WGS Statistics
Organism WGS Record. Vs Total IGHV IGLV IGKV TRAV TRBV TRGV TRDV
Chelonia mydas AJIM00000000.1 (AJIM01) 207 57 25 49 40 13 16 7
Vgene Table
Organism Vgene Locus contig Contig Pos. AA sequence
Chelonia mydas Vs43 trav AJIM01142881.1 7685 TLGQYMVTQDRSQAPAHEGEPIQLNCSYTGTEYSVHWYRQPQWGQPQFMALLSSSGRDTGENFTMSLDTKTKSSFLYLNSSRLEDSAVYLCAM
Chelonia mydas Vs45 trav AJIM01142884.1 1021 SSMEDAVTQTQPSVSGVERESVSLDCTYETVASSYIFYWYKQLPREKVIFLSWQHSGGEKTNEAGERFFFNLEKSKSSVSMRITELELGDAAMYFCAFSR
Chelonia mydas Vs44 trav AJIM01142883.1 6533 SCCEAQLVQRPESLVVQEGDISTVTCTYTSAYQTFLWYQQLPPERARPPVTVNARETATDGWFMGEHLEDLKSSSRHSSDSQLGDSGPYLCGME
Chelonia mydas Vs47 trav AJIM01142899.1 4848 GTCGADSVTPTEGSVIIRQGDPVRLNCTCQFSLTATLTYPFWYVQFPSQPLRLFLRDLGREDSDEGITKGFDATHDKKHKSFHLWKPSSELSDSATYYCAVR
Chelonia mydas Vs46 trav AJIM01142899.1 2842 GIYGESVNQTEGIVMVSQGDPVLLNCTYEFPGYPSPFWYVQDPNQPLTLFLRDVGRGGADEGARRGFNAKAERKTASFHLWKPSSELSDSATYYCAVS
Chelonia mydas Vs48 trav AJIM01142899.1 6645 GTYGADSVTQTEGTVTISQGDPVRLNCTYQFSSSVTVYPFWYVHFPSQPPRLLLRDLGRDDSDEGIRKGFNATHDKKLKSFHLWKPSSELTDSATYYCAAS
Chelonia mydas Vs973 trdv AJIM01266889.1 15274 APRWALAQIFQPPWLTYVEEERILIPCSQNATSHDMMSWYKQPQQGQGAPSFLGIGHDGSSTAGEFTMAVDKAARSTNLTRGGASLSDAGIYYCTVR
Chelonia mydas Vs929 trbv AJIM01248087.1 4699 MESAYVEQQPFLTGAQENPKTLQCTLKQTSYNWMYWYRRREGRKLEGLFNSLASGSGTNFTAEPMTALRNNTKWDLTWRSLSLSDSAVYYCAC
Chelonia mydas Vs590 trgv AJIM01142903.1 24789 GCAQIRLRQARLSVTRAENKISRIDCEASGIQNFGSAVIHWYRQRPGEAPERILYISSEKPVFDKDTSKKKFDCEKKPDQPISTLVVNAITPNDRAIYYCAYWD
Chelonia mydas Vs591 trgv AJIM01142903.1 6326 GEAQVLVQSQLSITRAENKTARIDCHVSGITLSTAYIHWYRQRPDAALERILYLSSGKPVFDQDSEKGKFMADKQLSKSTCTLTVNKISKSDAATYYCAAW
Chelonia mydas Vs592 trgv AJIM01142903.1 2451 GCAQIHLRQAQLSVIRAENKTARIVCEASGTENFGSAVIHWYRHRPGEALEQILYFKTQAEKSSFDKNKFRVDKTTEKSTCTLTVGKLTYNDMATYYCAYWH
Chelonia mydas Vs867 iglv AJIM01222284.1 1152 SLAQYVLTQPPSASVSPGQNARLTCSGSNIGSKNVQWYQQKPGSAPLLVIYGDSSRPSGIPDRFSGANSGNTATLTITGVQAQDEADYYCQVGDS
Chelonia mydas Vs598 igkv AJIM01144271.1 5142 ASGQIVMTQTPESLAVSPGDRVTINCKASSSVSTSYMSWYQQKSGQAPKLLIYSASTRPSGVPDRFSGSGSGTDYTFTISRVEADDAGDYYCLQGYSLL
Chelonia mydas Vs599 igkv AJIM01144271.1 2523 SSGQIVMTQTPESLAVSPGDRVTINCKASSSVTSGSTHYIAWYQQKSGQAPKLLIYYASTRASGIPARFSGSGSGTDFTLTISNVQAEDAGDYYCQQSYS
Chelonia mydas Vs622 ighv AJIM01149976.1 4041 VLSQVQLAQSGPGVVKPGATLTLTCAITGDSVTSRYWEWVRQAPGKGLEWVGQIDWSSSKWRIYYGPSFQSRATLSADSSKNQFSLQLRSLTAADTATYYCARR
Chelonia mydas Vs623 ighv AJIM01149978.1 10391 VRSQVQLVESGGDLKKPGDSLRLSCKASGFIFSSQGMSWVCQAPGKGLEWVAEINRAGSSQWYSPAGQGRFTISRDNSNSLVYLQMTGLRAEDTSRYHCAR
Chelonia mydas Vs620 ighv AJIM01149971.1 1462 VRSQVKLLQTGAAQVKPSQTLRLTCSVSGFSLTEYGYGVSWIRQPQGKGLEWLSTVYWDEDKYYQESLKNRLTISRDTSKSEVYLEMRGMEAGDSGIYYCARR
Chelonia mydas Vs621 ighv AJIM01149974.1 2909 VLSQVQLVESGPGMVKPGQTLTLTCAVSGVSITDSSYAWSWVRQPPGKGLEWVASIYPYDGRKWFAASLQSRTTISSDTSKNQVSLQLASLAAADTAMYYCAR
Chelonia mydas Vs4 ighv AJIM01044977.1 66 VHAWIQLVQSGPGAVKPRETLTLTCTDSGQSITSGHGWHWVRQPPGQGLGWLGGGYCSSTWYTNYGSSFQNRITISPDSSKNRFSLQLASLGAADTTTYYCTRE
Chelonia mydas Vs624 ighv AJIM01149978.1 8715 ALPRESPQYFPFISYSPGVYCPVVSGPRQPAGKGLEWVGATWTSGGTAYSDALKSRLTITRDTSKSQVFLQLTGLQPADTSVYYCARDTQ
Chelonia mydas Vs625 ighv AJIM01149978.1 4788 VRSQVVLTQSGPEVKKPGESIQLKCTVSGFNPDDYWMYWIRQAPGKGLQWLVSYWKSSVSNHYSPIVQGRVRVSKDSSSFYLQINSLKPEDSAMYYCAR
Chelonia mydas Vs365 iglv AJIM01223458.1 530 SSCQLTLTQPLTMSVTPGETAQLACVLSSGYSISNAYIRWYQQKQGEKPRYLLTYKDDSTQHQGSGVPERFTASKDTSRNTCFLTISRAQGEDDADYYCLDWD
Chelonia mydas Vs455 igkv AJIM01252480.1 5167 SSGDIVMTQTPESLAVSPGDTVTIRCKASSSLTSGSNHYLAWYQQKSGQAPKLLIYRASTRASGIPDRFSGSGSGTDYTLTISRVEADDAGDYYCQQYYSTP
