WGS Statistics
Organism WGS Record. Vs Total IGHV IGLV IGKV TRAV TRBV TRGV TRDV
Tympanoctomys barrerae NDGN000000000.1 (NDGN01) 230 78 31 54 24 21 13 9
Vgene Table
Organism Vgene Locus contig Contig Pos. AA sequence
Tympanoctomys barrerae V1 igkv NDGN010055322.1 215 SQGDVVLTQTLLSLSVSPGETASISCRSSQSLVHSNGNTYLNWVVLKPGESPWSLLYQVSRKYSGVPDWISGSGAGTDFTLTISRVKAEDTGVYYCWQNTHAP
Tympanoctomys barrerae V4 ighv NDGN010080648.1 772 VEADVQLLESGGGLVQPGAALRLSCVGSGFTFSSYAMHWICQAPGKGLEWISSVSQTAKKIFYADSVKGRFTISRDNDKNTVYLQMSNLKTEDMAVYYCTR
Tympanoctomys barrerae V5 iglv NDGN010082563.1 1380 SWAQSSLTQRPSVSGSPGERITISCDGTSSNIGSYSGISWYQKHPGTLHKLLIYDTSSRPSGVPDRFSGSKSGNTASLTISGLQPEDEADYYCCSYAGS
Tympanoctomys barrerae V7 igkv NDGN010097024.1 94 ARCDIQMTQSPSSISASVGDRVTIKCSASQGISIWLAWYQQKPGKAPKLLIYRATNLASGVPSRFSGSGSGTDFTLTISGLEPEDVATYYCQKYNSSP
Tympanoctomys barrerae V16 trbv NDGN010147852.1 4264 HLEARISQSPRHKVMKIKEKLTLKCHQTDNHNSMYWYRQDPGHGLRLIHSSYGVKTLEKGEVADEYNVSREKIEDFPLTLESATLSQSSVYFCASRV
Tympanoctomys barrerae V17 igkv NDGN010161081.1 728 STGDAVLTQSPLSLSVTPGESASITCRSSQSLLYSDGKTYLDWIVHKPGQAPQGLIYLVSSRYPGISDRISGSGSGTDFTLTISRVEADDAGVYYCFQE
Tympanoctomys barrerae V26 ighv NDGN010222069.1 717 VQAEERLLESGGGLVLPGGSLRLSCAASGFTFSSYWMNWVRQAPGKGLDWVGRINENSGTINYAGSVIGRFTISRDNVKSTLYLQMTNVKTEDTAVYYCAR
Tympanoctomys barrerae V37 ighv NDGN010305216.1 3147 VQCEEQLVESGGGLVQSEGSLTLSCAASGFTFSDYWMSWIRQAPGKGLEWIIDIRYDGATIYYAESVKGRFTISRDNAKNTLYLQITELKTEDTAMYYCARE
Tympanoctomys barrerae V45 trdv NDGN010382342.1 4563 SSMAQGITQSQPALTRQEGKAVKLHCSYDTTLSYHILFWYKRSPSGELIFLLLQESNAERNATQGRYSVSFQKAAKAIQLIISPAQPEDSATYFCCLRQ
Tympanoctomys barrerae V49 trdv NDGN010419626.1 214 PSVAQKVTQVQPPTSGREGEVATLDCEYEKKTVRDYLLWYKQLPSREMTFLIWTAPGQTKNTGRYSVKFLKADSMSFIIFSLQIEDSAKYFCSIRT
Tympanoctomys barrerae V51 ighv NDGN010431831.1 1569 VLSQVQLQESGLGLVKPSQTLSLTCSVSGFSLTDYGISWIRQAAGKKLEWMGVIWGGGNTDYNSALRSRLGITRDTSKRQVFLTFSSLRPEDTAMYYCAR
Tympanoctomys barrerae V61 ighv NDGN010537273.1 1186 VQAEVQLVESGGRLVQPGGSLRLSCAASGFAFSSYYMSWIRQTPGKGLEWLSYIRGDSSDINYAASVKGRFTISRDNSKNVLYLQMDNVRTEDTALYYCAT
Tympanoctomys barrerae V64 iglv NDGN010565024.1 4388 AMASYVLTQPPSVSVSPGETATIICSGEALPKKYADWFQQKLGQTPVLIMYDDSKQPSGISERFSGSSSGTTAILTINGARAEDEADYYCFSADSSGSY
Tympanoctomys barrerae V66 igkv NDGN010573377.1 1347 GRGDIQLTQAPSVSASLGERVAITCRASQGISNNLHWYQQKSGQAPKLLINYATGLQSGVPSRFSGSWSGTDFTLTISSLQPEDAAAYYCQQNYGT
Tympanoctomys barrerae V68 ighv NDGN010589501.1 201 VHGEIHLVQSGAELKRPGASVKVSCNSSGYTFTSYLMHWVRQSSQQGLEWIGWVHPAIGTGYAQKFQGRATLTADTSSSTAYMELSSLKYEDSAVYYCAR
Tympanoctomys barrerae V72 trav NDGN010629980.1 2112 PGTADSITSQETEVSGAEGKTVTLLCNYDSSSTGSIVLYWFRQYPNQAPEYILHRGWKNSIKGDASFAAGRFYSRSTGNSIDLRIRDLMLADAALYYCAMR
Tympanoctomys barrerae V75 ighv NDGN010656206.1 686 VLSDLTLRESGKNLLKPGETLSLTCTVTGGSVTSSYWWNWIRQPPGKALQWMGLWTGSTSYNPAFQGRISITADTSKNQFSLQLNSVTTEDTAMYYCAR
Tympanoctomys barrerae V80 trav NDGN010698253.1 700 STGQEKGVVQSVSILSAWERETAVINCSYTDTTFAYFPWYKKVEGRGPILLIDIHSIMDKKQERRFTVLLNKNVKHVSLHIAETQPGDSAVYFCAAG
Tympanoctomys barrerae V88 trav NDGN010745260.1 521 RNNGKLVTQTESQITLSEGASLAMNCSYDNTQYPSLFWYVQYPGEGPQLLFGVSMANDEGSNKGFEVTYGEETSSFQLEKAFVEVSDSAVYYCALR
Tympanoctomys barrerae V89 trdv NDGN010764318.1 44 SSMAQTVTQVQRATSRPEGETATLDCAYETSLSLYYILWYKQLPSGEMAFLIRRVSTDVNAESARYSVCLQGAAKSVILTISALQTGDSATYFCALVE
Tympanoctomys barrerae V103 igkv NDGN010877842.1 59 ARCDVQLTQSPSSSASVGDTVAITCRASQSIGKNLNWYQQKPGQPPKLLIYYAANLQSGVPPRFKGSGSGTDFTLTISAVEAVDAATYYCQQDTNL
Tympanoctomys barrerae V106 trgv NDGN010903972.1 1892 LLGHLEQNEISVSRARETAHLSCNTSIVNFNSVPTHWYQLKPNQGFEYVFYALAIPLQCGNKLEARKHSGTSKSTLKIIFLEKEGEATYYCAYWE
Tympanoctomys barrerae V108 ighv NDGN010911813.1 28 VQAEVQLVESGGGLVQPGGSLRLSCAASGFTFSSYYMDWIRQAPGKGLEWISYITSSGGSTYYTESVKGRFTVSRDNSKNMLYLQMNNVRTEDTALYYCAT
Tympanoctomys barrerae V118 igkv NDGN010980537.1 3369 TRCAIQMTQSPPSLSASPGDRVTITCRASENIYSYLSWYQQKPGEAPRLLIYDASNLQSGVPARFSGSRSGQDFTLTISSLQPEDAATYYCQKYYQYP
Tympanoctomys barrerae V119 ighv NDGN010992388.1 4523 VRCEVTLVESGGGLVQPSESLRLSCTASGFTFSSYGMHWIRQAPGKGLEWIAHIYSDSSKMYYADSIKDRFTTSRDNAKNMLYLQMSSLRPEDTAMYYCAR
Tympanoctomys barrerae V129 ighv NDGN011054930.1 1269 VLLQVQLQESGAGLVKPSQTLSLICSVSGVSITSNGHWWNWIRQTQGKRLDWMGDISYSGDTSYSPALKSRITIFRDTANNQFSLQLNSVTEDDTAVYYCVD
Tympanoctomys barrerae V135 ighv NDGN011097910.1 2811 VLSDLTLKESGPSLVKPGGTLSLTCTVTGGSVTSSNYWNWIRQPPGKALQWMGYWSGSTNYNPAFQSRISITADTAKNQFSLQLNSVTTEDTAIYYCA
Tympanoctomys barrerae V141 igkv NDGN011115523.1 2539 ARCDIRMTQSPHLSASLGEKVTITCQASQGISDYLNWYQQKSGKAPKLLIYWATNLDSGVPSRFSGSGSGTDFTLTISSLQPEDVATYYCMQYNKLP
