAATYFCATD
Spermophilus dauricus V423 trdv AXRT01123563.1 42255 TSMAQKVAQDQTAISVMEKEAVTFNCTYEISDSTYYLFWYKQPPRGKPTFLIRQDSYNEQNATEGRYSLNFQKASSSIQLTITASQLKDAAVYFCALRE
Spermophilus dauricus V424 trav AXRT01123563.1 54971 KSHGDSVTQTAGLVTLVEGAPMILNCTYQTTYSVFTLWYVQYLDKAPQLLLKSATENQKTESRGFHATLVKKENSFHLQKPAVQPSDSAVYYCALR
Spermophilus dauricus V425 trav AXRT01123565.1 34042 VRGMQVEQSPPALILQEGASSTLLCNFSTSANNVQWFRQNPGGRLINLFYIPSGTKQSGRLTSTTVSKERRSSLYISSSQTTDSAVYFCAVDALCSP
Spermophilus dauricus V426 trdv AXRT01123566.1 2094 FSMAQKVTQVQPATSGQERETVTLDCSYETSYPTYYIFWYKQLSSGEIIFLIHQSSSGSDERKGRYSVQFRRAAKSISLTISLLQREDSAKYFCALRE
Spermophilus dauricus V427 trav AXRT01123567.1 6212 VNGEQLKQIPPSLHIQEGEDFTIYCNYSSTIDSLQWYKQKPGGSPVFLMIIVKDGDVKKQGRLTAQLGKTRKDSSLHIVATQATDVGTYFCAV
Spermophilus dauricus V428 trav AXRT01123568.1 1717 GSRAQSVTQPDLHATVTEGVRLELRCNYSYAATPYLFWYVQYPDQHLEHLLTYLARDTLVKGIKGFEAEFKESESSFNLRKSSAHLSDSAKYFCAPV
Spermophilus dauricus V429 trav AXRT01123568.1 13453 VSTQQLEQRPQFLNTQEGNNLTVHCNSSSVFTSFQWYRQKPGDGPILLLTLVKGGEVKEQKGLTARFDEARKGSSLHIATAQPRDEGIYICA
Spermophilus dauricus V430 trav AXRT01123568.1 18922 VRRAQMKVEQSPQVLNLQEGMRSSLLCNYSLSMTSIQWFQQNSGGQLISLFYIASGVQQNGRMKSTVNSKERYSQLFIRGSQLGDSASYFCAVE
Spermophilus dauricus V431 trav AXRT01123569.1 20653 VRSQQPEQSPQALIIQEREDVTINCSSSKTLYSVQWYRQKHAEGPMFLMMLLKGGEHKSHDKITAMFHEKKQQSSLYIRASQLSHSGTYFCAVE
Spermophilus dauricus V432 trav AXRT01123569.1 39876 VSSQVLQQSPQSLSIQEGENLTINCNSSQSLYALHWYRQNYDAEFIFLMLFRKGREEKSHEKLTAKLDAKMQQSSLSITAAQSSHSGTYFCGGE
Spermophilus dauricus V433 trav AXRT01123569.1 49847 VRGQQLNQSPQSLSIQEGENVSMICNSLSIFNIFLWYRQDPGKILVLLITLYKSGELVRNGKLTAQLGGTRKESFLNISSFMPDNSGTYFCSG
Spermophilus dauricus V434 trav AXRT01123569.1 59422 VSSEDKVVQSPPSLVVHEGNSATLNCSYEMANFQSLHWYKQEEKAPTFLFILVSSGAENKLGRLSGSLNKKLSTLHITATQPGDTATYLCAVE
Spermophilus dauricus V435 trdv AXRT01123570.1 40486 ASMAQTVTQSQPEMSVQEAETATLDCTYDTKDSNYYLYWYKQTASGQMIPIIRQEAYKQENATENRFSVNFQKAAKSLGLKISDSQLGDAAVYFCAFQ
Spermophilus dauricus V436 trdv AXRT01123571.1 605 ASMAQSVTQSQPEMSVQEAETATLDCTYDTRESNYYLYWYKQTASGQMIPIIRQEAYKQENATENRFSVNFQKAAKSLGLKISDSQLGDAAVYFCALQ
Spermophilus dauricus V437 trav AXRT01123572.1 33004 ISGKNEVEQSPQYLSAQEGEFITINCSYSTGMTTLHWLQQNPGGGTVSLFVLSLQMKKNGRMSATISTKESQSSLHIEASQPRDSATYLCAV
Spermophilus dauricus V438 trav AXRT01123574.1 73227 GSCRTEIIQSSNLAATMGTDVKFQCQYNNLKGNYDSVYWYLQRTNQRLTYIYHTFQGTVESERYQLSVDRKLSSSTLTVKQVQPRDGAVYYCAV
Spermophilus dauricus V444 trdv AXRT01126020.1 19796 KGMLCNQVTQNSEDQTVLSGRELMLLCTYDVSFSDPDLYWYRKSPEGSFQFILYKDNTRSKYADFAQGRFFVKHNPTQKTFHLVVSQVRLEDSATYYCAVN
Spermophilus dauricus V445 igkv AXRT01126028.1 45348 VRCDFTMTQSPFFLSKSPGKRVTITCRASQGISNCLNWYQQKPGQVPKHLIYNASSLQSGVSTRFSGRGSGTDFTLTISSLEPEDFATYYCLQYDEFP
Spermophilus dauricus V446 igkv AXRT01126028.1 50920 ARCDIQMTQSPSSLSKSVGDRVTITCRASQNIKNYLHWYQQKPGQAPKLLIHWATSMGYGVSSRFSGSGYGKDFTLTISSLEPEDVATYYCLQGYSSP
Spermophilus dauricus V447 igkv AXRT01126028.1 77335 VRCDITMTQSPSSLPVSLGDRVTLTCRASQGISSNLHWYQQKPGQAPKLLIYGANNLQPGVPSRFSGSGSGTDFTLTISSLEPEDVATYYCLQGYSYP
Spermophilus dauricus V463 iglv AXRT01131405.1 10285 SWAQSVLTQQPSLSGTPGQKVTISCTGCSTSIGDGYSVQWYQQLPETAPKLLIYSNSNRPSGFLDHFSGSRSGNSGSLTITGLQPEDEAVYYCQSYDKSLKA
Spermophilus dauricus V465 trbv AXRT01132451.1 4421 HMESGVIQIPRHQVTKMGQMVILSCDPIFGHSFFYWYQQILEQRLEFLVSFYNGKTLEKSEILNDRFSVEKPDKSYFTLKIHLTKLEDSALYLCASSL
Spermophilus dauricus V466 trbv AXRT01132451.1 13033 PLHSGVSQTPKYLLAQDGKKQSFKCEQNLGHDTMYWYKQDSKQSLKMMFSYYNKEMIANETVPGRFSPESPDKDHLNLHVKSLEPEDSALYLCASSQ
Spermophilus dauricus V467 trbv AXRT01132451.1 16101 HMEPGVRQSPSHAVTEAGQDVALSCDPVAGHASLYWYRQTPGKGLESLVSFYNKQPAGKADFFRDRFSAERPEGSLSTLKIQPTQLGDSATYLCSSPSE
Spermophilus dauricus V468 trbv AXRT01132452.1 11463 PVNAGIIQTPKYQILKVGQPMTLRCAQDMNYGSMYWYRQDPGLGLRLVHYSHNIDNMEKGEVPEGNSVSRSRKGDFPLTLPSATYSQTSVYICASS
Spermophilus dauricus V469 trbv AXRT01132452.1 14340 HTHAGVSQSPRHKVTKRGQNVVLRCDPISGHSGLYWYRQTPGQGPAFLMSFLDERAADKSGMRSERFSAERPQGSFSTLEIQLTEPGDSAVYLCASSS
Spermophilus dauricus V470 trbv AXRT01132452.1 23003 HVEAGITQSPRHIITETGEKVTLRCHQTDNHDYMYWYRQDPGQGLQLIHYSYGVGNTAKGDVSDGYSVSRSNKKDFPLTLESTTRSQTSVYFCATSD
Spermophilus dauricus V471 trbv AXRT01132454.1 394 HVEAGITQNPRHIITETGEKVTLRCHQTDNHDYMYWYRQDPGQGLQLIHYSYGVGNTAKGDVSDGYSVSRSKTEDFPLTLESATHSQTSVYFCATSD
Spermophilus dauricus V472 trbv AXRT01132454.1 15251 SLHSGVSQTPKYLLAQTGKKQFLKCEQNLGHNAMYWYKQDSKQSLKMMFSYYNKEMTVNERVPGRFSPESPDKAHLNLHVKSLEPEDSALYLCASSQ
Spermophilus dauricus V473 trbv AXRT01132454.1 27220 HAHAGVSQSPRHRVTKRGKNVVLRCDPISGHSGLYWYPQTTGQGLEFLMSFQYERVADKSGMHSERFSAERPQGSFSTLEIQLTEPGDSAVYLCASSS
Spermophilus dauricus V474 trbv AXRT01132454.1 29798 LMDAVITQRPRHLILHTGKKTTLECSQNLNHYAMFWYRQDPGQGLRLLHYSGSVGSTAEGEAPQGTSVSRDQKEHFPLTLGSPSTSQSSLYLCASSE
Spermophilus dauricus V475 trbv AXRT01132455.1 2339 HVEAGITQSPRHIITETGEKVTLRCHQTDNHDYMYWYRQDPGQGLQLIHYSYGVGNTAKGDVSDGYSVSRSETEDFPLTLESATHSQTSVYFCATSD
Spermophilus dauricus V476 trbv AXRT01132455.1 4885 HVEAGITQSPRHIITETGEKVTLRCHQTDNHDYMYWYRQDPGQGLQLIHYSYGVGNTAKGDVSDGYSVSRSNKKDFPLTLESATRSQTSVYFCATSD
Spermophilus dauricus V477 trbv AXRT01132456.1 5632 LTDVGVTQTPRHEVAQKGQTVTLRCQAILSHNALFWYRQTVVQGLELLIFFRNQAPIDDTGMPKDRFSAAMPNASSSTLKIQPTEPRDSAVYLCASSL
Spermophilus dauricus V478 trbv AXRT01132456.1 12728 SLHSGVSQTPKYLLAQTGKKQFLKCEQNLGHNAMYWYKQDSKQSLKMMFSYYNKEMTVNERVPGRFSPESPDKAHLNLHVKSLEPEDSALYLCASSQ
Spermophilus dauricus V479 trbv AXRT01132456.1 18548 HMEPGVRQSPSHAVTEAGQDVALSCDPVAGHASLYWYRQTPGKGLESLVSFYNKQPAGKADFFRDRFSAERPEGSLSTLKIQPTQLGDSATYLCSSSL
Spermophilus dauricus V480 trbv AXRT01132456.1 27655 PTKAGITQSPKSQILKTGQRMTLTCAQDMNHDSMYWYRQDPGLGLRLIHYSHNVRNEEKGEVPDGYSASRSSKENFLLTLESPTPSQTSVYLCATSY