Chelonia mydas Vs454 igkv AJIM01252478.1 1926 SNGQIVMTQTPESLAVSPGDTVTIRCKASSSLTSGSYHYLAWYQQKSGQAPKLLIYLASTLQSGVPARFSGSGSGTDYTLTISKVEAEDAGDYYCLQTRSYP
Chelonia mydas Vs457 igkv AJIM01252480.1 16734 ASGQIVMTQTPESLAVSPGEKVTINCKASSSLTYLGNDYLAWYQQKMGHAPKLLIHSTSIRASGIPARFSGSGSRTDFTLTISRVEAEDAGDYYCQQGSETP
Chelonia mydas Vs456 igkv AJIM01252480.1 7381 ASGQIVMTQSPESLAVSPGEKVTISCKASSSLTYQGNDYLAWYQQKMGQAPKLLIYLASTRASGIPARFSGRGSGTDFTLTISSVEAEDAGDYYCCQ
Chelonia mydas Vs518 ighv AJIM01268506.1 8997 MPKPGETLTLTCTISGPSSDTLSSSCCWWTWIRQEPGKGLEWMGDVSKEGTTHYAPSLQSRVTISAEPAKNQVSLQLRSLAAADTARYYCVRK
Chelonia mydas Vs450 igkv AJIM01252476.1 111 SSGDIVMTQTPESLAVSPGDTVTIRCKTSSSLTSGSNHYLAWYQQKSGQAPKLLIYLASTLQSGVPARFSGSGSGTDYTLTINRVEAEDAADYYCQQTYETP
Chelonia mydas Vs453 igkv AJIM01252477.1 8340 SSGQIVLTQTPESLTVSPGDRVTINCKASASLTSTSSGKELLAWYQQKSGQAPKLLIYYADTLHSGVPARFSGSRSGSDYRLTISRVEAEDAGDYYCQQGKSYP
Chelonia mydas Vs452 igkv AJIM01252477.1 2364 SSGDIVMTQTPESLAVSPGDTVTIRCKASSSLTSGSNHYLAWYQQKSGQAPKLLIYLASTLQSGVPARFSGSGSGTDYTLTINRVEAEDAADYYCQQTYETP
Chelonia mydas Vs514 ighv AJIM01268494.1 21420 QVGGIRWGSQETRGDLKTTCTVFGFLVTGYAVNWVRQPAGKSPQWMGILWGGGSTDYNPALGGRISISREAAKSQVYLQGNRAGEEDSAIYYCAVKYGLG
Chelonia mydas Vs515 ighv AJIM01268498.1 3997 QLQETGPGAVKPGESLTLTCTISGDSVSSTSATWDWVRQPVGKGLEWVGRIYYRSSQWYTNYASSLQSRTTIAQDTSKNQFSLQLRSLAAADTGRYYCAR
Chelonia mydas Vs516 ighv AJIM01268500.1 5928 QLVESGPGTVKPSETLSLTCSISGASSDTLGGNCCWWSWIRQSPGKGLEWMGNINRGGSTNYAASLQSRITISVNPSKNQFSLQLRSLTAEDTATYYCARE
Chelonia mydas Vs517 ighv AJIM01268502.1 1941 QLVPSGPGVVKPGETLTLTCAVSGESSGIISSGCCYWSWIRQSPGKGLEWMGRITKDGSTNYAPSLQSRITITVDSSKNQFSLQLRSLTATDTATYYCAR
Chelonia mydas Vs459 igkv AJIM01252481.1 13140 SSGQTVMTQTPESLAVFPGDRVTINCKASANITGTYTYLAWYQQKTRQAPKLLIYYASTRAPGIPDRFSGSGSGTDFTLTINSLQAEDAGDYYCQQGYG
Chelonia mydas Vs458 igkv AJIM01252481.1 4222 AKGQIVLTQTPESLAVSPGDRVTINCKASSSVSSNMAWYQQKSGQAPKLLIYSASTRPSGIPDRFSGSGSGTDFTFTISRVEADDAGDYYCQQAQSWP
Chelonia mydas Vs108 ighv AJIM01155931.1 5238 AQSQMQLVESGGAVRNEGESIRLSCKGTGFTFSSYNMYWYRQRPGESPEFVSRIYYDGTDPRYAAWAQGRFTISRDNARSELSVKWSPLRREDTARYHCAARE
Chelonia mydas Vs163 ighv AJIM01168941.1 2377 VRSQVQVVESGGDVKKPGDFLRLSCKGSEFIFSDYWMSWVRQAPGKGLECIGEIHPTSTTINYTQPFKGRFTISTDNSNNLLYLQMTGLRPEGTARYYCA
Chelonia mydas Vs162 ighv AJIM01168779.1 4241 AWSQIQLVQSGPGVVKPGEPLTQTCAVSGYTISSGSDWAWIRQAPGKGLEYMGYIYGPSRGTNYAPAFQSRIAITADTAKNQFSLQLRSLTAADTATYYCAR
Chelonia mydas Vs204 trgv AJIM01178854.1 8512 VLCAIHLEQEQISVTKQPLQGSSAKFTCKVFGGSDSTYIHWYRAPAGEAPHRLLYLTLSGSELQLEAAFPKEKFLAYGRQSTCILFVHKLEETDSGRYYCATWDF
Chelonia mydas Vs205 trgv AJIM01178854.1 17011 GEAQVLVQSQLSITKAEDRTARIDCHVSGITLSTAYIHWYRQRPDAALERILYLSSGKPVFDQDSEKGKFEADKQLSESTCTLTVKKTTKSDAATYYCAAW
Chelonia mydas Vs206 trgv AJIM01178854.1 24403 GCAQIHLRQARLSVTRAEKKTARIVCEASGIQNFRSAVIHWYRQRPGEAPERILYISSEKVQFDKDSDKKFDGENNPDQPISTLRVNGINPNDRAIYYCAYWD
Chelonia mydas Vs201 trav AJIM01177848.1 2755 AALGDSVQPEESQVSGTEGDSVALRCSFDTSSTDYVYLNWYRQHPNQALQYILKRGVKRAQGYTHTADFAKKRYSSQADDSSIVLNIASLELADTAVYYCALER
Chelonia mydas Vs34 ighv AJIM01142254.1 5677 SEAAITLTQPSSVRAKPGSSITLDCVVSGYNINDHHLHWVRQAPGKRLVWVTAFRTGYATITANEFKGRVTPSTSGSTARLKIDRLTAADTATYYCARE
Chelonia mydas Vs35 ighv AJIM01142256.1 5500 GQSQVQLVQSGAEIKKPRDSLKISCKTSGFTLPSYYMSWLQQTPGKGLAWVGRIDPEDGATIYSQSFKDRFSITTDNSISTMYLQLRSLRAEDTAVYYCA
Chelonia mydas Vs37 ighv AJIM01142257.1 2805 VQSEVQLVQSGAEMKKPGESVKISCKTSGFTLTDYYMYWIRQTPGKGLVWIGRIDPEDGATRYADSMKNRVTISTENSISTVYLQLRSLRAEDTAVYYCA
Chelonia mydas Vs38 ighv AJIM01142257.1 5955 AQSEVQLVQSGAEIKKPGESVKLSCKTSGFTFTSVYMQWVRQTPGKGLVWVGRTDPEDSETKYSESFKGRFTITTDNSISTAYLQLNSLRIEDTAVYYCA
Chelonia mydas Vs39 ighv AJIM01142257.1 7872 VQSEVQLIQSGAEMKKPGESVKISCKTSGFTLTDYYMHWIRQTPGKGLVWVGDIDPEDGATSYADFMKNRVTISTENSISTVYLQLRSLRAEDTAVYYCA