Tympanoctomys barrerae V144 ighv NDGN011119311.1 1445 VMSQVTMKESGPGLVIPTETLKLTCSFTGFSLSTSGMAVGWIRQPPGKSLEWLAHIWFNDDKAYSPALKSRLSISKDTAINQVFLTMNSVDPADTATYYCGRR
Tympanoctomys barrerae V163 ighv NDGN011157881.1 503 VLSQVQLQESGPGLVNPSETLSLTCTVSGFSLSSYGVQWSRQSPGKAMEWVGGIWSGGSIYYNPGLKSRVSISRDTYQSQVSLTLSSLRSEDTAVYYCAR
Tympanoctomys barrerae V164 igkv NDGN011162753.1 3393 ARCDIQMTQSPHLSTSPGEKVTIACQASQDIDSYLNWYQQKPGKAPKRLIYYTSNLDSGVSSRFSSRGSGTSYKLTISSLQPEDVATYYCMQYDMRP
Tympanoctomys barrerae V168 ighv NDGN011170343.1 185 VHSQVQLVQSGPELKRPGESVKVSCKGSGYTFTSYSIFWVKQVPGKGLNYMGWINTETAKPTYSEGFTGRFVFSLDASVSSAYLQISSLQAEDTAVYYCA
Tympanoctomys barrerae V170 igkv NDGN011174698.1 963 SVGNAVLTQSPGSLSVTPGESVSISCTSSRSLLQTDRYTYLSWFLQKPGRPPKRLMYVVSRRDPGTPDRFSGSGSETDFTLQISSVAAGDAGIYYCQQ
Tympanoctomys barrerae V172 ighv NDGN011176236.1 3098 VQAEVLLVESGGGLVQPEGSMRLSCVASGFTFRNYGMHWIRQTPEKGLEWISAIGNGGNTYYADSVKGRFTISRDNGKKLVNLQMSSLRTEDTALYYCSR
Tympanoctomys barrerae V175 trbv NDGN011186178.1 1591 PVLNEVIQTPRHRIKTKGQQATLRCSPESGHQSVAWYQQAVGQGLQFLFENYNELQRAKGNISNRFSAQFQYSLSELNISTLELEDSAMYFCASR
Tympanoctomys barrerae V176 trbv NDGN011190094.1 1399 CSEDEVTQTPRQLVIWKGQKAMISCVPKTGHNVVYWYQQKKNEELKYLMHFQSNTVLDQTDEFKDRFSAACPRDSPCRLETKSSDLQDSALYLCASSR
Tympanoctomys barrerae V177 trav NDGN011191102.1 919 IKAQIKVDQSPQVQITQEKRNFYLTCNYSTSVNNVQWFQQSPEGRLISLFYIASGVQHKGRLKATVNFKERYSQLDIRDSRPEDSASYFCAVQ
Tympanoctomys barrerae V181 ighv NDGN011193547.1 829 VQAEVRLVESGGGLVQPGGSLRLSCVTSGFTLSSYVMSWIRQAPGRGLDWISDIDISDANTYYADSVKGRFTISRDNSKNTLYLQMSSLRTEDTAVYYCA
Tympanoctomys barrerae V192 igkv NDGN011211160.1 329 VRCDIQMTQTPSSLSASPGDSVTISCRASRNIGIELDWYQQKPGRAPTLLIYHVSNLHSGVPSRFRGSGSGTDFSLTINSLQPEDSATYYCQQDYGTP
Tympanoctomys barrerae V194 ighv NDGN011214844.1 318 VQAEVQLVESGGGLVQPGESLRLSCVASGFNFGSYAMYWIRQAPGKGLEWISAIGSTDTYYADSVKGRFTISRENSKNTLYLQMSSLKTEDTALYYCTR
Tympanoctomys barrerae V196 trbv NDGN011215812.1 2406 PGNAGITQTPTAQVLKTGQRTTLSCAQDLKHDSMYWYRQDLGLGLRLVYYSFDVNLTEKGEVPGGYTVSRSSSENFPLTLESASPSQTAVYFCASSF
Tympanoctomys barrerae V198 ighv NDGN011217388.1 729 VLSQVQLQNTGPDLVKPSETLSFTCVVSGFSLTSYHMHWIRQASGKAPEWIGCIWGGGGTNYNSAFQSRVSISKDTSKNQVSLTLRSLISEDTGVYYCARE
Tympanoctomys barrerae V209 trbv NDGN011237432.1 2049 PMNTRVTQTPRHLVMGTAGKKSLQCGQDLGHNAMYWYKQKAGKAPELMFLCSYKALTQNETVPSRFSTDCSGGSRVNLDLTALHPEDSAVYLCASSQ
Tympanoctomys barrerae V210 trbv NDGN011237432.1 3736 YMEPGVRQSPSHKVTEMGQNVTFRCDPISGQQYIYWYRQTAEKGIEFMVYLYNKDPMEKADFFKDRFSAEVPQGSYSVLKIWPAQLGDSAVYLCASSQ
Tympanoctomys barrerae V222 ighv NDGN011252979.1 107 AHGEVQLVQSGAELKKPGTSVKVSCKASGYTFTSYLMHWVRQSPEQGPEWIGWVFPATGSTGYAQKFQGRATITADTSSSTAYMELSSLKSEDTAVYYCAR
Tympanoctomys barrerae V233 trav NDGN011271800.1 1590 RTRGDSVTQIGGQVTLSERAVLIINCTYTASGYPTVFWYVQYPGEGPQLLLKAMTANEQGRNKGFEATYNKEASSFHLGKATVEEADSAVYFCAVG
Tympanoctomys barrerae V235 iglv NDGN011275225.1 631 VESQAVVTQESSLYTSPGGTVTLTCGSSTGAVTTSNYAHWVQKEPYKTLKGLIHNTNIRYTGVHARFSGSLLGDKAVLTILGAQPEDEATYYCALWYSNH
Tympanoctomys barrerae V240 ighv NDGN011281559.1 1842 AHGQVQLVQSGAEPKRPGASVKVSCKVTGSTSTITWIHWARQDPGQELEWIGAVDLRDGEVHYAQKFQGRATITGDKSSSTSYMELNSLKSEDTAVYYCVRQCG
Tympanoctomys barrerae V244 ighv NDGN011285660.1 91 VQAEVQLVESGGGLVQPGGSLRLSCVASGFNFGGYAMDWIRQAPGKGLEWIAYISSSSSYIYYLDSVKGRFTISRDNSQNTLYLQMNSLRAEDTAVYYCAK
Tympanoctomys barrerae V245 trav NDGN011288968.1 415 RINGDSVTQTAGQVVRLEKDSLAVNCSYESKSSQYPVLFWYVQYPGEGPQLLLRVAKANDKGHNKGFEAMYDKDTSSFHLQKASLEESDSAVYFCALS
Tympanoctomys barrerae V247 ighv NDGN011291223.1 192 AHGQVQLVQSGAELKRPEASVKVSCKASGYSFTGYWMHWVRQTPGQGLEWIGNLNPSNGNTNYAQKFQSRATFTADKSSSTAYMELRSLKSDDTAMYYCA
Tympanoctomys barrerae V258 trgv NDGN011301585.1 4719 GSQTSSKMEGGMVSVTRNPGSYLTITCDLRAGRSYTHWYRIQEGQAPQRLLYYDFSHKKAVLDSGLRPGKYNAYQVAEFSNKLTVQNLEEGDAGVYYCAVWT
Tympanoctomys barrerae V262 iglv NDGN011308140.1 740 LCGLPVLTQNPLASASPGASITLTCTLSSEHSSYTLEWYQQRLGRSSQYVMYVNSDGSSSKGDGISDRFSGSSAGADRYLTISNLYSEDEAQYYCGV
Tympanoctomys barrerae V267 ighv NDGN011310124.1 1694 VLSQVQLQESGPGLVKPSQPLSLTCTVSGYSITSGYAWHWIRQPPGKSLEWMGYIYYDGSTGYNPSLKSRISISRDTEKNQFSLQLNSVTTDDTATYYCAR
Tympanoctomys barrerae V270 ighv NDGN011313842.1 1831 VQCEIQLMESGGGLVQPGGSLKLSCAASGFTFDDYAMNWVRQGPGKGLEWLAYISWNGGSISYADSVKGRFTISRDNAKNTLYLQMAKLKTEDTARYYCAK
Tympanoctomys barrerae V272 igkv NDGN011317084.1 329 SWGEIVMTQTPLSLSISPGEPASISCRSSHSLLHSSGNTFLNWVVHKPGQAPRSLIHKVSNRDSGVPLRISGGESGTDFTLTISRVEAEDAGVYYCWQGLYEP
Tympanoctomys barrerae V280 ighv NDGN011321989.1 3172 VLSQITLKESGPGLLTPTKTLRLTCSFSGFSLSTTNIGVGWIRHPPRKSLEWLAHIWWDDDKYYSPALKSRLSISKDTSNNKVFLTMSSVDPADTATYYCARLD