Spermophilus dauricus V481 trbv AXRT01132456.1 38419 PTKAGITQSPKSQILKTGQRMTLTCAQDMNHDSMYWYRQDPGLGLRLIHYSHNVRNEEKGEVPDGYSASRSSKENFLLTLESPTPSQTSVYLCATSY
Spermophilus dauricus V482 trbv AXRT01132457.1 5175 LMDAVITQRPRHLILHTGKKTTLECSQNLNHYAMFWYRQDPGQGLRLLHYSGSVGSTAEGEAPQGTSVSRDQKEHFPLTLGSPSTSQSSLYLCASSE
Spermophilus dauricus V483 trbv AXRT01132458.1 11090 HTHAGVSQSPMHRVTKTGQNVTFRCDPIPGHNVLYWYRQTLGQGPEFLMYFQNKIAADKSGMPSERFSTERPQGSFSTLEIQLTVQGDSAVYLCASSS
Spermophilus dauricus V484 trbv AXRT01132458.1 16827 SVDAEVILSPRHLIRAKGGKGTLKCYPMSGHRSVSWYQQAPGQGPQFLVQYFEKMQRDKGKLPDRFSAQQFDDYHSELNMSSLELGDSATYLCASS
Spermophilus dauricus V485 trbv AXRT01132459.1 270 HLEAEITQSPRHIITETGEKVTLRCHQTYNYEYMYWYRQDPGQGLQLIHYSYGVGNTAKGDVSDGYSVSRSETEDFPLTLESATHSQTSVYFCATSD
Spermophilus dauricus V486 trbv AXRT01132460.1 7109 LTGAGVTQSPRDEITEERRAEAFWCDPISDHNTLFWYWQTPGGGPEHLIHFQNEAVLDDSQLPKDRFSAERSKGANSTLRIQPVQVGDSAVYLCASSS
Spermophilus dauricus V487 trbv AXRT01132460.1 9323 LTGAGVTQSPRDEITEERRAEAFWCDPISDHNTLFWYWQTPGGGPEHLIHFQNEAVLDDSQLPKDRFSAERSKGANSTLRIQPVQVGDSAVYLCASSS
Spermophilus dauricus V488 trbv AXRT01132460.1 13056 LTGAGVTQSPRDEITEERRAEAFWCDPISDHNTLFWYWQTPGGGPEHLIHFQNEAVLDDSQLPKDRFSAERSKGANSTLRIQPVQVGDSAVYLCASSS
Spermophilus dauricus V489 trbv AXRT01132460.1 19300 HTDAGVIQTPRHEVTEKRQAVTLRCEPISGHTHLFWYRQTAGQEPEFLIYFSSRSVVDDKGMPKDRFSAEMPSASSSTLKIQPTEPKDSAMYLCASSP
Spermophilus dauricus V490 trbv AXRT01132460.1 24335 HTDAGVIQTPRHEVTEKRQAVTLRCEPISGHTHLFWYRQTAGQEPEFLIYFSSRSVVDDKGMPKDRFSAEMPSASSSTLKIQPTEPKDSAMYLCASSP
Spermophilus dauricus V491 trbv AXRT01132461.1 1807 PTDAGVTQTPRHKVAQKGQTVTLRCEPHSNHDTIFWYRQTMVQGLELLVYFNNKLLMDDSGMPKDRFSAAMPEASFSTMKIQPIAPGDSAVYLCASSL
Spermophilus dauricus V492 trbv AXRT01132461.1 11630 PVTAMVMQNPRYRTTRVGKPVNLSCSQTLNHDTMYWYQQKPSHPPKLLLYYYDDQLNKQTDTSDNFQASRPKTSLCSLDIRSAGLEDSAVYLCASSR
Spermophilus dauricus V493 trbv AXRT01132461.1 14218 SLGQEVTQTPRHLIKGKGQRVKMFCVPIKGHNFLFWYQQILAKQFKFLVSFQYNKVSDQSGMPKERFSAECSQNSSCSLEIQPTELQDSATYLCASSE
Spermophilus dauricus V495 trbv AXRT01132461.1 37329 LMDGGITQTPKFLFRKEGQGVTLGCEQNSGHDAMYWYRQDPGQGLRLIYYSTVENDVQEGDLAEGYGASREQKPSFPLSMTSAEKKHTSLYLCVSSL
Spermophilus dauricus V496 trbv AXRT01132463.1 1908 LMDGGITQTPKFLLRKEGQGVTLGCEQNLGHDAMYWYLQDPGLGLRLIYYSTFEKDVQEGDLAKGYGASREQKPSFPLSMTSAEKKHTSLYLCASSL
Spermophilus dauricus V497 trbv AXRT01132463.1 7465 LMDGGITQTPKFLLRKEGQGVTLGCEQNLGHDAMYWYLQDPGLGLRLIYYSTFEKDVQEGDLAKGYGASREQKPSFPLSMTSAEKKHTSLYLCASSL
Spermophilus dauricus V499 trbv AXRT01132463.1 17517 GSGLGAHVSQHPSRAICKSGTSVKIECRFADFQATTVFWYHQFLKQSFVLMATSNVGSEGTYEQGFDKKNFPISHPNASFASLMVTSAHSADSSFYFCAG
Spermophilus dauricus V500 trbv AXRT01132464.1 471 SGLGAHVSQHPSRAICKSGTSVKIECRFVDFQATTVFWYHQFPKQSFVLMATSNVGSEGTYEQDFDKKNFPISHPNASFASLMVTSAHSADSSFYFCGGS
Spermophilus dauricus V501 trbv AXRT01132467.1 5110 SGLGAHVSQHPSRAICKSGTSMKIECRFVDFQATTVFWYHQFPKQSFVLMATSNVGSEGTYEQGFVKEKFPISHPNLNFASLMVTSAHSADSSFYFCGGS
Spermophilus dauricus V502 trbv AXRT01132467.1 9238 SGLGAHVSQHPSRAICKSGTSMKIECRFVDFQATTVFWYHQFPKQSFVLMATSNVGSEGTYEQGFVKEKFPISHPNLNFASLMVTSAHSADSSFYFCGGS
Spermophilus dauricus V503 trbv AXRT01132467.1 13210 SGLGAHVSQHPSRAICKSGTSMKIECRFVDFQATTVFWYHQFPKQSFVLMATSNVGSEGTYEQGFVKEKFPISHPNLNFASLMVTSAHSADSSFYFCGGS
Spermophilus dauricus V504 trbv AXRT01132467.1 17338 SGLGAHVSQHPSRAICKSGTSMKIECRFVDFQATTVFWYHQFPKQSFVLMATSNVGSEGTYEQGFVKEKFPISHPNLNFASLMVTSAHSADSSFYFCGGS
Spermophilus dauricus V505 trbv AXRT01132467.1 31281 SGLGAHVSQHPSRAICESGTSVKIECRFVDFQAQVVFWYHQFLKQSFVLMATSNVGSEGTYEQDFDKKKFPISHPNASFASLMVTSAHSADSSFYFCGGS
Spermophilus dauricus V506 trbv AXRT01132467.1 33092 GSGLGAHVSQHPSRAICESGTSVKIECRFVDFQATTVFWYHQFPKQSFQLMATSNVGSEGTYEQDFDKKKFPISHPNASFASLMVTSAHSADSSFYFCGGS
Spermophilus dauricus V507 trbv AXRT01132470.1 500 SFVAEVIQTPGHLVKTKGQKAKMQCVPTTGHTAVYWYQQKPNKELQFLIYFQNQEVLDQIEMVKQRFKVEYPKNSPCSLEIQSSEPGDSALYFCASSP
Spermophilus dauricus V508 trbv AXRT01132470.1 11905 SMDSGVTQTPRKRIAKTGKSTVLECSQTKGHDRMYWYRQDPGQGLWLIYFSIGVNDISQGEFSNGYSASRTEKPKFSLTVKSATPNQTALYFCASSP
Spermophilus dauricus V509 trbv AXRT01132470.1 16800 SMDSGVTQTPRKRIAKTGKSTVLECSQTKGHDRMYWYRQDPGQGLWLIYFSIGVNDISQGEFSNGYSASRTEKPKFSLTVKSATPNQTALYFCASSP
Spermophilus dauricus V510 trbv AXRT01132472.1 10675 PLEAQVTQNPRYLITKTGKMLTVTCSQNMNHDCMYWYRQDPGLGLKLIYLSINVEMVDKGDISDGYIVSRKEKKEFPLTLTSTSINQTSLYLCASSL
Spermophilus dauricus V511 trbv AXRT01132472.1 12907 PLEAQVTQNPRYLITKTGKMLTVTCSQNMNHDCMYWYRQDPGLGLKLIYLSINVEMVDKGDISDGYIVSRKEKKEFPLTLTSTSINQTSLYLCASSL
Spermophilus dauricus V512 trbv AXRT01132472.1 15139 PLEAQVTQNPRYLITKTGKMLTVTCSQNMNHDCMYWYRQDPGLGLKLIYLSINVEMVDKGDISDGYIVSRKEKKEFPLTLTSTSINQTSLYLCASSL
Spermophilus dauricus V513 trbv AXRT01132472.1 17371 PLEAQVTQNPRYLITKTGKMLTVTCSQNMNHDCMYWYRQDPGLGLKLIYLSINVEMVDKGDISDGYIVSRKEKKEFPLTLTSTSINQTSLYLCASSL
Spermophilus dauricus V514 trbv AXRT01132472.1 19603 PLEAQVTQNPRYLITKTGKMLTVTCSQNMNHDCMYWYRQDPGLGLKLIYLSINVEMVDKGDISDGYIVSRKEKKEFPLTLTSTSINQTSLYLCASSL
Spermophilus dauricus V515 trbv AXRT01132472.1 21835 PLEAQVTQNPRYLITKTGKMLTVTCSQNMNHDCMYWYRQDPGLGLKLIYLSINVEMVDKGDISDGYIVSRKEKKEFPLTLTSTSINQTSLYLCASSL
Spermophilus dauricus V516 trbv AXRT01132472.1 24086 PLEAQVTQNPRYLITKTGKMLTVTCSQNMNHDCMYWYRQDPGLGLKLIYLSINVEMVDKGDISDGYIVSRKEKKEFPLTLTSTSINQTSLYLCASSL
Spermophilus dauricus V517 trbv AXRT01132472.1 28323 LVHTGVTQTPKFLVKRMGEKAVLECLQDMDYERMFWYRQDPGLGLRLIYFSYDADNNDKGDIPEGYSVSRKKRERFSLILESASFTQTALYLCACSK
Spermophilus dauricus V518 trbv AXRT01132472.1 38302 FVSSVLLYQKPSRSICQHGTSVTIQCQVDSQVSLMFWYHQPPGQSLMLIATANQGSEATYESGFDKDKFPISRPNLTFSTLTVNNVSPKDSSLYLCSAG
Spermophilus dauricus V519 trbv AXRT01132472.1 56845 FVSSVLLYQKPSRSICQHGTSVTIQCQVDSQVSLMFWYHQPPGQSLMLIATANQGSEATYESGFDKDKFPISRPNLTFSTLTVNNVSPKDSSLYLCSAG