Chelonia mydas Vs969 trdv AJIM01266401.1 36744 KGFLCNKISQTPSVLTVKMGNKTKLCCNFDTQQMNPGLYWYRLVSNKALQLILYRDNSRSFDAHFVKERFSVRRDHARKAFHLLISAILSEDSATYYCAMR
Chelonia mydas Vs616 trbv AJIM01147818.1 4015 LADAKITQTPSLVLERGQTAYLRCEQTYGHNNMFWYRQDLGQGLQLLFYFSYKEEREKGTNFSNFQADQPRDDLFRLNISSVQLEHSAVYFCASSL
Chelonia mydas Vs615 trbv AJIM01147818.1 14391 TRSATIVQSPQSMVEQLGSQASLECSLEGTSNPNIYWYRQLPGGQIHMLAYSVSTGQADNTGPNHINASRSKDEEFLLSINGLLADDTGVYYCAW
Chelonia mydas Vs614 trbv AJIM01147816.1 2911 QTDAKITQTPSLVLERGQTAYLKCQQKYGHDSMFWYRQDPGQGLQLLFNFYYKKEREKGTSSSHFQADQPQDDLFRLNISSVQPEDSAVYFCASSS
Chelonia mydas Vs613 trbv AJIM01147815.1 2578 HTDAKITQTPSLVLKKGQTAQLTCRQTDDHNSMYWYQQQQGKGLQLIYYSVAAENKEKGDIKDGFTASRPQIEIFDLNISSVKIEHSAVYFCASSL
Chelonia mydas Vs195 ighv AJIM01175317.1 2027 VRSQLLVESGGDVKKPGDCLRLTCKASGFTFSSYGMSWVRQAPGKGLEWVADIKSDGSSQWYSPAVQGRFTISRDNAKSELYLQMTGLKPEDTARYYCA
Chelonia mydas Vs196 ighv AJIM01175318.1 862 VLSQVQLLESGGDVKKPGDSLRLTCTTSGFNIDSYWMSWVRQAPGQGLEWVSAINGATKYYGDSVKGRFTTSTDSSKKLIYLQMTGLKPEDTGRYYCAR
Chelonia mydas Vs197 ighv AJIM01175403.1 699 VRSQTLVESGGDVKKPGDSLRLTCKASGFKVGDYGMYWVRQAPGKGLEWVSSIYWELWNRYYYADSVKGRFTISRDDSNNLLHLDITDLKPEDTAWYYCAR
Chelonia mydas Vs110 iglv AJIM01155982.1 18586 SSSQPVVTQPPSVSVSPGNTVKLSCTGSSGTSIADYYMSWYQQKPGNSPRYLLNYYSDSDKYQGSGVPARFSGSKDTSSNAGYLTISRALAEDEADYYCTVWKS
Chelonia mydas Vs111 iglv AJIM01156187.1 553 VSSQPVVTQEPSMSVAPGGAVTLSCSLSTGAITTSNYPSWYQQKPGSAPKLLIHSTNSRPSGIPTRFSGSISGNKAALTITGVQAEDEADYYCAVWASSA
Chelonia mydas Vs692 ighv AJIM01169889.1 3384 VSSQIQLTQSGAEIKKPGESVKVTCKPSGYTFTSYGMNWVRQAPGKGLLEWIGYSYPSSGSTGYAQAFQGRFTITRDTSISTAYLQLGSLRTDDTATYYCAR
Chelonia mydas Vs758 iglv AJIM01190452.1 936 SVAQIVLTQPPAVSVSPRQNAQLTCTGEKFDKQYVQWYKQKPGRAPVLVIYKDSQRPSGIPDRFSRASSGNTATLTITGVQAQDEADYYCQVWDKDS
Chelonia mydas Vs759 ighv AJIM01190624.1 464 AGSQVVLTQSGPEMKKPGESTRLKCAVSGFTITSYYMAWVRQETGKGLEWLVSYWKPGSEYYSPTIKGRFTASKDSSNFYLQMNSLKPEDTALYYCVR
Chelonia mydas Vs119 trav AJIM01158213.1 9821 LGVQLFLYQTQQIQFVEVNGSAEIHCSSKEKMEGDDMFWYLRREGEKPICIKYCLDNLNVSKFACKHERHSSTLEINNIQKNETGVYYCAFI
Chelonia mydas Vs278 ighv AJIM01199833.1 1248 VHSQIQLVESGGGVKTTGDSIRISCKASGFPFGNYWMFWYRQDPGKAAEWISYINPDSTKADSGHSVKGRFTISRDNPSNLLYLQMTGLRPEDTAVYHCVR
Chelonia mydas Vs170 trbv AJIM01169868.1 8815 VGSAYVEQLPFFVGGLGESSTLQCTLKQTSCKYMYWYRQQGGRELEGLFYSLEDGPGTNFTAKPMTALRSNKKWDLKWKSLSQSDSAVYYCAC
Chelonia mydas Vs593 trgv AJIM01142904.1 7542 GSSQVRPTQPQLSITRKGNKAIRIDCRVSLSEDFGKAPIHWYRQRPGAAPERILFISTQSEFDRVSDKGKFNAEKKIDQSTCTLTINKITSSDIATYYCAYW
Chelonia mydas Vs612 trbv AJIM01147814.1 4066 THSATIVQTPQSVVEQLGRQASLKCSLEGTSNPYLYWYRQLPGGQIHMLAYSISAGQVDNSGPSHFSISRTKDKEFLLNIKSLLANDTGVYYCAW
Chelonia mydas Vs55 trav AJIM01144284.1 7977 SLCEAQVVQSPEWLVAGEGEVSTMSCSFTSAYQTFYWYQQLPGQGPTHLLTTSSNDNVTVGRFIGERLESGKRSSLHITDSQLGDSGTYLCAVD
Chelonia mydas Vs29 ighv AJIM01140610.1 2613 ALSQVQLVESGGNARSPGKTLRLSCEASGFTFGSFEMHWVRQAPGKGPEWVAGISSGRGASQWYAKAVEGRFTVSRDNSANRVYLQINRLKPEDTARYHCA
Chelonia mydas Vs569 trav AJIM01139629.1 2808 AVLGDSVQSREPHLSGREGDAVTLPCSYETSSTGYIYLFWYRQFPNQAPQYILWRGVKQARGRSNTAGFAKKRFSSQADDSSTVLNITALELADTAVYLCALQR
Chelonia mydas Vs978 trbv AJIM01268402.1 13560 AGSAYVEQLPFLTGVPGESQTLRCTLKETSHYWMYWYWQQEAEELGQLFYSSGDGSGTNFTAKPMSAWRKNNNWHLQWKNLSRSDSAVYYCAC
Chelonia mydas Vs256 trav AJIM01193071.1 71 AALGDSVQSKEPEVSGSAGGSVTLSCSYTTSGSDAYLYWYRQYPNQAPQYILWRGAKSASQFSDTADFAKERFSSQADDSSTVLNITALELADSAVYYCALQR
Chelonia mydas Vs600 igkv AJIM01144273.1 6962 SNGQIVMTQTPESLAVSPGDRVTINCKASSSVSSNYMAWYQQKSGQAPKLLIHSASTRPSGIPDRFSGSGSGTDFTFTISRVEVDDAGDYYCQQGQSFP
Chelonia mydas Vs601 igkv AJIM01144274.1 482 TNAQIVLTQTPESLAVSPGDTVTIRCKASSSLTSGSYHLLAWYQQKSGQAPKMLIYDATSRASGVPTRFSGSGSGTDYTLTISRVEAEDAGDYYCQQYKS