Tympanoctomys barrerae V281 ighv NDGN011321989.1 15957 VHSQVHLVQSGPELKRPGESVKVSCTSSGYTFTDHAITWVKQVPGKCRQYMDCVNINTAKPTYAEGFTGRFVISLDASVSSAYLQISLLQAEDIAVYYCA
Tympanoctomys barrerae V282 ighv NDGN011321989.1 20628 VLSQVQLQESGPGLVKPSQTLLLTCSISGDSVSSTSTTWNWVRQPANKGLEWLGRTYYRSKWYYNYAPSLQGRATITPDTSKNQFSLQLSSVSTEDTAVYYCAR
Tympanoctomys barrerae V285 ighv NDGN011322988.1 6972 VQAEVQLVESGGGLVQPGGSLRLSCAASGFTFSDYRMHWVRQAPMRGLEWVAEINSGGGSTYYPDSVKGRFTISRENAKNTLYLQMNTLKTEDSAVYYCAR
Tympanoctomys barrerae V290 trgv NDGN011326242.1 1325 GLGLNTVEQSQISVSRDLNKRADIHCKVSTDRFASDSIYWYRQKQGQALEHLVQVVSTENPAQATISRVTASKMSATLSSILTIRRVEKEDEALYYCAGWA
Tympanoctomys barrerae V292 ighv NDGN011327606.1 1801 VQAEVQLVESGGGLVQPGGSRKLSCVASGFTFSSYVMHWIRQAPGKGLEWLSFISETGKNINYADSVKGRFTISRDNDKNTLYLQMSSLKAEDTATYYCAR
Tympanoctomys barrerae V296 igkv NDGN011332819.1 400 STGQTQLTQSPASLALSSGETATLSCRASRSVSSYLDWYQQKAGQAPRLLISGASTRATGIPARFSGSGSGTDFTLTISSLEPEAVATYYCYQYSSG
Tympanoctomys barrerae V300 igkv NDGN011334744.1 8804 VCGDIVLTQSPRSLAVPAGESTTIHCKASQSLQSGSNSYLAWYQQKPGQSPRLLISWASTRASGVPDRFSGSGSGTDFTLTINNLQAEDIADYYCQQSHSTP
Tympanoctomys barrerae V306 iglv NDGN011338932.1 2817 SVASYVLTQPSSVSVTLGQTARMTCEGNDIGSKYVYWFQQKASQAPALVIYEDSKRPSGIPDRFSGANSGNTATLTISGAQAEDEVDYYCEVWVSSEK
Tympanoctomys barrerae V309 trav NDGN011341554.1 1436 RICGQSVTQMEGPVSITEGALLTINCSYTASGYTVLFWYVQYPTEGPQLLLKAVKANEKGRSKGFEATNDRAASSFHLEKAIVQVSDSGLYYCAVS
Tympanoctomys barrerae V311 trdv NDGN011342524.1 188 HAVAQKVTQVQTALSSPEGKAVTLDCSYETSVSYYGLLWYKQLLSGEMVLLSYQSSSGDDASTGRYSVNFQKIAKRITFTFSALQMEDSAKYFCAFW
Tympanoctomys barrerae V313 igkv NDGN011343834.1 193 GRGDIQLTQSPSVSASLGERVTISCRSSEGISSYLHWYQQKQGQAPKLLISYASTVESGLPSRFSGSGSGMDFTLAINGLESEDVATYFCQQSNNWP
Tympanoctomys barrerae V322 trav NDGN011356453.1 373 DQQQVKQNPASLTVQEGEISVLNCTYENSAFDYFPWYRQFPGKGPELLVAIRETMNKKDAGRFTVYFSKSAKELSLRIRTLQPGDSATYFCAA
Tympanoctomys barrerae V327 ighv NDGN011359652.1 316 IHCEEQLVESGGGLVQPGRSLRLSCAASGFTFDDYHMHWVRQAPGKGLEWLAYINWNGDSTNYADSVKGRFTISRDNDKNMLYLQMTKLKTEDTAVYYCTR
Tympanoctomys barrerae V335 igkv NDGN011367807.1 418 SRGDVVLTQTPQVLSVSPGGTASFSCRSSQSLLDSDGNTYLYWMVHKPGQAPRGLIYLVSNRIPGISDRISGSGSGTDFTLTISRVEAEDAGVYYCFQG
Tympanoctomys barrerae V340 igkv NDGN011371231.1 2480 TRCAIQMTQSPPTLSASPGDTVTITCRASQDVNSYLSWYQQKPGEAPRLLIYGASNLQSGVPPRFSGSGYGTDFTLTISGIQKEDVGTYYCLQTWSAP
Tympanoctomys barrerae V342 ighv NDGN011373977.1 6977 VLSQGQLQETGPGLVRPSQTLSFTCSVSGYSITSGRSWTWIRQPQGKGLQWVGRIDRAGGTAYEPSLKSRVSISRDTPKNQFSLQLNSVTAEDMALYYCAR
Tympanoctomys barrerae V346 igkv NDGN011377141.1 459 ARCDIQMTQSPSFVSASVGDRVTINCRASQSISKFLAWYQQKPGKAPKPLIYSATNLESGVPSRFRGSASWTFFTLTISSLEPEDVATYYCQQSANTP
Tympanoctomys barrerae V347 ighv NDGN011377479.1 2372 AQGQVQLVQSGAELRTPGAAVKVSCKASGYTFTNYNMHWVRQIPGEGLEWIGHIYPGSGYTNYAQKFQGKATLTDDKSSSTAYMELSSLKSEDTAVYYCAR
Tympanoctomys barrerae V355 trav NDGN011392201.1 5060 TGSLAKTTQPFSMDSYEGQGVNLSCTHPNIATNEYIFWYRQVHHQGPQYVIQGYKTNVANEMASLFIPNDRKSSTLRLPQAALEDSAVYYCIVGA
Tympanoctomys barrerae V356 iglv NDGN011392538.1 7812 SLSQALVTQEPSLSAAPGAPARLTCTLRSGISVGGYYIYWYQQKPGSPPRFLLYYYSDSNKQLGPGIPSRFSGSKDTSANAGVLHISGLQPEDEADYYCAI
Tympanoctomys barrerae V363 trav NDGN011401871.1 438 RIFGQSVTQMTGQVSITEGALLTINCSYTASGYPVLFWYVQYAREGPQLLLKAVKANEKGRSKGFEATNYRATSSFHLEKAFVQVSDSGVYYCAVS
Tympanoctomys barrerae V368 igkv NDGN011413577.1 154 GRGDIQLTQAPSVSASLGETVTISCQSSQGISNYLHWYQQKPGQAPKLLIYGATTVQSGVPSRFSGSGSGRDFTLAINGLESEDVATYFCQQGYNQP
Tympanoctomys barrerae V373 trbv NDGN011416663.1 1292 GPETQVTQTPRHLIAQAGKSLTVTCSQNVNYDVMYWYRQDPGLGLKLIYHSINVDFIEKGEISDGYSVSRKEKKHFPLTVDEANASQTSMYLCAISF
Tympanoctomys barrerae V377 trbv NDGN011419051.1 644 SVDAGVVQTPKHLIQVKGRQATLRCSPMSGHRTVYWYQQNLDQGLQFLFSYYNGDEREKGKSVERFSGQQFSNSTSELTLGALQLGDSARYLCASSV
Tympanoctomys barrerae V389 ighv NDGN011434383.1 3040 VQCEEQLVESGGGLVQPGGSLRLSCAASGFTFSNYWIFWIRQAPGKGLEWIVSMLYDGGNTYYADSVKGRFTISIDNSKNTVYLQMTTLKTEDTAVYYCVR
Tympanoctomys barrerae V390 ighv NDGN011435209.1 865 VQCEEQLVESGGGLVQPSGSLRLSCSASGFTFTNHWMNWVREAPGKGLEWITSIDYSGSNTYYADSVKGRFTISRDNEKNTLYLQMTKLKTEDAAVYYCAR
Tympanoctomys barrerae V396 ighv NDGN011440884.1 797 VLSQVQLQESGSGLVKPSQLLSLTCTVSGFSITTSNYWWNWVRQSPGKSLEWMGYISYSGSTGYSPSLQSRISISRNTGNNHFSLQLNSVTTEDIATYYCAR
Tympanoctomys barrerae V407 ighv NDGN011447333.1 3508 VLSQVQLQESGPGLVKPSQTLTLTCTVTGVSLTSNRFAWIRQAPGKGLEWMSILWTDGSTDYNSALKSRLSISRDTSKSQVSLTLSSLKTEDTALYYCAS
Tympanoctomys barrerae V414 iglv NDGN011449328.1 9697 LLSQALVTQEPSQSASPGASARLTCTLRSDITVGGYYIFWYQQKPGSPPKFLLYYYSDSSKQLGSGIPSRFSGSKDTSANAGVLHISGLQPEDEADYYCMT