Spermophilus dauricus V521 igkv AXRT01134040.1 1792 VRCDITMTQSPSSLPVSRGDRVTINCRASQGISNSLHWYQQKPGQAPKLLIRYANTLQSGVPSRFSGSGSGTDFTLTISSLEPEDVATYYCQQSSSW
Spermophilus dauricus V530 trav AXRT01137028.1 10627 SSFAQKVTQAQPAMWVQEKEAVSLLCSYDTSATNYDLLWYKQPSSGEMVFLILQNSYSQQNATEGRYSVNLQKASKSIQLVISASQLGDSAVYFCALRD
Spermophilus dauricus V531 trav AXRT01137028.1 20030 GVRGQQVEQSPSALRLQEGDSSTLRCNFSITMRSVQWFQQNLGGSLISLFFLTSGTKQEGRLKATMNFQERYSTLHISTSQLEDSGTYFCAAE
Spermophilus dauricus V532 trav AXRT01137028.1 28147 VSRGNQVEQHPSTLSVQDGDSAVINCTYSDSGSSYFTWYKQEAGKGLQMIIDIRSNKEINQIQRFIVVLDKKAKHFSLTVTATQNGDSAVYFCAAD
Spermophilus dauricus V533 trav AXRT01137028.1 45331 RTHGDSVTQMESHVTMSEGVLLTINCTYSTITIAYPALFWYVQYPGEGLQLLLKAVKANDKVSNKGFQATYNKEATSFNLEKASIQESDSAVYYCALG
Spermophilus dauricus V534 trav AXRT01137030.1 3236 GVRGQQVEQSPSALRLQEGTSPTLRCNFSTTMNRVQWFQQNPGGGLISLFYLTSGTKQEGRLKATVNFQERYSTLHISTSQMEDSGTYLCAA
Spermophilus dauricus V535 trav AXRT01137031.1 22048 SSFAQKVTQAQPAMWVQEKEAVNLHCSYDTSETSYGLLWYKQPSSGEMVFLFHKNSYSQQNATEGRYSVNLQKASKSIQLVISASQLGDSAVYFCALRE
Spermophilus dauricus V536 trav AXRT01137031.1 25734 SSFAQKVTQAQPAMWVQEKEAVNLHCSYDTSETSYGLLWYKQPSSGEMVFLFHKNSYSQQNATEGRYSVNLQKASKSIQLVISASQLGDSAVYFCALRE
Spermophilus dauricus V537 trav AXRT01137031.1 30333 RTLGQSVTQTEGQVTISEGSFLTINCTYSSSGYAYLFWYVQYPGEGPQLLLKALNVNDKGSEKGFEATYKKETTSFHLEKASIQESDTAVYYCALG
Spermophilus dauricus V538 trav AXRT01137031.1 32256 RTLGQSVTQTEGQVTISEGSFLTINCTYSSSGYAYLFWYVQYPGEGPQLLLKALNVNDKGSEKGFEATYKKETTSFHLEKASIQESDTAVYYCALS
Spermophilus dauricus V539 trav AXRT01137033.1 3948 VHSQQKAMEQSPAALSVPEGAVASLNCTYSDSASRNFMWYQQYSGKGPKLLISIYSNGEKGEGRFTAQLDTAKQHLFLHIQGSKLSESATYFCAL
Spermophilus dauricus V540 trav AXRT01137034.1 3116 GSGAQSVTQPDRHVLVSEGAPLQLRCSYSSSVSPSLFWYQQRPSQGPQLLLKYVSGATLVTGISGFQAELRKNETSFHLRKPSAHWSDSAEYFCALG
Spermophilus dauricus V541 trav AXRT01137034.1 8188 VNSQQEEESPWVLSVQEGENATMNCSYKSSTTTLQWYRQDSGKGPALVILIRANEREKHSGRLTATLDTSTKRSVLHITASQAADAATYFCATD
Spermophilus dauricus V542 trdv AXRT01137034.1 19921 TSMAQKVIQAQTAISVVEKEAVTLDCVYETSDSSYYLFWYKQLPSGKLTLLIRQESYNQQNATEGRYSLNFQKASSSIQLTITASQLMDAAVYFCALRE
Spermophilus dauricus V543 trdv AXRT01137034.1 23469 TSMAQKVIQAQTAISVVEKEAVTLDCVYETSDSTYYLFWYKQLPSGKLTLLIRQESYNQQNATEGRYSLNFQKASSSIQLTITASQLMDAAVYFCALRE
Spermophilus dauricus V544 trav AXRT01137034.1 37976 RSNGDSVNQTAGLVTLIEGAPVTLNCTYQTTYSGYFLYWYVQYLDKGPELLLKSATENQKIESQGFHSSLIKKENSFHLQKTAVQISDSAVYYCAVG
Spermophilus dauricus V546 igkv AXRT01138389.1 7730 SIGDVVQTQTPLSELITPGQPASISCRSSQSFLHSNGNTYLHWVVHKSGQAPQGLICGVYIWYTGVPDRFSGRGSETDFKLRISRVEPEDAGVYYCF
Spermophilus dauricus V549 igkv AXRT01139493.1 25571 TSGDIVMTQIPLSEPITLGQPASISCRSSQSLVDSGGNTYLSWVVHKPGQAPRGLIYKVSKRFTGVSDRFSGSGSGTDFTLRISRVEADDAGVYYCAQL
Spermophilus dauricus V550 igkv AXRT01139493.1 45135 TSGDIVMTQTPLSEPVTPGQSVSISCRSSQSLVGSGGNTYLRWVLHKPGQAPRGLIYGISNRYTGVSDRFSGSGSGTDFTLRISGVEPEDAGIYYCLQSVQAP
Spermophilus dauricus V551 igkv AXRT01139494.1 28854 SIGDVVLTQTPLSEPVIPGQPASISCRSSQSLLHSNGNTYLHWVMHKPGQAPKYLVYKVSNRDTWVPDRFSGSGSGTYFTLRISRVEPDDAGVYYCCEDIHVP
Spermophilus dauricus V552 igkv AXRT01139494.1 49168 AKCDITMTQSPTSLSKSQGETVTIRCQASQDISNYLSWYQQKPGQAPKPLIYYTNRLQSGVPSRFSGSGSGTDYSLTISSLEPEDFATYYCQQGYSSP
Spermophilus dauricus V553 igkv AXRT01139494.1 61276 TSGDIVMTQTPLSEPVTPGQSASISCRSSQSLLHSNGNTYLNWVVHKPGQAPQGLIYKVSNRYTGVPDRFSGSGSGTDFTLRISRVEPEDAGVYYCWQAKEYP
Spermophilus dauricus V554 igkv AXRT01139494.1 62379 TSGDIVMTQTPLSEPVTPGQSASISCRSSQSLLHSNGNTYLNWVVHKPGQAPQGLIYKVSNRYTGVPDRFSGSGSGTDFTLRISRVEPEDAGVYYCWQAKEYP
Spermophilus dauricus V555 igkv AXRT01139497.1 40902 TSGDIVMTQTPLSEPVTPGQSVSLSCRSSQSLLHSDGKTYLSWVVHKPGQAPQGLIYRVSNLVSGVSERFSGSGSGTDFTLRISRVDPDDAGIYYCVQYLQTP
Spermophilus dauricus V556 igkv AXRT01139497.1 54886 TSGDIVMTQTPLSEPVTPGQSVSLSCRSSQSLLHSDGKTYLGWVVHKPGQAPQGLIYLASNRFSGVPERFSGSGSGTDFTLRISRVEPEDAGIYFCVQSLQTP
Spermophilus dauricus V557 igkv AXRT01139497.1 73592 TSGDIVMTQTPLSEPVTPGQSVSLSCRSSQSLLHSNGKTYLSWVVHKPGQAPQGLIYLASNHVSGVPERFSGSGSGTDFTLRISRVEPEDAGLYYCCQDIQAP
Spermophilus dauricus V558 igkv AXRT01139806.1 6829 TSGDVVLTQTPLSEPVIPGQPASISCRSSQSLLHSNGNTFLNWVVHKPGQAPQGLIYKVSTRVSGVSDRFSGSGSGTDFTLRISRVEPDDAGVYYCWQG
Spermophilus dauricus V568 igkv AXRT01140812.1 1199 IRGDVVMTQTLSEPVMPGQSASISCRSSQSLLNSKGNTYMNWVVHKPGQAAQGLIYKVSNQFAGVPEGFSCSGSGTDFTLRISRVEPEDAGVYYCWQG
Spermophilus dauricus V569 igkv AXRT01140812.1 10799 STGDIVLTQTPLSESITPGQSASISCRASQSLLHSDGKTYLYWFVHKPGQAPQSLIYQVSNRDTGVPDRFSGSGSGTDFTLTISRVEPEDAGMYYCWQL
Spermophilus dauricus V575 igkv AXRT01142188.1 14487 SSGDVVLTQTPLSLPVTPGQPASISCRSSQSLLHSNGNTYLEWYQQKPGQSPKLLIYTVSNRFTGVPDRFSGSGSGTDFTLRISRVEAEDAGVYYCYQGTKVP
Spermophilus dauricus V576 igkv AXRT01142188.1 17303 VKMGTALTQSPALLAVYPGERTTITCTTNPKESSKFSWYQQKPGQAPKLLVHGTSTLASGVPARFSGSHLGADFTLTISNVETNDAGTYYCIEWPG
Spermophilus dauricus V581 igkv AXRT01143496.1 11174 VRCEITMIQSPSSLSVSRGDRVKITCRSSEDISSFLHWYQQKPGQAPKLLIYGTNSLESGFPSRFSGSGSGTDYTLTISSLEPEDVATYFCQQGWSYP
Spermophilus dauricus V597 igkv AXRT01152449.1 11262 SSGDVVLTQTPLTVPITPGQSASISCRSSQSLLYSDGKTYLEWHQQNPCQSPKLLIYEVSNRLTGVPDRFSGSGSGTDFTLRISRVEAEDAGVYYCGQF
Spermophilus dauricus V601 igkv AXRT01153546.1 3041 SSGDVVLTQTPLTVPITPGQSASISCRSSQSLLYSDGKTYLEWHQQNPCQSPKLLIYEVSNRLTGVPDRFSGSGSGTDFTLRISRVEAEDAGVYYCGQF
Spermophilus dauricus V603 igkv AXRT01156471.1 2324 ARCDIMMTQSPSSLSASPGDKVTITCRASQNINSWLAWHQQKPGQAPKVLINKASNLQSGVPSRFSGSGSGTDYTLTISSMEPEDVATYYCQQDSSYP
Spermophilus dauricus V604 igkv AXRT01158366.1 36464 IRGDVVMTQTLSEPVMPGQSASISCRSSQSLLNSKGNTYMNWVVHKPGQAAQGLIYKVSNQFAGVPEGFSCSGSGTDFTLRISRVEPEDAGVYYCWQG
Spermophilus dauricus V613 igkv AXRT01165002.1 51 GVRGDITMTQSPSSLPVSRGDRVTLTCGASQGIGSNLNWYQQKPGQAPKLLIYLSTSLQPGIPSRFSGSGSGTDFTLTISSLEPEDFATYYCQQDSSYP