Chelonia mydas Vs444 iglv AJIM01250395.1 145 FSSQQLQSLKASELVSPGGTVTLSCSLSSGAITDGNYPNWVQQRLGNVPRLIMYHTSTRPSGIPAHFTGSRSGNTMSLTITGALVEDDADYYCAVWTGSA
Chelonia mydas Vs682 ighv AJIM01166933.1 1586 VSSQIQLTQSGAEIKKPGESVKVTCKTSGYTFTSYYISWVRQAPGKGLEWIGYINPSSGGTSYAQAFQGRFTITRDTSISTAYLQLSSLRTDDTATYYCARDSM
Chelonia mydas Vs685 trav AJIM01167678.1 687 VQVQLFLHQLQSFLFVNINDTAKIQCSSKKQFLAGGITARWYRRREGEAPMLIKRCSDNQNVRKVACISEGQNLTLAIYNAQRNDSGVYYCTNSY
Chelonia mydas Vs572 trav AJIM01139633.1 2064 AVLGDSVRSNEPEVSRSEGVSVPLSCSYETSYTAGVYLCWYRQYRNRAPQYILRRGAKGIKTSDTAGFAQERFSSQANDRSTALNITALELADTAVYLCALQR
Chelonia mydas Vs573 trav AJIM01139635.1 33913 ETYGDSVSQTEGSRIISQGDPVLLNCSYEFSFNAFPFWYVQYPSGPPRLLLRDTGGEDWDMGIEKGFNATHDGQKKTFHLWKPSSELSDSGIYYCAAS
Chelonia mydas Vs570 trav AJIM01139631.1 524 AAFGNSVQSNEPEVSGSAGGSVTLSCSYTTSDSYAYLYWYRQYPNQAPQYILWRGAKSYSGQSNTANFAQKRFSSQADDSSTVLNITALELADSAVYYCALRL
Chelonia mydas Vs571 trdv AJIM01139633.1 3462 RDKAVSPKHKGSWKSWGGQTVTLECTFSTANQYYYLFWYRQQRSGRMDFLFRIDDSNDEENGAGRRFSAKFRKASKFFSLTIKELEPTDTAMYFCALVE
Chelonia mydas Vs576 trav AJIM01139636.1 814 ASGRAEIRQPVSAEAVEGAELNLTCSHASISNENVFWYRQFPNRGPQYIVSGYQGLFNSSDPEGALHIPKDRKSSALALSRARLADAAVYYCALS
Chelonia mydas Vs574 trav AJIM01139635.1 23710 QTYGNSVTQTEGTITVPEGKPVLLNCTYKTSGSPVLFWYVQYPHEAPRLLLTEYEATDEEERKRRRGFSAKHERNPISFHLNKNSSQVSDSADYFCGLS
Chelonia mydas Vs141 trgv AJIM01162888.1 2992 GCAQIYLKQAQLSVTRGKDKTASIDCEASGIQDFGNAFIHWYRQRPGEAPEWILYFKTQAEKSSFDKNKFRVEKTTEKSTCTLRVDRLTDNDMGTYYCASWD
Chelonia mydas Vs140 trgv AJIM01162888.1 53 ASSQVHLTQPQLSITTEGNKTLRIDCHVSLSEDFGKDPIHWYRQRPGAAPERILFISTQSEFDRVSDKGKFNAEKKIDQSTCTLTINKITSSDIATYYCAYWD
Chelonia mydas Vs147 trav AJIM01164188.1 1419 SALGDSVKSNQLEVSGSVGGSVTLTCSYTTSDTYVSLSWYRQYPNQAPQYILLRGAKGSTFSDTADFAQKRFSSQANDSATALNITALELADSAVYYCALQR
Chelonia mydas Vs146 trdv AJIM01164187.1 94 FSQGQGSVTQTQGQLEKLGGQTVTLECTFSTAKQYYYLFWYRQQRSGMMDFLFRIDDSNDEKNGAGRRFSAQFRKSSKFFSLTIKELEPTDTAMYFCALVE
Chelonia mydas Vs780 ighv AJIM01197438.1 4109 ARSQIQLAQSGPGVVKPGETLTQTCTVSGYTISSGYGWGWIRQAPGKGLEYMGYIYGPSQGTSYAPAFQSRITIAIDSSKNQFSLQLRSLTAADTGTYYCAR
Chelonia mydas Vs3 trdv AJIM01044004.1 265 FSQGQGSVTQTQGQLEKLGGQTVTLECTFSTANQYYYLFWYRQQRSGMMDFLLRIDDSNAEKNGAGRRFSAQFRKSSKFFSLTIKELETTDSAMYFCALWE
Chelonia mydas Vs58 trav AJIM01144288.1 6518 APGRADIQQPGFAEGLEGAELNLSCSHPSVTANEYIFWYRQFLNRGPEFIVSGFRGTIDSPDPEGALHISGDRKSSTLALRRARLADAAVYHCALR
Chelonia mydas Vs14 ighv AJIM01058406.1 143 VRSQVKLLQTGAAQVKPSQTLRLTCSVSGFSLTEYGYGVSWFRQPPGKGLEWLSIVYWNEDKYYQESLKNRLTISRDTSKSEVYLEMRGMEAGDSGIYYCARR
Chelonia mydas Vs757 trgv AJIM01190445.1 1190 GYSQITLIQTPLSVTRAVTESAYMRCKISGKSFNFNSAYIHWYRQTPGEAPKRILYIRSESVTMDSGFDRKKFKADNYVFASTSKFTVHQLTRDDAATYYCAIW
Chelonia mydas Vs546 ighv AJIM01058181.1 595 VFSQVQLVQSGPGKVKPGETLSITCKVSGLSVSTSYWSWVRQPPGKGLEWMGRIQSTADGGNTAYNSAFGNRITITRATPKDEVYLQLRSLTAADTGTYYCTRQ
Chelonia mydas Vs544 iglv AJIM01057094.1 2501 SSSQPVLTQPPSVSVSPGNTVKLSCTMSSGTSISGYNVYWYQQKPGNSPRYLLRYKSDSDKYQGSGVPARFSDSKDTASNAGYLTISGALAEDEADYYCAV
Chelonia mydas Vs543 igkv AJIM01055599.1 769 SYGQVTMTQSPESFSVSPGEKVTIRCTASSSINSNYVSWYQQKPRQAPNLLIYQASSLASGVPARFSGSGSGTVYTLTISSVEADDTADYYCIQWGS
Chelonia mydas Vs6 iglv AJIM01051539.1 190 SSYQFTLTQPLTMSVTPGETAQLACVLSGGESISNAYIRWYQQKQGEKPKYLLYYKDDSTQHKGSGVPDRFTASKAPSRNTCFLTISRAQGEDDADYYCSDWD
Chelonia mydas Vs834 trav AJIM01213283.1 29167 SRENPPMISVTEGEPISFECSFDGSPAVGNPFYEIIWMYEMTHKNVSKRILSFRMTRPNTSVPVSVTEGHFRGQLDFEKNTSSLSIPEVRVNDSGLYYCEVIIV
Chelonia mydas Vs839 ighv AJIM01213685.1 1119 VRSQVQLVESGAGVKKPGDSLRLSCQASGFTFSDRWMSWFRQPPGKGLEWVSEISTDGSTTRYADSVKGRFTVSRDNSNSLVYLQMTGLRAEDTARYHCAR