Tympanoctomys barrerae V416 iglv NDGN011450534.1 67 SLSQAVVTQEPSLSASPGASAGLTCTLRSDISVGGKWIFWFQQKPGSPPRFLLNYYSDSDKYQGSGIPSSFSGSKDSSANAGVLRISGLQNKDEADYYCMI
Tympanoctomys barrerae V417 trbv NDGN011450737.1 733 GSGLGALVLQHPSRVICKSGSSVKIECRYRDFQAISVIWYRQSPKQGFTRMATSNQSPDATYEEGFTKAKFPITHPNGTYSSLTVTNAHPEDSSSYFCGAS
Tympanoctomys barrerae V433 trbv NDGN011461203.1 2830 HLEAGITQSPRHKLVRTKEKVTLKCHQTNNHDRMFWYRQDPGQGLRLIHYSYGVNYLEKGEVPDGYNVSRENTKDFPLTLESATLSQSSVYFCASSE
Tympanoctomys barrerae V439 ighv NDGN011464474.1 1392 VLCQVQLQESEPGLLKTSETLTLTCAVSGFSLTSYSVQWLRQAPGKALDWLGGVWGDGSTYYKPDLKSRVSINRDTYKSQVSLTLISLRSEDTAMYYCSR
Tympanoctomys barrerae V449 trgv NDGN011472950.1 5195 SQTTHNIEGGMVSVTKKRGSHLTITCDLRAGKSYIHWYRFQEGQAPQRLLYYGFSKTVLDSGLRPGKYNAYQAAEHINTFVVRSVEEGDAGVYYCAVWT
Tympanoctomys barrerae V450 trgv NDGN011472950.1 10037 DSQTSSNMEEGMTVMNRPRGSYVEITCTIHIRSNYIHWYRFQEGTVPRRLLYYDFSNSKAMLDSGLPKGKFDAYVGTGGKSSKFVVRNVEASDSGVYYCAAWT
Tympanoctomys barrerae V458 trbv NDGN011476591.1 778 GSGLGALVLQHPRRAICKSGSSVKIECRCLDFQGLSVIWYRQSLKRGFTRMVISNQGSDDATYEEGFPKDKFPISHPNQTYSSLTLTSVHPEDSSSYFCGAS
Tympanoctomys barrerae V460 iglv NDGN011480008.1 4488 SWGQSALTQPPSASGSLGQKITITCTGTSNDIGQYNYVSWYKQLPGITPKLLIYAVNNRPSSAPDRFSGSKSGNTASLSISGLQAEDEAEYYCCSYRND
Tympanoctomys barrerae V462 igkv NDGN011482762.1 1109 VCSDIVMTQSPRSLAVSPGESVTIRCTSSQSLLGSSSKKNYLAWCQQKPGQSPRLLIYWASTRESGVPDRFSGSGSGKDFTLTISSLQAEDVADYYCQQGISFP
Tympanoctomys barrerae V463 igkv NDGN011483340.1 6444 ARCDIVMTQSPPTLSASLQGSVTINCRTSQSVNKYIAWYQQKPGQAPKSLIYYATNLQSGVPLRFGGSGSGQDYTLTISSLQPEDAATYYCQ
Tympanoctomys barrerae V472 ighv NDGN011487897.1 1549 VQAEVQLVESGGGLVQPGGSLRLSCAVSGFTFSSSYMNWIRQASGKGLELVSYISGDSSDIYYLDSMKGRFTISRDNSKNTLYLQMNNVRTEDMALYFCA
Tympanoctomys barrerae V482 trbv NDGN011492591.1 1836 TVDGGITQTPKFQFIQKGQSVTLECEQNLNHDTMYWYRQNPGQGLRLIYFSITVDDIQTGDITEGYTVSRKKKESFPLTMNSAQKDQAAVYLCASSL
Tympanoctomys barrerae V484 ighv NDGN011493487.1 2388 VLSDLTLQESGLNLLKPGETLSLTCTVTGGSISSSYYWHWIHQPPGKLLQWMGYWVGSAYYSSAFQGRISITVDLAKNQFSLQLNSVTTEDTAMYYCAR
Tympanoctomys barrerae V487 ighv NDGN011496908.1 3052 VQAEVQLVESGGGLVQPGGSLRLSCAASGFTFGSYYMNWIRQTPGKGLEWLSYISGDSSSINYAASVKGGFTISRDNSKNTRYMQMSNVKTEDTALYYCAR
Tympanoctomys barrerae V488 ighv NDGN011496908.1 10341 VQAEVQLVQSGGGLVQPGGYLRLSCEASGFTFSSYNMIWFRQTPGKGLEFISYITGDSSHIDYIESVKGRFTTSRDNSKNTLYLQMNNVKTEDTALYYCAR
Tympanoctomys barrerae V491 trgv NDGN011498669.1 8410 GLGVKTMGQPQISVTTELKKRVDIRCKISPDDFEYDSIHWYWVKKDQALEHLVQIVSSTIPAQGRNNRVSVRKNFATLSSILTINYVEKEDEAVYYCAAWE
Tympanoctomys barrerae V492 iglv NDGN011499175.1 2391 SLSQPVLTQPASSSASPAGSARLTCTLNSGFSVGDFRIWWYQQKLQSPPRYLLSYYSDSSKHQGSGVPSRFSGSKDTSINAGVLHISGLEPEDEADYYCAT
Tympanoctomys barrerae V514 iglv NDGN011521040.1 3286 SYVLTQPPSVLVALGETATITCSGEALPKKYAYWFQQQQQGQPPVRIIYKDSERPSGISERFSGSSSGTTATLTISSTQAEDEADYYCLSTDSSGSY
Tympanoctomys barrerae V532 igkv NDGN011535422.1 9408 VHGDIQMTQSPSSLSKSPGDRVTITCQASKNIYSNLAWYQQTPGKAPRLLIYYTASLQTGVPARFSGSGSGTDYTLTISSLEPEDAATYYCQQHSELP
Tympanoctomys barrerae V544 trbv NDGN011543960.1 3356 HTEPGIIQIPSHQVTRMGEMAILSCDPTSDNLYFYWYRQILGQGMEFLVCFYMGRILERSEMFKDDYSVDKPDGSYFTLKINLTKLEDSAVYFCGSSL
Tympanoctomys barrerae V564 ighv NDGN011551103.1 13122 ALGQVQLLQSGAELKKPGTSVKVSCKASGYTFTSYNVDWVRQSPGQGLEWIGVIYPGNGYTAYTQKFQGRATLTADKSSSTAYMELSSLKSEDTAVYYCAR
Tympanoctomys barrerae V568 iglv NDGN011553141.1 9194 SMASYKLTQPSSLSVTWGKTARITCQGYSLRSYTVSWYQLKPGQAPILIIYYDDIKASGIPDRFSGSNKGNTATLTISRAQLEDEADYYCQVWDSSGK
Tympanoctomys barrerae V570 trdv NDGN011553555.1 11295 ARTQVVQVNDSMYGFIGTDVVLHCSFANPMPSVKITQVTWQKATNGTKQNVAIYNPAMGVSVLAPYRERVQFLRPSFIDGTIRLSRLELEDEGVYICEF
Tympanoctomys barrerae V575 igkv NDGN011556946.1 2039 VCCDIQMTQSPSSLSASLGDSVTIRCQASQDVRGYLNWFQQKPGKSSSFLICNTKNLHSGVPLRFSGSGSGTDYTLTISNLQPEDLATYYCL
Tympanoctomys barrerae V577 igkv NDGN011557307.1 7535 GRCDIQLTQSPSVSASLGERVTITCRASQSTSNYLHWYQQKPGQAPKLLIYSATTVQPGVPSRFSGSGSGTDFTLTISSLEHEDVATYYCQHSKIWS
Tympanoctomys barrerae V581 trgv NDGN011558193.1 13474 GLGVTKLEQSQISVSTIVDKSVDLHCKVWSIRFQTKPIHWYLQKPNQALEHLIQVTAIRTPARTKNKRVLAKKDSETLSSILTINNVEKEDEATYYCAGWD
Tympanoctomys barrerae V588 iglv NDGN010032826.1 887 YCTQPVLHQPPSAASTLGTSVRLTCTLSSDHNIGFYSIFWYQQKPGQPPRFLLRYFSYADKHQGPKVPSRFSGSKDMFSNQGYLSISELQPEDEAVYYCALG
Tympanoctomys barrerae V589 ighv NDGN010041730.1 338 VQAEVQLLESGGGLVRPGGSLRLSCVASGFNFGSFAMHWIRQAPGKGLEWISLIYYDGNSKYYADSVKGRFTISRDNNKNTLYLQMSSLRPEDTALYYCAK