Spermophilus dauricus V614 iglv AXRT01166880.1 67 SWAQFELTQPHSVSASPGKTVTISCTRSSGNIGRYYVHWYQQRLGSAPSTVIYADDQRPSGVPDRFSGSIDSSSNTASLTISGLQIEDEADYYCQSYDGNY
Spermophilus dauricus V615 trdv AXRT01168744.1 151 TSMAQKVIQAQTGISVVEKEAVTLDCVYETSDSSYYLFWYKQLPSGKLTLLIRQESYNQQNATEGRYSLNFQKASSSIQLTITASQLMDAAVYFCALRE
Spermophilus dauricus V616 igkv AXRT01168973.1 432 SSGDVVLTQTPLTVPITPGQSASISCRSSQSLLYSDGKTYLEWHQQNPCQSPKLLIYEVSNRLTGVPDRFSGSGSGTDFTLRISRVEAEDAGVYYCGQF
Spermophilus dauricus V617 igkv AXRT01169378.1 3911 VRCDIMMTQSLSSLPVSRGDRVTITCRASQGISNRLHWYQQKPGQAPKLLIRYANTLQPGVPSRFSGSGSGTDYYLTISSLEPEDVVNYYCLQ
Spermophilus dauricus V620 trav AXRT01386126.1 85 VNSQQEEESPWVLSVQEGENATMNCSYKSSTTTLQWYRQDSGKGPALVILIRANEREKHSGRLTATLDTSTKRSVLHITASQAADAATYFCATD
Spermophilus dauricus V623 igkv AXRT01403620.1 78 SGARCDITITQSPSSLSASSGDRVTITCRASQSISSRIAWYQQKSGQDPKPIMYYVSIMESGVPSRFSGSGTGTDFSLTISSLELEDVATYFCQQYSSSP
Spermophilus dauricus V627 trav AXRT01483673.1 297 AHTQVVQVNDSMYGFIGTDIVLHCSFANPLPNVKITQVTWQKATNGSKQNVAIFNPAMGVSVLSPYRERVEFLRPSYIDGTIRLSRLELEDEGVYICEF
Spermophilus dauricus V647 iglv AXRT01006184.1 8379 SVASYVLTQPSSVSVTPGQTARITCGGNNIGSKSVYWYQQKPAQAPLLVIYYDSTRPTGIPDRFTGSNSGNTATLTIGGAQAGDEADYYCQVWDSGA
Spermophilus dauricus V648 iglv AXRT01006185.1 4764 SYVLTQPSSVSVAPGQTATITCEGKSIGSYLVHWYQQKPTQAPLLVIYKDSKRPSGISDPFSGSNSGNTAILTISGVQAGDEADYYCQLWYSNA
Spermophilus dauricus V649 iglv AXRT01006187.1 16011 FWAQSALTQPPSVSGTPGQSVTISCAGTSSDIGKYNEVSWYQNRPGITHKLMIYGVSSRPSGIPDRFSGSKSGNTASLTISGLQLEDEADYYCC
Spermophilus dauricus V650 iglv AXRT01006188.1 7782 SWSQSALTQPPSASRSIEQPVTISCTGTSNDIEICNNVSWYRNLPGASPKILIYGATNHPSSVPDHSSGPQSGNSASLTISSLQAEDEADYYCCSYTSSSN
Spermophilus dauricus V651 iglv AXRT01006190.1 1908 SVASYVLTQPSSVSVTPGQTARITCGGNNIGGKYVYWYQQKPAQSPLLIIYRDSNRPSGIPDRFSGSNSGNTATLTISGAQAGDEADYYCQVWDSGA
Spermophilus dauricus V652 iglv AXRT01006192.1 6489 FWAQSALTQPPSVSGTPGQSVTISCAGTSSDIGKYNLVSWYQHRPGTTHKLMIYGVSSRPSGIPDRFSGSKSGNTASLTISGLQLEDEADYYCCSYAGNYN
Spermophilus dauricus V653 iglv AXRT01006195.1 1934 SVASYVLTQPSSVSVTPGQTARITCGGNNIGSKNVHWYQQKPAQSPLLVIYGTSNRPSGIPDRFSGSSSGNTATLTISGAQAGDEADYYCQVWDGNA
Spermophilus dauricus V654 iglv AXRT01006197.1 21067 FWAQSALTQPPSVFGTPGKSVTISCVGTCSDIGRFNDVSWYQNHPETTHKLMIHSVSSRPSAIPNHFSGSNTGNTVSLTISGLQLEDETDYYCCS
Spermophilus dauricus V655 igkv AXRT01006481.1 25120 TSGDIVMTQTPLSKLVTPGQSVSISCRSSQSLLYSDGKTYLHWVVHKSGQTPHVLIYGVSNRFAGVSDRFSGSGSGTDFTMRISRVEPDDAGIYYCVQSLHIP
Spermophilus dauricus V656 igkv AXRT01006481.1 12052 ISGDIVMTQTPSSVPVTPGQSVSLSCRSSQSLVHSNGNTYLSWFVHKPGQAPQGLIYQVSNRFTGVSDRFSGSGSGTDFTLKISRVEPDDAGIYYCQQGKEYP
Spermophilus dauricus V660 igkv AXRT01008608.1 619 AKCDITMTQSPSSLSKSQGETVTIRCQASQGIGNELSWYQQKPGEAPKLLVYYTNRLQSGVPSRFSGSGSRTDYSLTISSLEPEDFATYYCQQGYSFP
Spermophilus dauricus V661 igkv AXRT01009149.1 4370 VRCDITMTQSLSSLPVSHGDRVTINCKASQDIGSYLHWYQQKPGQAPKLLIRYATSLESGVPSRFSGSGSGTDFTLTISSLEPEDVATYFCQQ
Spermophilus dauricus V678 igkv AXRT01015598.1 67603 VRCDIMMTQSPSSLPVSHGDRVTLTCRASQGIRNYLHWYQQKPGQAPKLLINNASNMKPGVPSRFSGNGSGTDFTLTSSTLTISSLDPEDVADYYCQHYSSAP
Spermophilus dauricus V679 igkv AXRT01015598.1 60338 TTGEIVLTQTPDSVALSPGERATLTCRASQSVGSFLAWYQQKPGQAPRCLIYGSFRRASGVPARFSGNGSGTDYTLSISSLEPQDAAVYYCCK
Spermophilus dauricus V680 igkv AXRT01015598.1 1177 SRCDITMTQSPSFMSKSQGDSVTITCQASESIGTSLHWYQQKPGQAPRLMINYATSLESGVPLRFSGTGSWTDFTLTISSLEPEDAATYYCQQSWDSP
Spermophilus dauricus V681 igkv AXRT01015601.1 30380 VKCDIRMTQSPSSLSMSPGGRVTITCRASEDIYDYLNWYQQKPGQPPKLLIYGASNLQPGVPSRFSGSGSETDYSLTISSLEPEDAATYFCQQGSSYP
Spermophilus dauricus V682 igkv AXRT01015601.1 12968 AKCDIQMTQSLSSLSKSRGERVTITCWASKYISDDIYWYQQKPGQTPKLLLYDATSLKSGVPLRFSNSGSGTDFTLTISSLEPEGAGNYYCQQGNSFP
Spermophilus dauricus V683 igkv AXRT01015604.1 33664 IRWDIQMTQTPSTLSVSQGDRVTITCQASENIYSYVSWYQQKQEQAPKQLIYAASNLQSGVPSRFSGSGSGKDYSLTISDLEPEDVATYYCLQGYSSP
Spermophilus dauricus V684 igkv AXRT01015607.1 6755 YNGDNVMTQTPLTLSITPGQPAFISCRSTQSLLHSDGNSYLSWYMQRPGHSPRLLIYIASNRASGVPEKFRGSGSGTYFTLKISRVEAEDVGAYYCQDGLQF
Spermophilus dauricus V685 igkv AXRT01015613.1 10698 VRCDITMTQSPSSLPVSPGDRVTISCKASQGIGGYLHWYQQKSGQAPKLLIRNANTLESGVPSRFSGSGSGSDYTLTISSLELEDVANYYCQQGSSSP
Spermophilus dauricus V686 igkv AXRT01015614.1 31447 VRCDIQMTQPTSFLSASQGDRVTITCRASQSIGYALSWYQQKLGQAPKLLIYAANSLQSGVPSRFSGSGSGTDFTLTISSLEPEDFATYYCQQYSSYP
Spermophilus dauricus V687 igkv AXRT01015614.1 16437 VRCDIMMTQSPSSLPVSRGDRVTITCRASQGISNRLHWYQQKPGQAPKLLIRYANTLQPGVPSRFSGSGSGTDYYLTISSLEPEDVVNYYCLQ
Spermophilus dauricus V688 igkv AXRT01015614.1 899 VRCDITMTQSPSSLPVSPGDRVTISCKASQGIGGYLHWYQQKSGQAPKLLIRNANTLESGVPSRFSGSGSGSDYTLTISSLELEDVANYYCQQGSSSP
Spermophilus dauricus V689 igkv AXRT01015615.1 7585 VRCDIMMSQSPSSLPVSCGHRDTLTCRASQGISSNLLWYQQKPGQAPKLLIRYANTLESWIPSRFTGSGYGTDFTLTISSLEPEDDADYYCLQNYSSP
Spermophilus dauricus V690 igkv AXRT01015616.1 36317 VKCDIIMTQSPSSLPVSPGDKVTITCRASEDIGDYLYWYQQKPGQAPKLLMDLVTGLQSGVPSRFSGSGFGTDFTLTISSLEPEDVATYYCQWHNSSP
Spermophilus dauricus V691 igkv AXRT01015617.1 39072 GVRCDIRLTQSSSSLTVSPGDRVTLTCRASQGINNYLHWYQQKPRQANKLLIYYANTLQSGVPWRFSGSRSGTDFTLTINSLEPEDVASYYCQQSSSW
Spermophilus dauricus V692 igkv AXRT01015617.1 29947 STCDIQMTQSPSPLSASQGDRVTITCRASEDISDFLHWHQQKPGHAPKRLITYANTLQSRVPSRFSGSGSVTDFTLTVSSLESEDVATYFCQQGSCSP
Spermophilus dauricus V693 igkv AXRT01015617.1 7324 VKCDIIMTQSPSSLPVSPGDKVTITCRASEDIGDYLYWYQQKPGQAPKLLMDLVTGLQSGVPSRFSGSGFGTDFTLTISSLEPEDVATYYCQWHNSSP
Spermophilus dauricus V696 trdv AXRT01016653.1 69594 TSMAQKVIQAQTEISVVENKAVTLDCVYETSDSSYYLFWYKQPSSGELTLLIRQGSYNEQNPNATEGRYSLNFQKASSSIQLTITASQLMDAAVYFCALRE
Spermophilus dauricus V697 trav AXRT01016653.1 49147 RSNGDSVTQRAGLVTLVEGASVILNCTYQATYSGYFLCWYVQYLDKAPQLLLKTATENQKTESRGFHATLVKKENSFHLQKPAVQPSDSAVYYCAVG