Chelonia mydas Vs7 iglv AJIM01051539.1 5842 FSSQELQSLKTSQLMSPGGTVTLSCSLSSGAITDGNYSLWVQQRLGNVPRLIMYHTSTRPSGIPAHFTGSRSGNTMSLTITGALVEDDADYYCTVRTGS
Chelonia mydas Vs548 trgv AJIM01058959.1 792 VLCAIHLEQEQISVTKQPLQGSSAKFTCKVFGGSDSTYIHWYRAPAGEAPHRLLYLTLSGSELKLEAGFSGEKFSAYGRQSISNLLVHKLEETDSGRYYCATWDF
Chelonia mydas Vs464 igkv AJIM01252482.1 18425 QIVLTQTPESLAVSPGDTVTIRCKASSSLTDDDYGVDVLAWYQQKTGQAPRLLIYWASTLEDGVPARFSGSGSGTDFTLTISSVEAEDAGDYYCQQSYETP
Chelonia mydas Vs460 igkv AJIM01252481.1 17960 SSGQIVMTQTPESLAVSPGDTVTIRCKASSSLTSGSSHYLVWHQQKSGQAPKLLIYAGSSLQTGVPAWFSGSGSGTDFTLTINRVEAEDAGDYYCLQ
Chelonia mydas Vs461 igkv AJIM01252481.1 25119 SSGQIVLTQTPESLAVSPGDRVTINCKASSSLTSGSYHYLAWYQQKSGQAPKLLIYAATYLQSGVPARFSGSGSGTDYTLTISRVEAEDAGDYYCQQGKSNP
Chelonia mydas Vs462 igkv AJIM01252482.1 1436 SSADIVLTQTPESLAVSPGDRVTINCKASSSVSNWMAWYQQKSGQTPKLLIYSASTRPSGIPDRFIGSGSGTDCTFTISQVEADDAGDYYCQQSWS
Chelonia mydas Vs463 igkv AJIM01252482.1 14787 ASGDIVMTQTPESLAVSPGERVTIRCKASSSLTYQGKEYLAWYQQKLGQAPKRLIYLASTQQPGTPARFSGSGSGTDFTLTISRVEAEDAGDYYCQQYRSYP
Chelonia mydas Vs316 igkv AJIM01210138.1 13159 SSGQIVMTQTPESLSASVGETVTIKCRASSSIGTYAHWYQQKSGQSPKLIIYSASSRPSGIPARFSGSGSGTDFTLTINRVEADDAGDYYCQQA
Chelonia mydas Vs317 igkv AJIM01210139.1 1975 SSGDIVMTQTPESLAVSPGDRVTINCKASSSTGNHLNWYQQKSGQAPKLLIYHGSTLASGVPARFSGSQSGSGYTDYTLTISSAETEDAGDYYCQQSYSFP
Chelonia mydas Vs314 igkv AJIM01210138.1 2430 SSGQIVMTQSPESLAVPVGGRVSINCKASTSVGTCLNWYQQKPGQAPKLLIYSASTLQSGVPARFSGSGSGTDFTFTISSVEADDAGDYYCLQCSSYP
Chelonia mydas Vs315 igkv AJIM01210138.1 4886 SNGQIVLTQTPESLAVSPGDRVTINCKASSSVSSYMAWYQQKSGQAPKLLIRSASTRPSGIPDRFSGSGSGTDFTFTISRVEADDAGDYYCQQYNSWP
Chelonia mydas Vs312 igkv AJIM01210136.1 16224 SSGDIVMTQSPESLSVSVGESVSISCKASSGITNDIAWYQQKSGKAPKLLIYEASSRETGVPARFSGSGSGTAFTFTISSVEVDDAGDYYCQQYNSWP
Chelonia mydas Vs313 igkv AJIM01210136.1 20150 SSGQTVVTQSQESLAVPVGGRVSINCKASTSIGSYLNWYQQKPGQAPKLLIYGASTRQSGVPARFSGSGSGTDFTFTISSVEADDAGDYYCQKGNDVP
Chelonia mydas Vs310 igkv AJIM01210134.1 23866 SRGQIVLTQTPESLAVSPGDRVTINCKASSSVSTSYMAWYQQKSGQAPKLLIYSTSTRPSGIPDRFSGSGSGTDFTFTISRVEADDAGDYYCQQ
Chelonia mydas Vs311 igkv AJIM01210136.1 9613 CSGEIAMTQSPASLSVSVGESVAIICKATLSIYDNIAWYHQKPGEAPKLLIYEASDRHTGFPGRFSGSGSGTDFTFTISKVEAVDAGDYYCQRYDERP
Chelonia mydas Vs109 ighv AJIM01155931.1 9507 VLSQLQLVASGPGSGKVSEPLTLTCAVSGFSINTQYSYWYWLRQPPGEGLESMGYIYPYNGGTGYAPSLQGRITISADTAKNQVSLTLRSLTAADTATYYCAWR
Chelonia mydas Vs318 igkv AJIM01210140.1 1979 SSGQIVMTQTPESLSVFPGDRVTINCKASSSVSNYMAWYHQKSGQAPKLLIRSASTRLSGIPDRFSGSGSGTDFTFTISRVEADDAGDYYCQQYYSSPL
Chelonia mydas Vs319 igkv AJIM01210140.1 9160 SYGQIVLTQTPDSLSVSPGERVTINCKASTSISNYLGWYQQKPGQAPKLLIYDSTNHYSGTPAWFSGSGSGTDFTLTISNFETEDAGNYYCHQRLSYP
Chelonia mydas Vs550 ighv AJIM01068914.1 630 GVRSEIQFVQSGAEIKKPGESMKLTCKASGYTFNEHRMSWIRQAPGKGLEWVASIRTDTFETFYPQNLKGRVTISVDVPLSTAYLQMNGLKSEDSAVYYCAR
Chelonia mydas Vs107 trdv AJIM01155930.1 4970 VRSDVALDQGAQALAVREGEEVTFQCRVTGGEMNSYWMYWYRKGQRGPLTWIYREGDHYGEGFQGRFVGEVDSSNNRFTLKILSAELRDRAVYYCASS
Chelonia mydas Vs552 iglv AJIM01104335.1 325 SLTQYVLTQPPAVSVSPGQNAQLTCTGEKFDKYYVHWYQQKPGRAPVLVIYKDSERPSGIPDRFSGASSGNTATLTITGVQAQDEADYYCQVWDKDS
Chelonia mydas Vs553 iglv AJIM01125412.1 668 FSSQQLQSLKASELVSPGGTVTLSCSLSSGALTDHNHPFWVQQRLGNVPRLIMYSTSTRPSGIPERFAGSRSGNTMSLTITGALTEDDADYYCSVWAASI
Chelonia mydas Vs106 trav AJIM01155930.1 2762 LTQGQTVIQPVRETKVKEGEFVSLDCSYNSGFPTLFWYRQESGGSPQFILQERSRHEDLEERFRNRFKAKINKTSRVFPLDISSVQPSDSATYYCALI
Chelonia mydas Vs928 trbv AJIM01248082.1 17979 SGLGVLISQFPRTATQRPGETMKITCVQNETSYSYMYWYKQLQGDGPRLIAQSVDGSNATYEEESNAPKFPITRPNTRISSMSIVDLRTQDSASYFCA
Chelonia mydas Vs419 trav AJIM01242414.1 5172 SSMEDAVTQTQPSVSGVERQSVSLDCTYETAASSYYLYWYKQPPGESLLFLSWQHSGGTKRNEAGKRFSVNLEKSRRSVSMSITALELGDAAMYFCAFSR