Tympanoctomys barrerae V597 iglv NDGN010122237.1 1117 SMSQAVVTQEPSLSASSGASARLTCILRSDISVGGKGLQWYQQKPGSPPRFILRYYSDSDKYQDSGFPSRFSGSKDTSANAGVLHISGLQPEDEADYHCVI
Tympanoctomys barrerae V603 trav NDGN010166313.1 647 VSVAQKVTQSQQEISMQEAATATLDCTYDTTDSNYYLFWYKQLRSGQMIFVIRQEAYKQQNATEARFSVNFQKATKSFSLKISSSELADAATYFCAFTS
Tympanoctomys barrerae V606 iglv NDGN010204533.1 318 SWAQSTLTQPPSASGTLGQKATITCTGTSNDIGKYNYVSWYQQRPETSPKLLIYGVSSRPSGVPDRFSGSKSGNTASLSISGLQAEDEADYYCCSYAGS
Tympanoctomys barrerae V611 trdv NDGN010276555.1 577 PSVAQKVIQVQPAASEREGEVATLDCEYERRSVTDYLWWYKQLPSGEMTFLIWGIPSQTKRTGHYSVKFPEANSVSFIISGLQMEDSAKYLCAVR
Tympanoctomys barrerae V613 ighv NDGN010294975.1 1089 VQAEVQVVESGGGLVQPGGSLRLSCKASGFTFSDYYVTWIRQAPGKGLEWVGFIRNKANSHTTEYAASVKGRFTISRDDSKSTAYLQMTQLKTEETAVYYCT
Tympanoctomys barrerae V618 ighv NDGN010328330.1 1321 VQGEVMLVESGGGLVQPSGSPTLSCTTSGFTFSSYGMNWIRQAPGKGLEWIAYLYIDGSSKYYADSAKGRFTISRDNGKNMLYLQMSSLRSEDTAMYYCTR
Tympanoctomys barrerae V629 ighv NDGN010391663.1 5420 VHSQVQLVQSGPELKRPGESVKVSCKGSGYTFTNYAINWVKQVPGKGLQWMGWINTETAKPTYAEGFTGRFVFSLDASVSSAYLQISSLQAEDTAMYYCA
Tympanoctomys barrerae V631 ighv NDGN010407994.1 524 VRCEEQLVESGGGLVKPGGSLRLSCAASGFTFHDYNMYWIRQAPGKGLEWLGWISPSGGSTDYPDSVKGRFTISRDNAKNTLYLQMNSLKTEDTAMYYCAR
Tympanoctomys barrerae V635 iglv NDGN010449307.1 794 SWAQAVLTQPPSVSRSLGQMVTISCTGSSNNIGYGYYVHWYQQLSGMSPKLIIYEDSNRPSGVSDRFSGSKSGNSASLTISGLQSEDEADYYCQSYDGSLNT
Tympanoctomys barrerae V637 iglv NDGN010461153.1 748 SFSQPVLIQPRSQSASLGMNTKLTCTLSSGFVVSGYHISWYQQKSGNRPRFLLRYYSDSNKYQGSGVPNRYSGSKDSSANAGVLLLTGLQSEDEADYYCL
Tympanoctomys barrerae V640 igkv NDGN010490746.1 3576 TGVCSDIVMTQSPRSLAVSAGESATICCKASQSLQPNSSNYLAWYQQKPGQSHRLLIYWASTWASGVLDRFSGSGSGTDFTLTINNLQADDVADYYCQQYDRFP
Tympanoctomys barrerae V647 igkv NDGN010550086.1 508 ARCDVQLTQSPSSSASVGDTVAITCRASQSIGGYLNWYQQKPGQPLTLLIYYATGLQSGVPARFKGSGSGTDFTLTISVVEAEDAATYYCQQHNNFP
Tympanoctomys barrerae V653 ighv NDGN010604955.1 564 VLSQVQLQESGPGMLKPAESLFVTCSVSGFSLTDYGVHWIRQAPGKALEWMGVIWGAGSTDYNSALKSRASISRDTSKKQVSLTLSSLRSEDTAVYYCAM
Tympanoctomys barrerae V654 trav NDGN010632364.1 7067 RTCGDSVTQTESQITVQQGALLTINCTYTAPGYPALLWYVQYPEEGPQLLFRVSKANDKGSSKGFEATYIKEARSFHLEKASVEESDSAVYFCALG
Tympanoctomys barrerae V656 ighv NDGN010643618.1 10124 VQAEVQLVESGGGLVQPGGSLRLSCVGSGFNFGSAGIHWIRQASGKGLEWIAMIYYDSSKTNYADSVKDRFTISRDNGKSTSYLQMSSLRAEDTAVYYCAA
Tympanoctomys barrerae V657 ighv NDGN010643618.1 3541 VLSQVQLQESGPGLMKPSQTLSLTCSVSGFSITTNAYGWNWIRQPPGKGPECMGYINYNGGAGYSPSLKSRMSISRDTDKNQFSLQLSSLTAEDTAMYYCAR
Tympanoctomys barrerae V659 ighv NDGN010667242.1 4434 VQADVQLLESGGGLVLPGGSLKLSCVGSGFTFSSFSMRWVRQAPGKGLEWISFISQTAKNINYAESVKGRFTISRDNDKNTVYLQMANLKTEDTAVYYCTR
Tympanoctomys barrerae V666 igkv NDGN010710844.1 540 VCSDIVLTQSPRSLVVSPGESATIHCKASQSLLYSANNKNYLAWHQQKPGQSPRMLIYWASTREFGVPDRFSGSGSGKDFTLTISNVQAEDAGDYYCHQHYSSL
Tympanoctomys barrerae V668 ighv NDGN010744741.1 934 VLSQVQLQESGPGLVKPSQTLSLTCSVSSFSITTSGYDWSWIRQHPGKSLEWMGYISYNGSTGYSLSVKSRISISRDTDKNQFFLQLSSLTAENTAMYYCAR
Tympanoctomys barrerae V669 trdv NDGN010752876.1 319 SSVAQTVTQVQRATSRLEGETAALDCTYEMSLSLYYIFWYKQLPSGEIAFLIRQVSTDVNAESGRYSVCLQGAAKSVILIISALRTGDSATYFCALVE
Tympanoctomys barrerae V671 iglv NDGN010764777.1 702 SLSQAVVTQKPSLSVSPGASARLSCTLRSDITVGSKWISWHQQKPGSPPRFLLEYYSESNKQLGPGIPSRFSGSKDNSANAGLLHISGLQPDDEADYYCNI
Tympanoctomys barrerae V677 trav NDGN010830643.1 429 VSSQQKEVEQSPETLRVPEGAGASLNCTYRTSASQTFIWYRQYPGRGPELLISTYSSRDKREGRFTAQLSTASRHFSLDITGTQHGDSATYLCTV
Tympanoctomys barrerae V682 trbv NDGN010891943.1 764 SMASGITQTPRNRITQTGTNTVLECSQTKGHDRMFWYRQDPGQGLRLIYYSIDINDFTKGDISDGYNVSRKEQASFSLSIEAATPSQTGLYFCASSD
Tympanoctomys barrerae V683 trav NDGN010896232.1 578 VSSQQKEVEQSPETLRILEGASTSLNCTYRISGSQPFIWYRQYPGKGPELLLYVYSSGDKKEGRFTAQLRTASQQYSLHIRGAQHSDSATYLCTV
Tympanoctomys barrerae V689 igkv NDGN010948056.1 742 TRCDIQMTQSPSVSASVGDRVTINCRASQGINVWLAWYQQKPGKVPKLLIYWATSLASGVPSKFSGTGSGTDFTLSISNLEPEDSATYYCVQYHQFP
Tympanoctomys barrerae V695 trav NDGN010991727.1 1728 MSAGEQVEQHPSSLSILEGGRSVMRCTYTNSTFSYFYWYKQEPGMGPQLLIQIFSNTDNKQDGRFIVLLNKKDKSLSLNITAAHPGDSATYLCAA
Tympanoctomys barrerae V697 igkv NDGN011002170.1 758 SMGDVVMTQTPSTLSISPGEPATISCRSSQSLVHSDGNTYLNWMVHKPGQAPRGMIYKISQKYSWVPDRFSGSGSGTDFTLTISRVEAEDVGVYYCWQGSYWP
Tympanoctomys barrerae V698 ighv NDGN011004086.1 574 ARAEVQLVESGGALMQPGGSLRLSCVASGFTFSNYGMNWIRQSTGKGLEWISYISSGSGSIYYADSVKGRFTVSRDNSKNTLYLQMNSLRTEDTAVYYCAR
Tympanoctomys barrerae V699 igkv NDGN011005682.1 325 SRGDVVMTQSQLSLSISPGEPASISCRSSESLLHSNGKTYLNWVVHKPGQAPRPMIYQVSNRDFWAPDRISGSGSGTDFTFTISGVKAEDAGVYYCWQG