Spermophilus dauricus V698 trav AXRT01016653.1 38421 SSMSQKVTQDQAAISMLEKEAVTLNCAYNATSFSYYLFWYKQPPSGEVILLMDQESYREEKVTKGRFSLNLQKPVSSISLTISALELQDSAVYFCALRE
Spermophilus dauricus V699 trav AXRT01016653.1 35039 SSMSQKVTQDQAAISMLEKEAVTLNCAYNATSFSYYLFWYKQPPSGEVILLMDQESYREEKVTKGRFSLNLQKPVSSISLTISALELQDSAVYFCALRE
Spermophilus dauricus V700 trdv AXRT01016653.1 8608 FSVAQKVTQVQTATSGQEGEAVTLDCSYETGWSGYDLFWYKQLPSGEIIFLIRQSSSGANRREGHRYSVQFRREVKSISLTISPLQQEDSAKYFCALWE
Spermophilus dauricus V701 trdv AXRT01016653.1 3684 FSVAQKVTQVQTATSGQEGEAVTLDCSYETGWSGYDLFWYKQLPSGEIIFLIRQSSSGANRREGHRYSVQFRREVKSISLTISPLQQEDSAKYFCALWE
Spermophilus dauricus V702 trav AXRT01016654.1 33704 RTHGQSMTQMEGQQTMSEGSILIINCTYSSSGYAHLFWYVQYPGDGPQLLLKAMKANDKGREKGFEATYKKETTSFHLEKASIQESDSAVYYCALS
Spermophilus dauricus V703 trav AXRT01016654.1 29958 RTHGQSMTQMEGQQTMSEGSILIINCTYSSSGYAHLFWYVQYPGDGPQLLLKAMKANDKGREKGFEATYKKETTSFHLEKASIQESDSAVYYCALS
Spermophilus dauricus V704 trav AXRT01016654.1 17467 VSSQQKAVEQSPAALSVPEGAIASLNCTYSDSASQNFMWYQQYSGKGLKLLISIFSNGEKGEGRFTAQLDTARWHLFLHIRASQLSDSATYFCAL
Spermophilus dauricus V705 trav AXRT01016654.1 11099 GSGAQSVTQPDRHVLVSEGAPLQLRCSYSSSVSPYLFWYQQRPSQGPQLLLKYASGATLVTGISGFQAELRKNETSFHLRKPSAHWSDSAEYFCALG
Spermophilus dauricus V706 trav AXRT01016654.1 6645 VNSQQEEESPQVLSVQEGENATMNCSYESSTITLQWYRQDSGKGPALVILIRSNEREKHSGRLTATLDTSTKRSVLSIMASQAADTATYFCATD
Spermophilus dauricus V707 trav AXRT01016657.1 5117 WTRGESVTQTESQVTISEGSFLTINCNYSSSGYPNLFWYVQYPGDGPQLLLKAMKANDKGREKGFEATYKKETTSFHLEKASIQESDSAVYYCALS
Spermophilus dauricus V708 trav AXRT01016657.1 3480 SSFAQKVTQAQPAMWVQEKEAVNLHCSYDTSETSYGLLWYKQPSSGEMVFLFHKNSYSQQNATEGRYSVNLQKASKSIQLVISASQLGDSAVYFCALRE
Spermophilus dauricus V709 trav AXRT01016660.1 23418 GVRGQQVEQSPSALRLQEGNNSTLRCNFSITMQTVQWFQQNPGGSLISLFFLTSGTKQEGRLKGVLNFLERYSTLHISTSQLEDSGTYFCAG
Spermophilus dauricus V710 trav AXRT01016660.1 12147 MSLGNKVEQHPSTLSVQEGDSTVINCTYSDIGSVYFLWYKQEARKSLQMIIDIRSNKEINQIQRFIVVLDKKAKHFSLNITAAQRGDSAVYFCAAD
Spermophilus dauricus V711 trav AXRT01016661.1 16493 GVRGQQVEQSPSALRLQEGTSPTLRCNFSTNIYSVQWFRQNPGGSLISLFYLTSGTKQEGRLKATMNFQERYSTLHISTSQLEDSGTYLCAG
Spermophilus dauricus V712 trav AXRT01016661.1 8979 VSRGEKVEQHPSIPSTLSVQEGDSAVINCAYSDSASTYFPWYKQEVGKGPQHIIDIRSNKEINQIQRFIVVLDKKAKHFSLNITATQPGDSAVYFCAAD
Spermophilus dauricus V713 trdv AXRT01016664.1 12669 FSVAQKVIQVQPSTSGQEGGAVTLDCSYGTGWSAYNLFWYKQLPSGEIIFLIRQSSSGANEIRGRYSVQFRRATKSIKLTISPLQREDSAKYFCALWE
Spermophilus dauricus V714 trav AXRT01016668.1 74825 GVRGQQVEQSPSALRLQEGNSTTLRCNFSTNIYSVQWFRQNPGGSLRSLFFLTSGTKQEGRLKATADAKERYSTLHISTSQLEDSGTYLCAAE
Spermophilus dauricus V715 trav AXRT01016668.1 62469 SSFAQKVTQAQPAMWVQEKEAVSLLCSYDTSETNYGLLWYKQPSSGEMVFLILQNSYSQQNATEGRYSVNLQKASKSIQLVISASQLGDSAVYFCALRE
Spermophilus dauricus V716 trav AXRT01016668.1 57699 SSFAQKVTQAQPAMWVQEKEAVSLLCSYDTSDTNYGLLWYKQPSSGEMVFLILQNSYSQQNATEGRYSVNLQKASKSIQLVISASQLGDSAVYFCALRE
Spermophilus dauricus V717 trav AXRT01016668.1 44954 VHSQQKTVEQSPEALSVPEGAVASLNCTYSDSASQNFRWYQQYSGKGPKLLISIFSNGEKGEGRFTAQLDTAKRHLFLHIRGSQLSDSATYLCAV
Spermophilus dauricus V718 trav AXRT01016668.1 33736 GSGAQSVTQPDRHVLVSEGAPLQLRCSYSSSVSPYLFWYQQRPSQGPQLLLKYVSGATLVTGISGFQAELRKNETSFHLRKPSAHWSDSAEYFCALG
Spermophilus dauricus V719 trav AXRT01016668.1 32924 GSGAQSVTQPDRHVLVSEGAPLQLRCSYSSSVSPYLFWYQQRPSQGPQLLLKYVSGATLVTGISGFQAEFRKNETSFHLRKPSAHWSDSAEYFCALG
Spermophilus dauricus V720 trav AXRT01016668.1 24263 VNSQEEEESPRVLSVQEGENATINCSYKSSTTTLQWYRQDSGKGPALVILIHSNEREKHSGRLTATLEISTQRSVLSIRASQAAGAATYFCATDEQ
Spermophilus dauricus V721 trdv AXRT01016668.1 22250 TSMAQKVIQAQTAISVVEKEAVTLHCVYETSDPTYYLFWYKQLPSGELTLLIRQESYNQQNATEGRYSLNFQKASSSIQLTITASQLMDAAVYFCALRE
Spermophilus dauricus V722 trav AXRT01016668.1 8227 RINGDSVTQTAGLVTLTEGASVILNCTYQTSYLVSFLFWYVQYPDKAPQLLLKSATENQRTVSQGFHATLVKKENSFHLQKPAVQPSDSAVYYCAVG
Spermophilus dauricus V723 trav AXRT01016670.1 16256 VSRGEKVEQRPSTLSVQEGDSTVINCTYSDSALIYFPWYKQEAGKGPQLIIDIRSNKEINQIQRFIVVLDKKAKHFSLNITATQPGDSAVYFCAAD
Spermophilus dauricus V724 trav AXRT01016670.1 10815 SSFAQKVTQVQPAMWVQEKEAVSLLCSYDTSETSYGLLWYKQPSSGEMVFLILQNSYSQQNATEGRYSVNLQKASKSIQLVISASQLGDSAVYFCALRE
Spermophilus dauricus V725 trav AXRT01016671.1 33378 FSQGEKVEQRPSTLSVQEGDSAVINCTYSDSALDYFPWYKQEAGKGPQHIIDIRSNKEINQIQRLIVVLDKKAKHFSLNITATQPGDSAVYFCAAS
Spermophilus dauricus V726 trav AXRT01016671.1 27169 SSFAQKVTQAQPAMWVQEKEAVSLLCSYDTSDTNYGLLWYKQPSSGEMVFLILQNSYSQQNATEGRYSVNLQKASKSIQLVISASQLGDSAVYFCALRE
Spermophilus dauricus V727 trav AXRT01016671.1 25164 RTHGNSVTQTEGQVILSEGALLTINCTYSTTGYPTLFWYVQYPGEGPQLLFRVSRSNEKGSNKGFKAIYKKETTSFHLEKASIQESDSAVYYCALG
Spermophilus dauricus V728 trav AXRT01016671.1 16713 GVRGQQVEQSPSALRLQEGNSTTLRCNFSTTMNRVQWFQQNPGGSLRSLFFLTSGTKQEGRLKATADAKERYSTLHISTSQLEDSGTYLCAM
Spermophilus dauricus V729 trav AXRT01016672.1 1876 FSQGEKVEQRPSTLSVQEGDSAVINCTYSDSALDYFPWYKQEAGKGPQHIIDIRSNKEINQIQRLIVVLDKKAKHFSLNITATQPGDSAVYFCAAD
Spermophilus dauricus V730 trav AXRT01016677.1 12386 RIRGDSVTQMEGQVTMSEGALLTINCTYSATTSGYPTLFWYVQYPGEGPQLLLKAVKANDKVSNKGFEATYNKEASFFHLEKASIQESDSAVYYCALS
Spermophilus dauricus V731 trav AXRT01016677.1 6431 GVRGQQVEQSPSALRIQEEASSTLMCNFSTTMNRVQWFLQNPGGGLISLFFLTPGTKQEGRLKATMNFQERYSTLIISTSQLEDSGIYLCAAE
Spermophilus dauricus V732 trav AXRT01016678.1 10457 GVRGQQVEQSPSALRIQEGTSPTLRCTFSTSMQSVQWFRQNPGGGLINLFFLASGTKQEGRLKATMDPKERYSTLHITPSQLDDSGTYLCAAE
Spermophilus dauricus V733 trav AXRT01016681.1 19841 SASSYFPWYKQEVGKGPQHIIDIIINCTNSDSASSYFPWYKYKQEVGKGPQHIIDIISNKEINQIQRFIVVLDKRAKHFSLNITAAQPGDSAVYFCAAR
Spermophilus dauricus V734 trav AXRT01016681.1 13310 SSFAQKVTQAQPAMWVQEKEAVSLLCSYDTSETNYGLLWYKQPSSGEMVFLILQNSYSQQNATEGRYSVNLQKASKSIQLVISASQLGDSAVYFCALRE