Chelonia mydas Vs418 trav AJIM01242413.1 832 ALGQYTVTQDRSQAPAHEGEPIQLNCSYTGTEYSVHWYRQPQGGQPRFVASLSSSGRDTRENFTMSLDTKTKSSFLYLNSSCLEDAAVYLCAL
Chelonia mydas Vs104 trgv AJIM01155222.1 1080 GCAQIHLRQAQLSVTRGKGKTARIDCEASGIQNFGNAYIHWYRQRPGEAPEWILYFRTQADKSNFDNNKFRVEKTTEKSTCTLRVERLTDNDMGTYYCAYWD
Chelonia mydas Vs542 trav AJIM01054876.1 560 GAVDGKVSQPAALLFLAGGLAGGGSALPCNHSVTGYERIFWYYQRPGAAPRAVISGYNSAEKSERFELSIDPSGRSAPLRITKVAVEDSGVYYCAVR
Chelonia mydas Vs133 trav AJIM01160715.1 154 PAGPAGPGGGHGDPVTASVLAGGSITLSCTFHSHNQTGIQVTWARGSQEAIVLDPDHPFYQGRLAKSQQDQQGRAEATVTLSELMERDSDLYHCY
Chelonia mydas Vs451 igkv AJIM01252476.1 5173 ASGQIVMTQTPESLAVSPGDRVTINCKASSSVSSSMSWYQQKSGQAPKLLIYSASTRPSGVPDRFSGSGSGTDFTFTISRVEADDAGDYYCLQSSNLP
Chelonia mydas Vs665 ighv AJIM01162222.1 1886 VYSQISLVESGGGIKKPGETLRLTCTVSGFSLTSDGVHWVRQLAGKGLEWMGCIWGDGSNNYNDAFKSHLTITRDTSKSQVFLQLTGLQPGDTSVYHCAR
Chelonia mydas Vs519 ighv AJIM01268515.1 1323 VLSQVQLVQSGPGPVTPGEPLPLTCAVSGVSITDSSYAWSWVRQAPGKGLEWMGYVYPYSSGSTSYAPSLQGRITISGDTAKSQFSLQLRSLTAAGTATYYCAR
Chelonia mydas Vs323 igkv AJIM01210140.1 27448 SSGQIVMTQSPESLAVPVGGRVYINCKASTSLGTSIHWYQQKPGQAPKLLIYSASTLQTGVPAWFSGSGSGTDFTFSINNVQAEDAGDYYCQQSSSFP
Chelonia mydas Vs322 igkv AJIM01210140.1 19541 ASGQIVMTQTPESLAVSPGDRVTINCKASTSISSNIAWYQQKSGQAPKLLIYYASTRPSGIPDRFSGSGSGTDFTFTISRVEADDAGDYYCQQHSSAPL
Chelonia mydas Vs321 igkv AJIM01210140.1 16208 STGQKVLTQTPESLSVSPGDTVTIKCRASESVSSYLAWYQQKSGQAPKLLIYYATTRASGIPDRFSGSGSGTDFTLTISRVEAEDAGDYYCQQG
Chelonia mydas Vs320 igkv AJIM01210140.1 12826 SSGQIVMTLTQTPESLSASVGETVTIACQASLSIGTYISWYQQKSGQSPKLLIYSASSRPSGIPARFSGSGSGTDFTLTISGVEANDTGDYYCQQASYSVP
Chelonia mydas Vs327 igkv AJIM01210140.1 45147 SSGQMVLTETPESLAVPPGDRVTINCKASSSVSSSMSWYQQKSGQAPKLLIYSASTRPSGVPDRFSGSGSGTDFTFTISRVEADDAGDYYCLQSSNLP
Chelonia mydas Vs326 igkv AJIM01210140.1 37296 SSGQIVMTQTPESLSTSMGETVTIKCQASSCIGTYAHWYQQKSGQSPKLIIYSASSRPSGIPARFSGSGSGTDFTLTINRVEADDAGDYYCQ
Chelonia mydas Vs325 igkv AJIM01210140.1 34879 SYGQIVLTQTPESLFVSPGERVTINCKASTSISNYLGWYQQKPGQVPKLLIYDSTNRYSGTPARFSGSGSGTDFTLTISSVEVEDAGNYYCQQRKSYP
Chelonia mydas Vs324 igkv AJIM01210140.1 30076 SSGQIAMTQTPESLSVSVGETVTIKCKASASISNYIAWYQQKPGQAPKSLIYYTSNRPTGIPDRFSGSGSGTDYTFTISRVEADDAGDYYCQQYNNFP
Chelonia mydas Vs121 iglv AJIM01158366.1 2243 SSSQPVVTQPPSVSVSPGNTVKLSCTMSSGTSISDYYVSWYQQKPGNSPQYLLYYYSDSSKGQGSGVPARFSGSKDTASNAGYLTISGALAEDEADYYCAVIKS
Chelonia mydas Vs330 igkv AJIM01210142.1 9985 SSGQMVLTQISLAVAPGDRVTINCKASSSTSNYISWYQQKPGQAPKLLIYAATSRYTGVPARFSGSGSGSGYTDYTLTISSVEAEDAGDYYCQYSYSYS
Chelonia mydas Vs329 igkv AJIM01210142.1 3210 SSGQIVLTQTPETLSVSPGDRVTINCKASSSVSSWMAWYQQKSGQAPKLLIHKASTRSSGIPDRFSGSGSGTDFTFTISRVEVEDAGDYYCQEYSSWP
Chelonia mydas Vs328 igkv AJIM01210141.1 1387 SYGQVTMTQTPESLSVSPGQKVTIRCSASSSISSSYVSWYQQKPGQAPKLLIYRGSTLASGVPGRFSGSGSGTVYTLTISSVEADDAADYYCLQAQS
Chelonia mydas Vs124 iglv AJIM01158368.1 1398 SSSQAVVTQLPSVSVSPGNTVKLSCTISSGNSISDYDVRWYQQQPGNSPRYLLRYKSDSNKYQGSGVPARFSGSKDTASNTGYLTISGALAEDEADYYCTI
Chelonia mydas Vs927 trbv AJIM01248080.1 10586 GADVRLNQTLSLVLERGKIADLRCEQNINHDYMYWYQQHQGKGLHLIYYSYDTAQVEPGNISERFTAVRPQTQLFQLKISPVKPEDSAVYFCASSL
Chelonia mydas Vs70 igkv AJIM01147920.1 1790 SYGQIVLTQTPESLSVSPGQRVTINCKASTGISNNLGWYQQKSGQPPKLLIYDSTNRVSGIPARFSGSGSGTDFTLTISSVEAEDAGDYYCQQRQSFP
Chelonia mydas Vs71 igkv AJIM01147920.1 8562 ASGDIEMTQTPESLLVSPGDRVTINCKASSNIGSEIDWYQQKSGQAPKLLIYYGSSCPSGIPDRFSGSGSGTDFTLTITSFQADDAGSYYCQQDYGFP
Chelonia mydas Vs72 igkv AJIM01147920.1 14715 SYGQVTMTQSPESFSVSPGEKVTIRCTASSSINSNYVSWYQQKPRQAPKLLIYQASSLASGVPARFSGSGSGTVYTLSISSVEADDAADYYCLQWGSSP
Chelonia mydas Vs74 igkv AJIM01147921.1 12956 SHGDTVMTQTPESLAVSPGDRVTINCKASSSVGSSMAWYQQKSGQAPKLLIYYASTRPSGIPDRFSGSGSGTDFTFTISRVEADDAGDYYCQQGNYWP