Tympanoctomys barrerae V705 trdv NDGN011065434.1 329 LGVAMKVTQVQPATSGREGEVATFDCEYETERVTDYLFWYKQHPSGELTFLIQSVSGQTKRTGRYSTSFPKANSMSFIISSLQVEDSAKYFCAIRA
Tympanoctomys barrerae V706 iglv NDGN011073814.1 2251 SVASYVLTQPSSMSVTLGQIARMTCGGNSIGSKSVQWFQQKSGQAPMLVIYGDSNRASRIPDRFSGANSGNTATLTIAGAQAEDEADYYCQVWDG
Tympanoctomys barrerae V708 ighv NDGN011089291.1 313 VLSDLTLRESGPNLLKPGETLSLTCTVTGASVSSYAWSWIRQPPGKALQWMGYWAGSTSYNPAFQGRISITADTAKNQFSLQLKSVTTEDTAMYYCA
Tympanoctomys barrerae V710 igkv NDGN011096029.1 1549 SNGDIVLTQAPASVAASQGQKVTITCTASSTISSSYLHWYQQKPGASPKLLIYRTSNLASGVPARFSGSGSGTSYSLAISSVEAEDAATYYCQQGYDSP
Tympanoctomys barrerae V728 ighv NDGN011133369.1 3096 TQGQVQLLQSGAELRMPGASVKVSCKTSGFTFTDYYISWVRQSPGQSLEWIGWIYPGNGNTNYAQKFQGRASLTADKSSSTAYMELSSLKSEDTAVYYCAR
Tympanoctomys barrerae V730 ighv NDGN011138481.1 1412 VMSQITLKESGPGILRPTETLRLTCSFSGFSLSTYGIGVGWIRQPPGKSLEWLAHIWWDDDKRYNQALKSRLSISKDTSKNQVFLTMSSVDPADTATYYCARR
Tympanoctomys barrerae V734 trbv NDGN011148610.1 3776 VRAQTVHQWPATEVQPVGSTLSLECSVKGKSNPNLYWYRQVTGESLQLLFYSVGVGEVTSVAPQNFSASRPKDGQFILSSKKLLLSDSGFYLCAWS
Tympanoctomys barrerae V743 igkv NDGN011161024.1 1775 STGQTQVTQSPASLALSSGETASLRCRASQSVDSKLAWYQQKAGQAPRLLIYGASTRATGIPARFRGSGSGTDFTLTISSLEPEDVATYYCFQYSNWF
Tympanoctomys barrerae V747 igkv NDGN011165007.1 708 VCSDILMTQSPRSLAVSPGESVTIHCKASESLLHSKNKKNYLSWYQQKPGQSPRLLTYYASIRASGVPGRFSGSGSGTDFTLTINNVQAGDVADYYCEQDLRY
Tympanoctomys barrerae V749 igkv NDGN011172193.1 485 SNGDIVLTQSPASLTASQGDQVTITCTVSTGVSTSYLHWYQEKPGASPKLLVYSTSNLASGVPARFSGRSSGTSYSLTISRLEAEDTAAYYCQQSNSY
Tympanoctomys barrerae V753 trav NDGN011174544.1 1126 VNSQQEEIPQALKIQEGENTSVSCSYKSITTSLRWYRQDSGRSLVLLILVLSNEREKHNGSLRATLDTATKSSSLLITAAQTVDDATYFCATD
Tympanoctomys barrerae V769 igkv NDGN011199556.1 574 ARCDIQMTQSPSVSASVGERVTINCRASQDISQWLAWFQQKPGKSPKPLIRYTTTVQPGVPSRFSGSGSGTEYTLTISSLQPEDVAIYYCMQYDKLS
Tympanoctomys barrerae V772 ighv NDGN011206238.1 2193 VLADVQLLESGGGLVQPGGSLRLSCVGSGFTFSSYVMYWIRQAPGKGLEWISSISQSGKKIFYAESVKDRFTISRDNDKNTVYLQMPNLKTEDTAVYYCT
Tympanoctomys barrerae V782 trav NDGN011214899.1 1152 DAGAQSVTQPDARVAVPERDPVQLRCTYSYGGALYLFWYVQPPGQGPRLLLRYYSGDPRVQGIRGFEAEHRKNESSFHLRKHSVEWSDTAEYFCALS
Tympanoctomys barrerae V785 ighv NDGN011218876.1 349 EPYDSLINRIFLCLQVQPGASLRHSCAASGFTFSNCLMSWVCQVPRKGLQWVGQISKSGVSTYYSDSVKGRFTISRDNAKSMLYLEMTSMKTEDTAVYYCTR
Tympanoctomys barrerae V789 trav NDGN011229407.1 3145 VSGQHEDVERSPGSLGVPEGATTSLNCTYRDSTFRYFWWYRQYPGRGPEPLMSVYSSGDKEEGRLTAQLSTASQHFSLHIRGSQHSDSATYLCAA
Tympanoctomys barrerae V798 trgv NDGN011252442.1 2710 GLGVNTVEQSQISVSTDLNKRADISCKVSANNFAAVSIHWYRQKQGQALDHLVQVVSTTNPAQGTISRVTASKRSATLSSILTIRLIEKEDEALYYCAMWV
Tympanoctomys barrerae V799 ighv NDGN011252654.1 987 VLSQVQLQESGPGLVKPSQTLSLTCTVSGFSVTGYIAGWIRQAPGKGLEWMGIIWSGGNTDYSPALRSRLNIGRDTSKNQLSLTLSSLKTEDTAMYYCAR
Tympanoctomys barrerae V805 ighv NDGN011260041.1 1988 AHGQVQLEQSGAELKRPGASVKLSCKVTGSTSTIAWISWVQQCPGQGLEWIGAVDLRDGEIKYAQKYQGRATITGDKSTSNMELRSLGSEDTAVYYCA
Tympanoctomys barrerae V814 igkv NDGN011272079.1 2803 TRCDIQMTQSPSSISASVGDRIAINCKPTQDINKWLAWYQQKPGKAPKLLIYYATSLQSGVSSRFSGSGYGTDFTLTISSLESEDVGTYYCKQSYSW
Tympanoctomys barrerae V831 trbv NDGN011296283.1 3524 YTEAGVTQSPSYRVTKKGQNVTFRCDPISGHRFLYWYHQMLGQGPKFLMYFQDERSADTTGMPSARFTAERLEATFSNLKIWSVQQEDSAVYHCAS
Tympanoctomys barrerae V838 trbv NDGN011307664.1 1558 FSDDEVTQTPRHLVRWKGQKAKMTCVPKKGHSYVYWYQQKKNEELKFMVYFQNEDIVDETDEFKARFSAACPKDSPCQLETKSSDLEDSALYFCASSQ
Tympanoctomys barrerae V840 trgv NDGN011308982.1 7042 GSQTSGLEGGMTSVTRKPGSYIVITCNIDKEENYVHWYLVQEGQAPRRLLYYDFFTSQTVDSEVTSGKYHVYEGTERSFKFVLRNVEESDSGVYYCAVWA
Tympanoctomys barrerae V847 ighv NDGN011313775.1 2834 VHGQVQLVQSGAELRKPGSSVKVSCKTSGYSFTGYWMHWVRQSPGQGLEWIGEVNPNNGNTNYAKKFQGRATLTADKSSSTAYMELSSLKSEDTAVYYCA
Tympanoctomys barrerae V849 trgv NDGN011314966.1 910 GSQTSSKMEGGMVSVTRNPGSYLTITCDLRAGRSYTHWYRIQEGQAPQRLLYYDFSSSKAVLDSGFKLGKYNAYQATEHSNKFVLRSVEEGDAGVYYCAVWT
Tympanoctomys barrerae V850 igkv NDGN011316475.1 317 ARCAIQVTQSPTSISAAVGDTVTITCTTSQNIIYYMNWYQQKPGEAPKWLIYAADTLQAGVPSRFSGSGSMSGTHFTLTISGVQPEDVATYFCLCYST
Tympanoctomys barrerae V852 trav NDGN011319962.1 437 RNCGYSVTQTEGPVALTERNLLTLNCTYQTIYSRPVLTWYVQYMDKAPRFLLRNAKENQQTESRGFQVSFVKSHSSFYLKKPSLQLSDLAVYYCALWTW
Tympanoctomys barrerae V860 trbv NDGN011330920.1 4711 HLEAGITQSPRHKVMNTKQKVTFKCHQTDNHDRMYWYCQDPRHGLRLMQYSCGVNYLDKGEVLDGYNVSRENTEDFLLTLESATLSQSSVYFCASSD
Tympanoctomys barrerae V861 ighv NDGN011331722.1 3721 VQAEVQLMESGGGLVQPGGSLRLSCAASGFTFSSYGMSWVRQAPGKGLDWVSTISYDGSSTYYANSVKGRFTISRDNSKNTLYLQMNSLRPEDTSVYYCAK