Spermophilus dauricus V735 trav AXRT01016684.1 16080 VKGGNQMEQSPPSLRLWEGDSTSMSCTHSLSVFNGLQWYRQDSGTGLGHLFSMYSAGDVQQKGRLRAMLLKGGSSLNITAVQHGDSATYLCAV
Spermophilus dauricus V736 trav AXRT01016684.1 7715 GVRGQQVEQSPSALRLQEGTSSTLRCNFSTTIYSVQWFLQNPGGGLINLFYLTSGTKQEGRLKATADAKERYSTLHISTSQLEDSGIYLCAAE
Spermophilus dauricus V737 trav AXRT01016685.1 4636 VSRGEKVEQHPSFLSVREGDSAVTHCTYTDSASTYFFWYKHEPGAGLQLLMQILSNMEKKQDQRLTVLLSKKDKHLSLNITAANPRDSATYFCAAR
Spermophilus dauricus V738 trav AXRT01016686.1 13889 TLSLAKTTQRISMDAYEGQEVNISCNHTNIATNEYIFWYRQVPHQEPHFVIQGYKTNVANEVASLFIPVDRKSSTLSLHRVTLRDSAVYYCTVG
Spermophilus dauricus V739 trav AXRT01016686.1 2603 GVRGQQVEQSPSALRLQEGASTTLRCNFSATMTSVQWFLQNPGGSLISLFYLTSGTKQEGRLKVTADAKERYSTLHISTSQLEDSGTYLCAAE
Spermophilus dauricus V751 ighv AXRT01023754.1 1272 VLCQVQLQESGPGLVKPSQTLSLTCAVSGFSITTGSYRWSWIRQPPGKGLEYIGHIWSDGDTNYSPSLKSRVSISRDTSKNQFSLQLSSLTTEDTATYYCAR
Spermophilus dauricus V752 ighv AXRT01023755.1 5034 VQCEVQLVESGGGLVQPGGSLRLSCAASGFTFSDYDMDWVRQAPGKGLEWVGEINPSGGSTYYLDSVRGRFTISRDNSKNTLYLQMSSLRAEDTATYYCAR
Spermophilus dauricus V784 igkv AXRT01033468.1 1852 SSGDTVMTQTPLSLSVIPGEPASVSCRSSQSLLHNDGNTYLSWYQQKPGQAPKLLIYEVCKCFSGASDRFSGSGSGTEFTLRISRVEAEDAGVYYCFQSTWIP
Spermophilus dauricus V811 igkv AXRT01043793.1 61202 VRCDIMMIQSPSSLPVSLGDRVTLTCRASQGISHNLHWYQQKPGEAPKLLIKYANTLKSRVPSSFSGSGYGTDFTPPISSLEPEDVANYYCI
Spermophilus dauricus V812 igkv AXRT01043793.1 47205 VRCDIQMTQPTSSLSASLGDRVTITCRASQSIGYALSWYQQKPGKASKLLIYAANSLQSGVPSRFSGSGSGTDFTRTISSLEPEDFATYYCQQYNGYP
Spermophilus dauricus V813 igkv AXRT01043793.1 32134 ARCDITMTQSLSSLSKSLGDRVTIMCQASQSISNYLNWYQHKPGQFPKRLIYGASNLQSGIPLRISGSGSGTDFTLISSSLEPEDAATYFCLQDTVPL
Spermophilus dauricus V832 igkv AXRT01052786.1 3731 SIGNTVMTQSPLSLSITTGQPASISCRSSQSLLHSNGNTYLHWVVHKPGQAPQSLIYKVSNQYTGVPDRFSGSGSGTDFTLRISRVVAEDAGVYYCLQ
Spermophilus dauricus V845 igkv AXRT01056760.1 12627 TCGDIVMTQTPLSEPVTPGQSASISCRSSQSLLHSDGNTYLYWVVHKPGQAPQGLIYWVSNRYTGVSDRFSGSGSGTDFTLKISRVEPEDAGVYYCWQGIQNP
Spermophilus dauricus V846 igkv AXRT01056762.1 920 SIGDVVQTQTPLSELITPGQPASISCRSSQSFLHSNGNTYLHWVVHKSGQAPQGLICGVYNWYTGVPDRFSGRGSETDFKLRISRVEPEDAGVYYCWQAKEYP
Spermophilus dauricus V847 igkv AXRT01056764.1 50914 TSGDIVLTQTPLSEPVTPGQSASISCRSSQSLLQSNGNTYLHWVVHKPGQAPWGLIYRVSNQNTGVPDRFSRTGAGSDFTLKIIKVEPDNAGIYYCHQDKEYP
Spermophilus dauricus V848 igkv AXRT01056764.1 25906 TSGDIVMTQTPLFEPITPGQSASISCRSSQSLLHNNVNTYLNWVVHKPGQAPWGLIYLVSNHNTGGPDRFSGSGPGSDFILRISSVKSDDAGIYYCVQG
Spermophilus dauricus V849 igkv AXRT01056764.1 23685 TSGDIVMTQTPLFEPITPGQSASISCRSSQSLLHNNVNTYLNWVVHKPGQAPWGLIYLVSNHNTGGPDRFSGSGPGSDFILRISSVKSDDAGIYYCVQG
Spermophilus dauricus V850 igkv AXRT01056766.1 1641 TSGDVVLTQTPLSEPVTPGKSASISCRSSQSLLDSNGYTYVSWVVHKPGQAPQGLIYKVSNRVSGVSDRFSGSGSGTDFTLRISKVEPEDAGVYYCWQG
Spermophilus dauricus V851 igkv AXRT01056768.1 12129 TSGDIVMTQTPLSEPVTPGQSVSLSCRSSQSLLYSDGKTYLSWVVHKPGQAPQGLIYLASNRVSGVPERFSGSGSGTDFTLRISRVEPEDTGIYFCGQTLQNP
Spermophilus dauricus V852 igkv AXRT01056768.1 6431 TSGDVVLTQTPLSVPITPGQPASISCRSSQSLLHSNGKTYLHWVVHKPGQAPQGLIYEVSNRHTLVSERFSGSGSGTDFTLRISRVEPDDAGVYYCWQE
Spermophilus dauricus V863 iglv AXRT01060230.1 3396 TVASYVLTQPSSVSVTPGQTARITCEGNSIDSYRVHWYQQKPAQAPVLLIYSSSNRPSGIPDRFSGSNSGNTATLTISGAQAGDEADYYCQVWNYPV
Spermophilus dauricus V864 iglv AXRT01060232.1 2660 SWSQSALTQPPSASGSAGQTVTISCTGTSNDIGRYNYVSWYQNLPGSSPTLLIYRVTNRPSGIPDRFSGSKSGNTASLTISRLQPEDEADYYCCS
Spermophilus dauricus V870 igkv AXRT01061867.1 9118 ARCDITMTQSPSSLSASPGDRVTITCRASQNINSWLAWYQQKPGQAPKLLIYKASSLQSGVPSRFSGSGSGTDYTLTISSLEPEDVASYYCQQYNSWP
Spermophilus dauricus V876 ighv AXRT01062543.1 2106 VQCEVQLVESGGGLVQPGGSLRLSCAASGFTFSSYWMSWVRQAPGKGLEWISSIYTGGSTYYADSVTGRFTISRDNSKNTLYLQMSSLRTEDTATYYCAR
Spermophilus dauricus V877 ighv AXRT01062544.1 41634 VLCQVQLQESGPGLVKPSHSLSLTCAVSGFSITTSGYYWSWIRQPPGKGLEWIGRIWYDGDTNYSPSLKSRASISRDTSKNQFSLQLSSLTTEDTATYYCAR
Spermophilus dauricus V878 ighv AXRT01062544.1 37189 VQCEVQLVESGGGLVQPGGSLRLSCAASGFTFSNYWMSWIRQAPGKGLEWVGEINQNGGTTNYVDSVRGRFTISRDNSKNTLYLQMSSLRTEDTATYYCAR
Spermophilus dauricus V879 ighv AXRT01062544.1 14749 VQCEVQLVESGGGLVQPGGSLRLSCAASGFTFSSYNMHWVRQAPGKGLEWVARIKNKANSYSTAYAASVKDRFTISREDAKNTLYLQMSSLRTEDTATYYCA
Spermophilus dauricus V880 ighv AXRT01062544.1 1438 VQCEVQLVESGGGLVQPGGSLRLSCAASGFTFSSYWMNWVRQAPGKGLEWISSINTGGSTYYADSVTGRFTISRDNSKNTLYLQMSSLRTEDTATYYCAG
Spermophilus dauricus V881 ighv AXRT01062548.1 1189 VQCEVQLVESGGGLVQPGGSLRLSCAASGFTFSDNWMNWVRQVPGKGLEWVSRISTGGSTYYADSVRGRFTISRDNSKNTLYLQMSSLRTEDTATYYCAR
Spermophilus dauricus V882 ighv AXRT01062549.1 8900 VQCEVQLVESGGGLVQPGGSLRLSCVASGFTFSDYGMSWVRQAPGKGLEWVARIKNKANSYSTAYAASVKDRFTISREDSKNTLYLQMSSLRTEDTATYYCA
Spermophilus dauricus V883 ighv AXRT01062550.1 4118 VQCEVQLVESGGGLVQPGGSLRLSCAASGFTFSSYGMNWVRQAPGKGLEWISGISDGGSTYYADSVKGRFTISRDNSKNTLYLQMSSVRAEDTATYYCAR
Spermophilus dauricus V884 ighv AXRT01062553.1 22458 VQCEVQLVESGGGLVQPGGSLRLSCAASGFTFSDNWMSWVRQAPGKGLELVGQINPSGGSTYYPDSVKDRFTISRDNSKNTLYLQMSSLRVEDTAIYYCAR
Spermophilus dauricus V885 ighv AXRT01062553.1 12768 VLCQVQLQESGPGLVKPSQTLSLTCAVSGFSITSGYCWHWIHQPPGKGLEWIGYICSSGSTYYSPSLKSRVSISRDTSKNQFSLQLSSLTTKDTATYYCAR
Spermophilus dauricus V886 ighv AXRT01062553.1 7456 VQCEVQLVESGGGLVQPGGSLRLSCAASGFTFSSYYMSWVRQAPGKGLEWVGQIYPGSGSTYYPDSLRGRFTISTDNSKNTLYLQMSSLRAEDTATYYCTR
Spermophilus dauricus V887 ighv AXRT01062555.1 5622 VLCQVQLQESGPGLVKPSQTLSLTCAVSGFSITTGSYGWSWIRQPPGKGLEYIGYIWSNGNTYYSPSLKSRVSISRDTSKNQFSLQLSSLTTEDTATYYCAR
Spermophilus dauricus V888 ighv AXRT01062555.1 324 VQCEVQLVESGGGLVQPGGSLRLSCAASGFTFSDNWMSWVRQAPGKGLEWVGQINPSGGSTYYPDSVKDRFTISRDNSKNTLYLQMSSLRTEDTATYYCAR
Spermophilus dauricus V889 ighv AXRT01062561.1 18395 VLCQVQLQESGPGLVKPSQTLSLTCAVSGFSITTSGYCWYWIRQPPGKGLEWISRICYDGSTNYSPSLKIRVSIARDTSKNQFSLQLSSLTTEDTATYYCAR