Chelonia mydas Vs836 iglv AJIM01213283.1 10464 CYAQVTQPPSEFVSPGGTVQLPCTLEGSYTVSANRVVWIQQKPGSVPRYLLYFFTESNKGMGSGVPSRFAGSRSGSNKIGYLTITGAQAEDDAIYYCVTWTGSA
Chelonia mydas Vs710 ighv AJIM01175776.1 4950 PILGFKMTQSGLGEAKVSGSLILTCAVSDSALSTGEDWWHWLRQPPGKGLVWLALIDRYGNTHYFPDIKNRATISVDPSKNEFYLRVDSLSPQDTATYYCAR
Chelonia mydas Vs541 trav AJIM01052400.1 863 GANGESVTQPEDRLTVSQGAPALLKCSYDTSYIPTLWWYEQYPNEAPRLLLTQYEASGEEERRSRRGFSATPDKQGKTFHLKKNSTELRDSAVYYCAMS
Chelonia mydas Vs741 trgv AJIM01186371.1 2353 GCAQIHLKQAQLSVTRKKGKTARIDCEASGIQDFRSAVIHWYRHRPGEAPERILYISSEKPVFDKDSDKNKFNCEKKPDQPISTLVVNAITPNDRAIYYCAYWD
Chelonia mydas Vs85 iglv AJIM01150476.1 12302 SSSQPVLTQPSSESVSPGQTAKLSCATSSGYSLSSYNLYWYQQRPGQAPRFVLSGTSSRGDGIPDRFTGSCSGNVGYLTITNIQAEDEADYYCAMWYGSGGV
Chelonia mydas Vs84 iglv AJIM01150475.1 4069 SLAQFVLTQPPSVSASPGQTVTISCARSSGSISGSWNSWYQQSPGRAPVLIIYQDSKRPSGIPSRFSGAIDSSANAATLTISGVQADDEADYYCSAG
Chelonia mydas Vs87 iglv AJIM01150477.1 13675 VSSQPVVTQEPSMSVAPGGAVTLSCSLSTGAVTTSNYPSWYHQKPGSAPQLLIYETNKSPAGIPARFSGSISGNKAALTITGVQAEDEADYYCAVWASSA
Chelonia mydas Vs86 iglv AJIM01150477.1 5009 VSSQPVVTQEPSMSVTPGGAVTLSCSLSTGAVTTSNYPAWFQQKPGTVPQKLIYSTNSRPSGIPARFSGSISGNNAALTITGVQAEDEADYYCIVWIG
Chelonia mydas Vs521 ighv AJIM01268520.1 1140 VLSQIQLVPSAPAAVKPGESLTVTCKVSGDSIATRAWWNWVRELPGRGLQWVGRIHFSGSTNYAPDLQTRANIAKDDAKNEYYLELRSLTAADTATYYCTRWD
Chelonia mydas Vs83 iglv AJIM01150474.1 772 FSSQQLQSLKASELVSPGGTVTLSCSLSSGALTDNNYPKWVQQRLGNVPRLIMHSTSTRPSGIPARFTGSRSGNTMSLTVTGALAEDDADYYCSVWTGSA
Chelonia mydas Vs513 ighv AJIM01268494.1 5995 ARSQGALTQSGTAVKKPGESHTVKCAVSGFNVMGYNMFWIRQAPGKGMEWIIHYYSPSSNNYSPAIQGRFTSSKDSSNFYLQMTNLKREDTAMYYCAR
Chelonia mydas Vs655 trav AJIM01158396.1 3476 GTYGADSVTQTEGSIIIYQGDPVRLNCTYQISGFPSLFWYLQFPSQPPRLFLRDLGREDSDEGIRKGLDATHEKKHKSFRLWKPSSDLSDSATYYYCAAS
Chelonia mydas Vs661 iglv AJIM01160901.1 1571 VSSQPMVTQEPSMSVAPGRAVTLSCSLSTGAVTTSNYPGWLQQKPGSAPRQLIYQTNNRPSGIPARFSGSLSGNNTALTITGVQAEDEADYYCIVWTGSA
Chelonia mydas Vs335 ighv AJIM01211342.1 335 VRSQTLVESGGGVKKPGDSLRLSCKASGFTFSSYSMSWVRQAPGKGLEWVAFIRYDGSTIYYLDSVKGRFTISRDNSKSELYLQMTGLKPKDTARYYCAR
Chelonia mydas Vs136 ighv AJIM01161994.1 13917 VQSEVQLVQSGAETKKPGESVKISCKTSGFTLTDYYMHWIRQTPGKGLVWVGDIDPEDGATSYADFMKNRVTISTENSISTVYLQLRSLRAEDTAVYYCA
Chelonia mydas Vs135 ighv AJIM01161994.1 12046 VQSEVQLVQSGAEIKKPGESVKLSCKTSGFTFTSVYMHWISQAPGKGLVWIGRIDPADSETKYSESFKGRFTITTDNSISTAYLQLNSLRIEDTAVYYCA
Chelonia mydas Vs69 igkv AJIM01147916.1 2995 SSGQIVMTQSPESLAVPVGGRVSINCKASTSIGTSIHWYQQKPGQAPKLLISYASTLQSGVPARFSGSGSGTDFTFTISSVEAEDAGDYYCQQGSSWP
Chelonia mydas Vs62 ighv AJIM01145045.1 5219 SEAAITLTQPSSVRAKPGSSITLDCVVSGYNINDHHLHWVRQAPGKRLVWVTGFRTGYATITANEFKGRVTPSTSGSTARLKIDRRTAADTATYYCARE
Chelonia mydas Vs61 ighv AJIM01145043.1 8660 SVAAISLTQLSSALVKPGSSVTLDCVASGYAINDDHMHWSRQTQGKGLVWIAAFKTGDTTYISNDFKGRVTPFTSSSTARLRIDGLTAADTATYYCS
Chelonia mydas Vs60 trav AJIM01144290.1 1727 SPGRAEIQQPGTAEGVEGAELNFTCSHPSIKTNENVVWYRQFPNRGPEFIVSGYREITHIPDPEGALHVSGDRKSSALALSRARLADAAVYYCALR
Chelonia mydas Vs66 ighv AJIM01146236.1 2964 ARSQVVLTRSGPALKKPGESQKLQCAASGFTLSSTWMGWIRQEPGQGLEWLADYYSEGSKYYASSVQGPFTASKDSTSLSLQMTGLRAEDPSVYYCA
Chelonia mydas Vs65 ighv AJIM01146232.1 9861 VRSQVQLVESGGDVKKPGDSLRLSCKASGFTFSSYWMQWVRQAPGKGLEWIGEIHPTSTTINYAQPFKGRFTISRDNPNNLLYLQMTGLKSEDTARYYCA
Chelonia mydas Vs436 trbv AJIM01247096.1 1817 QGDAKITQTPSLVLERGQTAYLRCEQTYGHNNMFWYRQDPGQGMQFLINFYNKEQNEKGKITDRFQAYQPQNNLFRLNISSVQPEDSAVYFCASSL
Chelonia mydas Vs728 ighv AJIM01181308.1 736 VKADVQLAESGGGVKKPGDSLHLTCQASGFTFSSYWMNWVHQAPAKGLEWVSTVTSDGSQAYHSPAILGRFTISRDNSNSLVFFQTDSLKPEDTAVYYCS