Tympanoctomys barrerae V862 ighv NDGN011331841.1 3074 VLSLTLRESGRNLVKPGETLSLTCTVTGGSVTSSYAWSWIRQPPGKALQWMGYWAGSTEYNPAFQGRISITADTAKNQFSLQLKSVTTEDTAMYYCA
Tympanoctomys barrerae V866 igkv NDGN011336414.1 345 GRGDIQLTQVPSVSASLGERVTISCRSSQGISSSLHWYQQKPGQAPKLLIRYATTVESGVPSRFSGSRSGTDFTLAISGLESEDVATYFCQQSYNWP
Tympanoctomys barrerae V869 igkv NDGN011337257.1 419 GRGDIQLTQAPSVSASLGETVTISCRSSQGISSSLHWYQQKSGQAPKLLISYASTVQSGVPSRFSGSGSGTDFTLAISDLESEDVATYFCQQGYSSP
Tympanoctomys barrerae V873 ighv NDGN011344871.1 5246 ARGQVQLVQSGAELKRPGTSVKVSCKASGYTFTSYFMHWVQQRPGQGLEWIGRIDPEDGETKYAQKFQGRAMITADTSSNTAYMELSRLNSEDTAVYYCA
Tympanoctomys barrerae V882 iglv NDGN011355727.1 3706 LCGLPVLTQNPLASAFLGASIKLTCTLSSEHSSYYIEWYQQRPGRSPLYVMHLKSDGSSSKGDGISDRFSGSSAGVDRYLTISDLRSEDEAQYYCGVSH
Tympanoctomys barrerae V883 ighv NDGN011355993.1 6746 VLCDPTLRESGPNLLKPGDTLSLTCTVTGGSVTSSYYWSWIRQPPGKALQWMGFWSGYTRYNPAFEGRISITPDTSKNQFSLQLNSVTTEDTAMYYCAS
Tympanoctomys barrerae V887 ighv NDGN011358986.1 1404 VQAEVQLVESGGGLVQPGGSLRLSCAVSGFTISGYGMAWIRQAPGKGLDWVSTISSSGSTYYADSVKGRFTISRDNSKNTLYLQMNSLITEDTAMYYCG
Tympanoctomys barrerae V898 ighv NDGN011369195.1 4374 VLSDLTLRESGQNLLKPGETLSLTCTVTGGSVTSAYGWNWIRQPPGKALQWMGYWSGSTDYNTAFQGRISITADTSKNQFSLQLNSVTTEDTAMYYCAR
Tympanoctomys barrerae V904 trdv NDGN011374424.1 6627 KGTLCDEVTQSPPYQTVTSGSETMLLCTYSTGYSNPVLYWYRKVAGQPLQFILYRDNSLSRDADFVQGRFSVKRSKTHKTFDLVISPVKTEDKATYYCALA
Tympanoctomys barrerae V912 trbv NDGN011378676.1 1219 HLEAGITQSPRHKVVKTKEEVTLKCHQTDNHDYMYWYGQDPGRGLRLIYYSRYVKSFDKGEVPDGYNVSRENTEDFPLTLESTTLSQSSVYFCASSY
Tympanoctomys barrerae V915 ighv NDGN011380242.1 1235 VLSQVQLQESGPGLLKPSETLSLTCTVSGLSLSSNHFGWIRQAPGKGLEWMGNIYSGGSKDYNSALKSRLNIGRDTSKNQVSLTLSSLKTEDTATYYCAR
Tympanoctomys barrerae V918 trav NDGN011382245.1 2314 RICGQSVIQMEGPVSTIEGALLTINCSYTASGYPVLLWYVQYPREGPQLLLKTVKANEKGRSKGFEATNDRSTSSFHLEKAFMQVSDSGVYYCAMS
Tympanoctomys barrerae V920 iglv NDGN011384615.1 5254 SLSQALVTQEPSLSANPGASVRLACTLRNDISVGGYSIYWYQQKPGSPPRFILRYYSDSSKQLGSGIPSRFSGSKDNSANGGVLHISGLQPEDEADYYCMI
Tympanoctomys barrerae V925 iglv NDGN011389599.1 2862 AGSQAVVTQEPSLSTTPGGTVTLTCGSSTGAVTTGHYPAWVQQTPYQTPQGLIGSTSSRAPGVPARFSGSLLGAKAALTITGAQAEDEATYYCLLWYSSH
Tympanoctomys barrerae V926 iglv NDGN011389674.1 2930 SWAQAVLTQPPSVSGSAEETVTISCTGSSTNIGGGYSVHWYQQLSGTAPKLIIYNNSNRPSGIPDRFSGSKSGSSASLTINELQPEDEADYYCQSYDYNLGA
Tympanoctomys barrerae V927 ighv NDGN011390574.1 885 VQAEVQLVESGGGLVQPGGSLRLSCTASGFSGFSYYYMNWIRQAPGKGLEWISEISDDSSDINYADSVKGRFTISRDNSRNTLYLQMSNVRSEDTALYYCAT
Tympanoctomys barrerae V936 trav NDGN011400114.1 1847 LKGEDPVEQRPRTLGPQEGDATSMSCIYPVSISEHLQWYRQEEGLGLQHLFSVYSAGDVKQKGRLSVTLLKNGSSLSIVASQPEDSATYFCAV
Tympanoctomys barrerae V937 trav NDGN011403692.1 520 VKGLQVEQIPPAQILQEGANSTLWCKFSEPVSTVQWFRQDPGGRLVSIFYIPSGTKQSGRLKAMTIAKERHSSLSVSSSQPTDSATYFCAAAHSAPRA
Tympanoctomys barrerae V938 trav NDGN011405415.1 696 TSIAQKVTQVQTVASVQETEAAILNCTYDTTYGNYALLWYKQISSGKIVILFRQGSYDQQNAKEGRYSLYLQKASKSVQLVISASQLVDSALYFCALL
Tympanoctomys barrerae V953 trgv NDGN011421639.1 1390 GLGLNKVEQSQISISTQLKKSVDIHCKVSTSNFESARIHWYRQKYDQVFDYLVQVASSTTPAQGTISRVSARKISATLSSILTLNYVEKEDEAIYYCARWR
Tympanoctomys barrerae V963 ighv NDGN011431090.1 952 AQGQVQLVQSGAELKRPGDSVKVSCKASGYTFTSYEIHWVQQRPGQGLEWIGWIYPGNGNTGYAQKFKGRATVTADKSSSTAYMYLSSLKSEDTAVYYCAR
Tympanoctomys barrerae V972 ighv NDGN011439511.1 3463 VHGDVQLLQSGAELKKPGASVKISCKASGYTFTSYWMSWVKQRPGQGLEWIGIIGPSDGDDRYAQKFQGKATLTADKSSSAAYMELRSLKSEDTAMYYCA
Tympanoctomys barrerae V980 igkv NDGN011443754.1 1920 ASESVVLTQTPASLNVALGERASIICRASEYVSDYLTWYQQKPGQIPRILIYDADNQFPGVSDRFTGRQDETKFIFEIKRVEAGDAGTYYCQQSYAAP
Tympanoctomys barrerae V982 ighv NDGN011444332.1 6342 VLSQITLKESGPGLVTPTETLRLTCSFSGFSLSATNIGIGWIRQPPGKGLEWLAHIYWDDDKRYNQALKSWLSISKDTPNNQVFLTMSSVDPADTATYYCARK
Tympanoctomys barrerae V986 trav NDGN011446564.1 1717 VAGQSVEQPTELMTMEGASVQVNCTFQTSGFNGLYWYQQRDGGAPVFVSYIVLDGLQNRSRFSTFLHRSDGYSYLLLRELQIEDSASYLCAVR
Tympanoctomys barrerae V987 iglv NDGN011446617.1 4029 SWAQAVLTQPASMSGSPGETVTISCSGNSNNLGRHYVHWFQQLSGTAPKLIIYNNSDRPSGVSGRFSGSKSGNSGSLTISELQSEDEADYYCQSYDSSLSA
Tympanoctomys barrerae V989 iglv NDGN011447696.1 3473 SMASYVLTQPSSVSVTLGQTATITCEGNNIGGNYVHWHQQKASQAPVLVIYEDSNRPSGIPDRFSGANSGNTATLIISSAQAEDEADYYCQVWDSSTR
Tympanoctomys barrerae V990 iglv NDGN011447771.1 2431 VESQAVVTQEPSLSTTPGGMVTLTCGSSTGAVTTGHYPAWFQQKPYQTPQGLIGETSSRAPGVPARFSGSLLGDKAALTITEAQAEDEATYYCLLWQGNY
Tympanoctomys barrerae V995 trgv NDGN011449324.1 2496 GLGQLEQPEISISRARDESVQIPCKASISNFKNVDIHWYRQKLNQGFEHLMYVRTAYNQRPLGGVNKKLETNKNFDTSTSNLKINFLKKEDEATYYCTYWD