Spermophilus dauricus V890 ighv AXRT01062565.1 67394 VLCQVQLQESGPGLVKPSQTLSLTCAVSGFSITTSGYCWDWILQPPGKGLEWIGEICSGGNTYYSPSLKSRVSISRDTSKNQFSLQLSSLITEDTATYYCA
Spermophilus dauricus V891 ighv AXRT01062565.1 54266 VLCQVQLQESGPGLVKPSQTLSLTCVVSGFSITSGYCWDWIRQPPGKGLEWISRICYDGSTAYSPSLKSRVSTSRDTSKNQFSLQLSSLTTQDTATYYCAR
Spermophilus dauricus V892 ighv AXRT01062565.1 41081 VQCEVQLVESGGGLVQPGGSLRLSCAASGFTFSDYGMSWVRQAPGKGLEWISGISDGGSNTYYANSVKGRFTISRDNSKNTLYLQMSSLRTEDTATYYCAR
Spermophilus dauricus V893 ighv AXRT01062565.1 34568 VLCQVQLQESGPGLVKPSQTLSLTCAVSGYSITTSGYCWEWIRQPPGKGLEYIGYIWSDGDTYYSPSLKSRVSISRDTSKNQFSLQLSSLNTQDTATYYCAR
Spermophilus dauricus V894 ighv AXRT01062565.1 28517 ILCQVQLQESGPGLVKPPQTLSLTCAVSGFSITTSGYGWSWIHQPSGKGLEYIGLIWYDGDTNYTPSLKSRVSISRDTSKNQFSLQLSSLTTEDTATYYCAR
Spermophilus dauricus V895 ighv AXRT01062565.1 7248 VQCEVQLVESGGGLVQPGGSLRLSCAASGFTFSDYYMDWVRQAPGKGLEWISYISGGSSDINYVESVKGRFTISRDNSKNTLYLQMSSLRTEDTATYYCAR
Spermophilus dauricus V896 ighv AXRT01062567.1 3866 VLCQVQLQESGPGLVKPSQTLSLTCAVSGYSITSGYCWSWIRQPPGKGLEYIGYICSGGSTNYSPSLKSRVSISRDTSKNQFSLQLSSLTSEDTATYYCAR
Spermophilus dauricus V918 igkv AXRT01070719.1 36088 ARCDITMTKSPSSLSVSPGDRVTITCRASQSINSWLVWHQWKPGKAPKCLIYKASNLQSGVPSRFSGSGSGTDYTLTISSVDPEDVATYYCQQP
Spermophilus dauricus V919 igkv AXRT01070721.1 10684 SSGDVVLTQTPLTVPITPGQSASISCRSSQSLLYSDGKTYLEWHQQNPCQSPKLLIYEVSNGLTGVPDRFSGSGSGTDFTLRISRVEAEDAGVYYCGQF
Spermophilus dauricus V942 ighv AXRT01078294.1 1464 VQCEVQLVESGGGLVQPGGSLRLSCAASGFTFSSYGMNWVRQAPGKGLEWISGISDGGSTYYADSVKGRFTISRDNSKNTLYLQMSSVRAEDTATYYCAR
Spermophilus dauricus V967 igkv AXRT01085708.1 3812 TSGDIVMTQTPLSEPVTPGQSVSLSCRSSQSLLHSDGKTYLSWVVHKPGQAPQGLIYLASNHVSGVPERFSGRGSGTDFTLRISRVEPEDAGLYYCCQDIQAP
Spermophilus dauricus V974 igkv AXRT01089499.1 19640 AKCDITMTQSPTSLSKSQGETVTIRCQASQGISNYLNWYQQKPGQAPKLLIYYTNRLQSGVPSRFSGSGSGTDYSLTISSLEPEDFATYYCQQYDERP
Spermophilus dauricus V975 igkv AXRT01089499.1 7313 AKCDITMTQSPTSLSKSQGETVTITCRASQGISNYLNWYQQKPGQAPKPLIYYTNRLQSGVPSRFSGSGSGTDYSLTINSLEPEDFATYYCQQNYELP
Spermophilus dauricus V1016 igkv AXRT01098395.1 12768 VRCDITMTQSPSSLPASPGERVTITCRVSQGIGNSLQWYQQKPGQAPKLLIYRANTLQSGVPSMFSGSGYGTDFTLTISSQEPEDTATYYCQQSWDYP
Spermophilus dauricus V1017 igkv AXRT01098395.1 3322 VRCDIMITQSPLSLPVSCGDKVTITCRASEDIGDYLYWYQQKPGQAPKLLMDLVTGLRSGAPSRFSGTGFGTDFTLTISSLEPEDVATYYCQWHNSYP
Spermophilus dauricus V1018 igkv AXRT01098396.1 2118 VRCDITMTQSPSSLPASPGERVTITCRVSQGIGNSLQWYQQKPGQAPKLLIYRANTLQSGVPSMFSGSGYGTDFTLTISSQEPEDTATYYCQQSWDYP
Spermophilus dauricus V1019 igkv AXRT01098397.1 35415 VRCDITMTQSPSSLPVSCGDKVTITCRASQNINSWLAWYQQKPGRDPKLLIYGASNLQPGVPLRFSGSGSETDFTLTISSLEPEDFGTYYCQQYNCSP
Spermophilus dauricus V1027 igkv AXRT01100946.1 18746 IVLTQTPASVPLSPGEKPTLTCRASQSVGSYLTWYQEKPGQAPKCLIYGVSSRASGIPAWFSGSWSGTDYSLFIRCLEPGDAAVYYCVQGYTD
Spermophilus dauricus V1028 igkv AXRT01100948.1 19002 TTGEIVLTQTLASVALSPGKRATLTCRASQSVGSSLDWYQQKPGKAPRCLIYCSFSRASGVPARFSDNGSGTDYTLSISSLEPQDAAVYYCCK
Spermophilus dauricus V1034 iglv AXRT01101712.1 1886 SVVSYELTQPPSVSVALGQTATITCSGDALPKKYAYWFQQQHPGQTPVRIIYKDSERPSGIPERFSGSSSGTTATLTISRTQTEDEAVYYCLSWNSDGTQ
Spermophilus dauricus V1035 iglv AXRT01101715.1 8439 SVATYVLTQPSSVSVTPGQAARITCEGNSIGSYSVHWYQQKPAQSPLLIIYNDNNRPSGIPDRFTGSNSGNTATLTIGGAQAGDEADYYCQVWDRSA
Spermophilus dauricus V1036 iglv AXRT01101716.1 1946 SVATYVLTQPSSVSVTPGQAARITCEGNSIGSYSVHWYQQKPAQSPLLIIYNDNNRPSGIPDRFTGSNSGNTATLTIGGAQAGDEADYYCQVWDRSA
Spermophilus dauricus V1037 iglv AXRT01101722.1 1958 SVASYVLTQPSSVSVTPGQTARITCGGNNIGSKYVYWYQQKPAQSPLLIIYEDSKRPSGIPDRFSGSNSGNTATLTISGAQAGDEADYYCQVWDGNA
Spermophilus dauricus V1038 iglv AXRT01101723.1 13847 FWAQSALTQPPSVSGTPGQSVTISCAGTSSDIGKYNEVSWYQNRPGTTHKLMIYGVSSRPSGIPDRFSGSKSGNTASLTISGLQLEDEADYYCCSYAGNYN
Spermophilus dauricus V1039 igkv AXRT01102032.1 1497 ARCDITMTQSPSSLSASPGDRVTITCRASQNINSWLVWYQQKPGQAPKRLIYKASNLQSGVPSRFSGSGSGTDYTLTITSMDPEDVATYYCQQHNSYP
Spermophilus dauricus V1052 trgv AXRT01106778.1 36941 GLGLSKVEQSEISISKEIKKSVSISCKISSTSFDTEVIHWYWKKPNKTVEHLIQVTSIKSPARGSLNGKGNKIEAKKYSQTSSSVLTIFSIEKEDAAMYYCAGW
Spermophilus dauricus V1057 igkv AXRT01107880.1 2805 SGSRCDIQMIQSRSSLLASQGDRVTLTCRASQGISNNLHWYQQKPGQAPKVLIRYANTFQSGVPSRFSGSGSGTDVTLTIRSLKPEDGAIYFCQQG
Spermophilus dauricus V1058 igkv AXRT01107883.1 134166 SSGDVVLTQSSLSVPVTPGQSASISCRSSQSFLYSDGNTYLHWYLHKPGQAPKLLIYTVSDWFTGVPDRFSGSGSGTEFTLRISSVEAEDAGVYYCFQNIHFP
Spermophilus dauricus V1059 igkv AXRT01107883.1 95941 VRCDITMTQSPSSLPVSRGDRVTITCRASQGISSWLAWYQQKPGQAPKLLIYGASNLQSGVPSRFSGSGSGTDFTLTISSLEPEDVANYYCVQGSSYP
Spermophilus dauricus V1060 igkv AXRT01107883.1 90614 TTGEIVLTQTPASVALSPGERATLTCKAIQSVSSYIAWYQQKPGQAPRCLIYGASSRASSIPTRFSGSGSGIDYTFSISSLEPGDAAVYYCL
Spermophilus dauricus V1061 igkv AXRT01107883.1 79364 VRCDITMTQSPSSLPVSRGDRVTITCRASQGISSWLAWYQQKPGRAPKLLIYDASNLQPGVPSRFSGSGSGTDFTLTISSLEPEDFGTYYCQQYDGSP
Spermophilus dauricus V1062 igkv AXRT01107883.1 30041 VRCDITMTQSPSSLPVSPGDRVTITCRVSQGIGNSLQWYQQKPGQAPKLLIYRANTLQSGVPSMFSGSGSGTDFTLTISSQEPEDTATYYCQQSWDYP
Spermophilus dauricus V1063 igkv AXRT01107883.1 19254 VRCDIMITQSPLSLPVSRGDKVTITCRASEDIGDYLYWYQQKPGQAPKLLMDLVTGLRSGVPSRFSGSGFGTDFTLTISSLEPEDVATYYCQGHNSYP
Spermophilus dauricus V1064 igkv AXRT01107885.1 23199 ARCDITMIQSPSSLSASPGDRVTITCRASQNINSWLAWYQQKPGQAPKLLIYKASSLESGVPSRFSGSGSGTDYTFTISSMEPEDAATYYCQQGSNLP
Spermophilus dauricus V1065 igkv AXRT01107888.1 2213 AGCDITMTQSLSSLSKSLGDRVTIMCQASQSISNYLNWYQHKPGQFHRRLIYGASNLQSGVPLRISGSGSGTDFTLISSSLEPEDAATYFCLQDTVPL
Spermophilus dauricus V1066 igkv AXRT01107889.1 7460 VRCDITMTQSPSFLPVSLGDRVTLTCRARQGISNNLHWYQQKPGEAPKLLIKYANTLKSGVPSRFSGSLSGTDFTLTISSLEPEDVANYYCLQDYSSL