Tympanoctomys barrerae V998 igkv NDGN011450132.1 8971 DSLAETVHTQSPALLPVAVGDQATITCRASTDIDDDMHWYQQKPGESPKLLIKYATGLISGVPSRFSGSGYGTDFTLTINDLKREDAAYYFCQHDDNLP
Tympanoctomys barrerae V999 igkv NDGN011450132.1 1272 MRYDIQLTQSPSIQSASIGDQITLTCKSSQGITNDLAWYQQKPGKAPKCLIYEANSLQSGVSSRFSGSGYGTDFTLTIRNLEAEDFATYYCQQYNNWP
Tympanoctomys barrerae V1004 iglv NDGN011451365.1 2711 LDSQLVLTQESSLSTAPGGTVTLTCSANTGAVTTNNYANWVQQMPYHAPKGLIYGTSSRYAGVPARFSGSLLGDKAALTITGARSEDEATYYCLIWYSNH
Tympanoctomys barrerae V1005 igkv NDGN011452231.1 5783 TRCDIQMTQSPPSLSASPGDRVTITCRASEDIYSALSWYQQKPGEAPRLLIYGASILHDGVPARFSGSGSGQEYTLTISSLQPEDVATYYCQQGSSFP
Tympanoctomys barrerae V1007 iglv NDGN011452835.1 5130 SVASYVLTQPSSVLVTLGQTATINCEGNNIGGRYTYWYQQKSSQAPALVIYEDSKRPSGIPDRFSGANSGNMATLTIEGAQAEDEADYYCQVWDSSTD
Tympanoctomys barrerae V1019 trbv NDGN011459854.1 1088 FGLGVLVLQHPSRAICKSGSSVKIECRYVDLQATVVFWYRQHPKQSFELMATSNMNSKGSYEQGFTEAKFPISHPNLTYSTLTVTNAHPEDSSSYFCVGS
Tympanoctomys barrerae V1020 trbv NDGN011459951.1 1096 TVDGGITQTPKFRFIQKGQSVTLECEQNLNHPRMFWYRQDPGQGLRLIYFSIEVDVIQTGDITEGYTASRKKKESFLLTMNSAQKDQAAVYLCASSL
Tympanoctomys barrerae V1021 ighv NDGN011460175.1 3810 VHAQVQMVQSGPELKRPGESVKVSCKGSGYTFTDHGITWVKQVPGKGLQYMGWINTYTADPTYAEGFKGRFVFSMDTSVSSAYLQISSLQDEDTAVYYCA
Tympanoctomys barrerae V1026 ighv NDGN011464190.1 6022 VQSEERLVESGGGLVQPGGSLRLSCVGSGFTFSSYVMYWIRQAPENGLEWIALISQTGKNIYYADSVKGRFTISRDNDKNTAYLQMSNLKTEDTAVYYCT
Tympanoctomys barrerae V1027 ighv NDGN011464473.1 3315 AHGEVQLVQSGAELKKPGASVKVSCKASGYTFTSYDMHWVRQSPGQGLEWIGGVSPGSGYTAYAQKFQGRATITADKSSSMAYMELRSLKSEDTALYYCAR
Tympanoctomys barrerae V1034 igkv NDGN011469104.1 1333 GRGDIQLTQAPSVSASLGERVCITCRASQDIGTVLHWYQQNTGEVPQLLIYCTTSSHSGVPSQFSGSRCGTDFTLAISSLESEDAATYYCQHSYDWP
Tympanoctomys barrerae V1036 igkv NDGN011469642.1 11155 GRCDIQLTQTPSVSASLGERVTISCRASQDVSNYLYWFQQRPGQAPKLLISYATTVQSGVPSRFSGSGSGTDFTLAISSLESEDVATYYCHSKSW
Tympanoctomys barrerae V1037 igkv NDGN011469642.1 3948 TSGEIVMTQSPASLALSAGEIATLSCRASQSVSSYLAWYQQKAGQAPRLLLYGASTRATGVPTRFTGSGSGMDYTLTISRLEPEDSAVYLCQQGYSG
Tympanoctomys barrerae V1047 igkv NDGN011473963.1 691 GRGDIQLTQAPSVSASLGERVTITCRASQGISSSLHWFQQPPGQAPKLLIAYTNQLPSGVPSRFSGSGSGTDFTLTINGLESEDLATYYCLQTSSFP
Tympanoctomys barrerae V1064 igkv NDGN011485854.1 2627 ARCDILMTQSPSFLPASVGDTVIITCRASEDTGIALHWYQQKPGKAPKLLIYAAAELESSVPTRLSGSGSRTDFILTIRSLELEDAGTYYCLQTWDDP
Tympanoctomys barrerae V1074 igkv NDGN011490390.1 1576 VCSDIVMTQSPGTLVVSAGESATIHCKSSQSLLYNGYNYLAWYQQKPGQSPRLLISWASTRASGVPDWFSGSGSGTDFMLTIANLQAEDVADYYCHQYRSSP
Tympanoctomys barrerae V1082 ighv NDGN011501607.1 1127 VLSQVQLRESGPGLVKPSQTLSLTCSVSGFSIATSGYCWDWIRQRSGKGLMWMGRICWNGNTNYSPTFKSRVSITRDASKNEFFLQLSAVTTEDTAVYYCA
Tympanoctomys barrerae V1090 igkv NDGN011508785.1 1741 VLCDIHVTQAPPSLPPSFGDRVTITCRASENINNHLNWYQQKPGHSARFPIYAASIFASGLPPRFSSSGSGTDYTLSISSLEAEDSATYYCLQYHQYP
Tympanoctomys barrerae V1096 igkv NDGN011513614.1 9818 SAADVMLTQSPLSLSVTPGEPTSISCRSSQSLLDSRGNSHLHWFLQKPGQAPRAWIHFVSNRDPGVQDRFSGSGSGTDFTLRISRVEAEDVGVYYCLQA
Tympanoctomys barrerae V1114 ighv NDGN011531359.1 2089 VEAEVQMVESGGDLVKPGGSLRLSCMASGFTFTSCWMHWIRQAPGKGLQWISYVTGDSKGLNYADSMKGQFTISRDNSANTLYLQMNNLRPEDTAVYYCK
Tympanoctomys barrerae V1127 iglv NDGN011541518.1 1104 SWAQTVLTQPPSVSGSPGETVSISCTGSSTNIGSDYVSWYQQLSGTAPKLIIYENNKRPCGVPGRLSGSKSGSSGSLTISELQPEDEADYYCQSYASSLCA
Tympanoctomys barrerae V1132 igkv NDGN011545618.1 2814 SRCDIQMTQSPSSHSASVGDTVTINCKASQNIGSYLAWYQQKPGKEPKLLIYAASGLASGVPARFSGSRSGQDYTLTISSLQPEDVATYYCQQANSLP
Tympanoctomys barrerae V1133 igkv NDGN011545926.1 662 ARCDIWVTQSPTSLSAAVGDTVTITCKASENIGYSLNWFQQKPGEAPTLLIYGADSLKSGVPPRFSGSRSGTDYSLRISSLEPEDGATYYCLQLSKSP
Tympanoctomys barrerae V1135 igkv NDGN011546644.1 2019 VCSDIVVTQSPRSLTVSPGESATIHCKASQSILDSTDNKNYLSWYQQKPGQSPKRLIYWASTRASGVSDRFSGSGSGKDFTLTIKNVQAEDVGDYYCQQDYDTP
Tympanoctomys barrerae V1138 trgv NDGN011547270.1 3643 ALGQLEQPEVVISRATDKSASMACNASIRGFGSKAIYWYRQKPNEGLKHLLYVSGSTNKVNFGGKKNKFEASKNTKASTSTLKINFLEKGDEAVYYCAYWTSS
Tympanoctomys barrerae V1139 ighv NDGN011547665.1 1324 VHGQVQLVQSRAELKRPGASVKVSCKASGYSFTSYWISWVQQSSGQGLEWIGRIDPSDGYTSYAQKLQGRVTITADKSSSTAYMELRSLKSEDTAMYYCA
Tympanoctomys barrerae V1142 igkv NDGN011548624.1 4483 LGTRCETWMTQSPAPILEAVGDTVTITCQAGQETSNDLNWDQQKPGKARQLLIYGAENLASGVPSRFSGSGYDTDFTLTISSVQPEDVATYYCQQNIILP
Tympanoctomys barrerae V1145 iglv NDGN011549504.1 4846 SMASFILTQPPSVSVAPGKTAKITCSGAKLSDAYAQWYQQKPGQAPVMIIYGDSERPTGIPDRFSGSSSGSTATLTISGAQPEDEADYYCQSYDSSDV
Tympanoctomys barrerae V1160 iglv NDGN011557488.1 1965 AESQAVVTQESSLSTSPGGTVTLTCASSTGAVTTSNVATWVQQKPYQTHRVLVYGTSYQISGVPARFSGSLLGDKAAFTITGAQPEDEATYYCALLY