Spermophilus dauricus V1067 igkv AXRT01107893.1 41153 SSSRCDTTMTQSPSSLSKSQGDRVAISCKASQSIGSAVAWYQQKAGQTPNLLIYRATSLQPGVPSRFSGSGSGTDFTLIISSLEPEDAATYYCQLDYN
Spermophilus dauricus V1068 igkv AXRT01107893.1 15002 ARCDITMTQSPSSLSVSPGDRVTITCRASQSINNWLAWYQQKPGQAPKLLIRYATRLESGVPSRFSGSGSGTDYTLTIRSLEPEDVANYFCQQYDELP
Spermophilus dauricus V1069 igkv AXRT01107894.1 3482 SSSRCDTTMTQSPSSLSKSQGDRVAISCKASQSIGSAVAWYQQKAGQTPNLLIYRATSLQPGVPSRFSGSGSGTDFTLIISSLEPEDAATYYCQLDYN
Spermophilus dauricus V1070 igkv AXRT01107896.1 25825 ARCDIMMTQSPSSLSASPGDRVTITCRASQNINSWLAWYQQKPGQAPKCLIYKASNLQSGVPSRFSGSGSGTDYTLTISSLEPEDVATYYCVQGYSSP
Spermophilus dauricus V1071 igkv AXRT01107896.1 9001 VRCDITMTQSPSFLPVSRGDRVTLTCRASQGISNYLHWYQQKQGQAPKLLIRYANTLESGVPSRFSGSGSGTDFTLTINSLEPEDVATYYCQQGNSYP
Spermophilus dauricus V1072 igkv AXRT01107903.1 36391 ASGSPGLTQSPDSLTVSGGGSASITCIANESISDYLTWYQQKPGQAPKILIYDADNLWSGVSDRFSGKQSGTEFILKISRVEAEDAASYYCQQDYAVP
Spermophilus dauricus V1073 igkv AXRT01107903.1 14020 YNGDNVMTQTPLSLSVTPGQPASISCRSSQSLLHSDGNSYLSWYMQRPGHSPRLLIYMASNRASGVPDKFSGSGSGTDFTLKISRVEAEDVGVYYCQDGLYF
Spermophilus dauricus V1090 ighv AXRT01112660.1 2542 VQCEVQLVESGGGLVQPGGSLRLSCAASGFTFSDYYMHWVRQAPGKGLEWISRISDGGSDINYVDSVRGRFTISRDNSKNTLYLQMSSLRAEDTATYYCGR
Spermophilus dauricus V1091 ighv AXRT01112661.1 68354 VLCQVQLQESGPGLVKPSQTLSLTCAVSGFSITTSGYRWSWIRQPPGKGLEWIGGIRNDGDTKYNPSLKSRVSISRDTSKNQFSLQLSSLTTEDTATYYCAR
Spermophilus dauricus V1092 ighv AXRT01112661.1 56692 VLCQVQLQESGPGLVKPSQTLSLTCAVSGFSITTSGYGWNWIRQSPGKGLEWIGYIISGGSTNYSPSLKSRVSISRDTSKNQFSLQLTSLTSEDTATYYCAR
Spermophilus dauricus V1093 ighv AXRT01112661.1 51703 VQCEVQLVESGGGLVQPGGSLRLSCAASGFTFSDNWMSWVRQAPGKGLELVGQINPSGGSTYYPDSVKDRFTISRDNSKNTLYLQMSSLRVEDTAIYYCAR
Spermophilus dauricus V1094 ighv AXRT01112661.1 24587 VLCQVQLQESGPGLVKPSQTLTLTCAVSGFSITTSGYCWEWIRQPPGKGLEWIWEICSGGSTNYSPSLKSRVSISRDTSNNQFSLQLSSLTTEDTATYYCAR
Spermophilus dauricus V1095 ighv AXRT01112661.1 8874 VLCQVQLQESGPGLVKPSQTLSLTCAVSGFSITTSGYCWEWIRQPPGKGLEWIGRICYGGSTYYNPSLKNRVSISRDTSKNQFSLQLSSMTIEEKATYYCVR
Spermophilus dauricus V1096 ighv AXRT01112661.1 6903 VQCEVQLVESGGGLVQPGGSLRLSCAASGFTFSSYWMSWVRQAPGKGLEWISSIYTGGSTYYADSVTGRFTISRDNSKNTLYLQMSSLRTEDTATYYCAR
Spermophilus dauricus V1114 igkv AXRT01120174.1 1573 TSGDIVMTQTLLSELIIPGQPASISCMSSQSLLHSNGNTYLYWFLHKPGQASWGLTYKVSKWFTGVSDRLSGSGSGTDFTLRISRVEAEDAGVYYCM
Spermophilus dauricus V1137 trdv AXRT01126026.1 4521 VCLEIILEPDTKTLTVLVGKPATFRCRVTGGDLKNYQMSWYKKNEDNSLFLIYKLNNSMGNLRNNLKGKIDTLKSEFILDIQKTTPQDAGTYYCGSD
Spermophilus dauricus V1154 trbv AXRT01132472.1 115726 TRAQTIHQWPTSKVQLVGSPLSLECTVKGASNPNLYWYRQTAGGALHQLFYSVSVGQVDPEMFQNLSASRPQSGQFFLSSKKLLLEDSGFYFCAWS
Spermophilus dauricus V1177 igkv AXRT01139493.1 16069 AKCDITMTQSPSSLSKSQGETVTISCQASQGINSYLNWYQQKPGQAPKLLIYYTNQLQSGVPSRFSGSGSGTDYSLTISSLEPEDVADYYCQQSNSSP
Spermophilus dauricus V1178 igkv AXRT01139494.1 66729 AKCDITMTQSPTSLSKSQGETVTIRCQASQGISNYLNWYQQKPGQAPKLLIYYTNRLHSGVPSRFSGSGSGTDYSLTISSLEPEDFATYFCQQDYSSP
Spermophilus dauricus V1179 igkv AXRT01139497.1 32379 AKCDITMTQSPSSLSKSQGETVTIRCQASQGIDNELSWYQQKPGEALKLLIYETNHLQSGVPLRFSGRGRGTDYSLTISSLEPEDVATYFCQQG
Spermophilus dauricus V1207 iglv AXRT01147877.1 106803 SFSQLVLTQPPSASASLGQTAKLTCTLSSGYNSYWVAWYQQSPGKSPRFVMRVGTSGIVGSKGDGIPDRFSGSGSGLDRYLTIQNIQEEDENVYYCGADY
Spermophilus dauricus V1208 iglv AXRT01147877.1 102140 SLSQPVLTQQPSLCIPGASARLTCSLSSGFRVDNSLISWYQQKPENPPHYLLSYYSDSVKDKGSEVPNRFSGSKDASANAGILLISDLQPEDEAGYYCA
Spermophilus dauricus V1209 iglv AXRT01147877.1 98367 SLSQPVLTQQPSLCIPGASARLTCSLSSGFRVDNSLISWYQQKPENPPHYLLSYYSDSVKDKGSEVPNRFSGSKDASANAGILLISDLQPEDEAGYYCA
Spermophilus dauricus V1210 iglv AXRT01147877.1 48615 SFSQLVLTQPPSASASLGQTAKLTCTLSSGYNSYWVAWYQQSPGKSPRFVMRVGTSGIVGSKGDGIPDRFSGSGSGLDRYLTIQNIQEEDENVYYCGANY
Spermophilus dauricus V1211 iglv AXRT01147877.1 43838 SLSQPVLTQQPSLCIPGASARLTCSLSSGFRVDNSLISWYQQKPENPPHYLLSYYSDSVKDKGSEVPNRFSGSKDASANAGILLISDLQPEDEAGYYCA
Spermophilus dauricus V1212 iglv AXRT01147882.1 42516 SFSQPVLTQPPSASASLGQTAKLTCTLSSGYSSYWVVWFQQSPGKSPRFVMRVGISGIEGSKGDGIPDRFSGSGSGLDRYLTIQNIQEEDENVYHCG
Spermophilus dauricus V1221 igkv AXRT01151324.1 12854 VRCDITMTQSPSSLSASQGDRVTITCRASQGISNYLHWHQQKPGQALKLLIRYANTLQSGVPSRFIGSRSGTDFTLTISILEPEDVADYYCQQSNSYP
Spermophilus dauricus V1222 igkv AXRT01151961.1 2486 VKMGTALTQSPALLDVYPWERTTITCTTNPKESSKFSWYQQKPGQAPKLLVHDTSTLASGVPARFSGSHLGADFTLTISNVETNDAGTYYCIEYPG
Spermophilus dauricus V1223 igkv AXRT01151963.1 7279 VRYDITVTQSPSSLPVSLGDRVTITCRASQSISSYLHWYQQKPGQAPKLLIYGANTLESGVPSRFSGSGSRTDFTLTISSLEPEDVATYYCQQGSSFP
Spermophilus dauricus V1226 igkv AXRT01153396.1 550 VRCYITMTQSPSSLPVSREDRVTLTCRASQGFCSNLNWYQKKPGQAPKLLIYLAISLQSGVPSRFSGSGSGTDFTLTISSLEPEDVANYYCQQGSSSP
Spermophilus dauricus V1229 igkv AXRT01158366.1 25890 AKCDITMTQSPSSLSKSQGETVTISCQASEGINSYLSWYQQKPGQAPKLLIYYTNRLQTGVPSRFSGSGSGTDYSLTISSLEPEDFATYYCQQYRSYS
Spermophilus dauricus V1234 igkv AXRT01166259.1 543 VRCYITMTQSPSSLPVSHEDRVTLTCRTSQGIRSNLHWYQQKPGQAPKLLIYLAISLQSGVPSRFSGSGSGTDFTLTISSLEPEDVANYYCQQGSSSL
Spermophilus dauricus V1236 igkv AXRT01169850.1 9917 VRCDITMTQSPSSLPVSSGDRVTITCRSSQGISNYLYWYQQKPGQADKLLIYYVTSVESGVSPRFSGSGSGTDFTLTIISLEPEDAATYFCLQ
Spermophilus dauricus V1237 igkv AXRT01169850.1 853 SSGDTVMTQTPLSLSVIPGEPASVSCRSSQSLLHNDGNTYLSWYQQKPGQAPKLLIYKVSNRFTGVPDRFSGSGSGTEFTLRISRVESEDAGVYYCLQGTWTP
Spermophilus dauricus V1238 igkv AXRT01172527.1 416 VRCDITMTQSPSSLPVSRGDRVTINCRASQGISNYLHWYQQKPGRAPKLLITYATTLQSGVPSRFSGSGSGTDFTLTISSLEPEDVADYYCQQSYSYP
Spermophilus dauricus V1239 iglv AXRT01348107.1 459 SWAQSVLTQQPSLSGTPGQKVTISCTGSSNNIGSYDVQWYQQIPEMAPKLLIYYNSNRYSGVPDRFSGSKSGKSASLTITGLQPEDEADYYCESYESSLS
Spermophilus dauricus V1245 trgv AXRT01458391.1 742 SDTSSSLERGMMSVISQPGSYVPITCDFNKASNYIHWYQFKEGQAPRHILYYNFLQSKVVVSSGIISGKYNAIKGPDGRCIFVVQNVEESDSAVYYCAYWT