Chelonia mydas Vs727 trbv AJIM01181307.1 758 MESAYVEQQPFLTGAQENPKTLQCTLKQTSYNWMYWYRRREGRKLEGLFNSGGDGPGTNFTAEPVTALRSNTKWDLTWRSLSLSDSAVYYCAC
Chelonia mydas Vs841 trav AJIM01214023.1 1391 VNGLSVTQPDDRVTGSQGEPVLLKCFFDNTPIPTLWWYEQYPNEAPYLLLTQYEALDEEERKSRRGFSATPDKQESFHLKKNSSELSDSAVYYCGMS
Chelonia mydas Vs722 trav AJIM01179950.1 1951 TFGDSVTQIEGTILVKEGVPLIIECTYESILFPYLRWYIQQPNGAPKLWLGDRTSGGGQDEGDKQGFFANHIQAQKSFQLKKSSSEVNDSAVYYCSLR
Chelonia mydas Vs438 trbv AJIM01248076.1 20595 HTDAKITQIPSLVLKKGQTAQLKCSQTDGHSYMYWYQQQQGKGLQLIYYSLGKDNQEDGDSDIKNDFTVSRPEIKVFDLNITSVKMEHSAVYFCASSL
Chelonia mydas Vs123 iglv AJIM01158367.1 1707 SLAQYELTQPPSVTVSPGQNAQLTCSGDNINIYHVQWYQQKPGSALVQLLYQNNKRVPGIPERFSGANSGNTATLTITGVQEQDEADYYCQVWDDP
Chelonia mydas Vs538 iglv AJIM01017380.1 1116 ASSQYTVTQESSLLVSPGGTVKLSCSLSILSDITSEYPYWIQQRRGGVPPLPIYNANVKVSGTPERFSGSSSGNTAYLIISGALAEDDADYYCL
Chelonia mydas Vs56 trav AJIM01144287.1 910 GASGVSVMQTQGPMTVSEGEGLRLNCSYDDAAVYAVFWYVQFPSQPPRLLLRDLGREDSDEGIRKSFDATHEKKHKSFHLWKPASEVSDSATYYCAAS
Chelonia mydas Vs57 trav AJIM01144288.1 4133 APGRAEIRQPVSAEALEGAELNLTCSHPSASSDNIAWYRQFPNRGPEFIVTGFRETAHSPDPEGTLHISKDKENSTFALRRVRLADAAVYYCARR
Chelonia mydas Vs122 iglv AJIM01158366.1 7012 SLAQYVLTQPPSVSVSPGQNAQLTCTGNNIGSKDVQWFQQKPGSAPLQLIYQSSSRPSGIPDRFSGAKSGNTATLTITGVQVQDEADYYCQVSDSNA
Chelonia mydas Vs53 trav AJIM01144281.1 1600 SSMEDVVTQTQTAAAGVESASVTLDCAYKTDTSYYSLYWYKQHGAEKLVFPLWEYSDGLKKNEAGERVSVDFKKSESSTSLRITGLELRDSAMYFCAFNR
Chelonia mydas Vs228 ighv AJIM01184803.1 981 ARSQVQLVESGGDVKKPGDSLRLSCKASGFTFSSYQMSWVRQAPGKGLEWVSLIYTDGSKSYYSDAVKGRFTISRDNSNNLLYLQMTGLKPEDTARYYCAR
Chelonia mydas Vs59 trav AJIM01144288.1 9248 SQCRAKIQQPVSTEALEGAELNVTCSHPSASRDNIFWYQQFPNGGPELIVTGFSETAHSPDPEGTLHISNDEENSTFALRGVWLADAAVYYCARR
Chelonia mydas Vs903 trdv AJIM01236235.1 4169 LRAQTVLVNDTVSGFIGTDVVLHCSFTNPLPSVKITQVTWQKATNGSKQNVAIYNPAMGVSILSPYKERVTFRNPSFKDGTIQLSRLELEDEGVYICEF
Chelonia mydas Vs420 trav AJIM01242414.1 10354 SCCEAQVVQSPEWLVTGEGKVSTMSCSFTSAYQTFYWYQQLPGQGPTHLLTASSNDNVTVGRFIGEPLESGKRSSLHITDSQPGDSGSYLCAVR
Chelonia mydas Vs589 trgv AJIM01142903.1 33197 GEAQVLVQSQLSITKAEDKTTQIDCHLSRITLSSAHIHWYRRRPDAALKRILYFISGNPVLDQDSEKGKFEAEKQLSESICVLTVKKTTKNDSATYYCATW
Chelonia mydas Vs588 trgv AJIM01142901.1 321 GEAQVLVQSQLSITKAEDRTGRIDCHVSGITFNSAYIHWYRQRPDAALERILYLSSGKPVFDQDSEKGKFMADKQLSKSTCTLTVNKISKSDTATYYCAAW
Chelonia mydas Vs637 ighv AJIM01152710.1 689 VRSHIQLVEPGGDVKKPRDTLRLSCKASGFTFTDYHMNWVRQAPGKGLEWVTHIQVTSTYYADSLKGRFTISRDNPKNMVYFQMRNLKTEDTALYYCAK
Chelonia mydas Vs639 ighv AJIM01152711.1 2389 ARSQVVLTQSGPEMKKPGESTRLKCAVSGFTITSYYMAWVRQETGKGLEWLVSYWKPGSEYYSPTIKGRFTASKDSSNFYLQMNGLKPEDTALYYCAR
Chelonia mydas Vs638 ighv AJIM01152711.1 11808 YLMLLKKALKLGNRLLSQCIFGLFSPYQTVTFRSCNMDWVPQSPGKGLEWIAFIYYDGAGPSSADSMKGRVTISRDNPNNLLYLQMTGLKPEDTARYYCAR
Chelonia mydas Vs587 trgv AJIM01142901.1 15054 GYSQITLLQTPLSVTRPVSKSARMSCKTSGFNINSAYIHWYRHSPGAAPKRILYIGSGSAIMDEGFDSKRFEARNDVSGSTSNLRVDQLTQKDAATYYCAVWD
Chelonia mydas Vs586 trav AJIM01142883.1 361 SCCEAQLVQRPESLVVQEGDISTVTCTYTSAYQTFLWSQQLPPERARPPVTVNARETATDGWFMGEHLEDLKSSSRHSSDSQLGDSGPYLCGME
Chelonia mydas Vs507 ighv AJIM01266401.1 21709 VQTNYEFEASGGEVKMLGDSLRISCITSGFTFNSYGMSWVRHAPGKGLQWVAYISQAGDTVRYSESVKGRFTISRDNSRGLVHLHMTELRPEDAAEYYCTW
Chelonia mydas Vs505 ighv AJIM01266401.1 2296 VQTNYEFVASGGEVKMLGDSLRISCKTSGFNFDDSWMSWVRHTPGKGLQWVATISSKAGDTIHYSESVKGRFTISRDNYWNVLHLHMTELRLEDAAEYYCMW
Chelonia mydas Vs504 ighv AJIM01266400.1 3230 GWTVKFVESGGDIKKPGDSLHLSCKTSGFKFGDYWMSWYRLSAGKGLEWVCSMKQSPTSDKYYASSVKGRFTISRDNSKNTAYLQMNNLKPEDTARYYCRD
Chelonia mydas Vs672 trav AJIM01164163.1 2356 VQVQLFLHQLQSFLFVNINDTAKIQCSSKKQLLAGGITAQWYRRREGEAPMLIKRCSDNQNVRKVACISEGQNLTLAIYNAQRNDSGVYYCTNSY
Chelonia mydas Vs596 igkv AJIM01144271.1 24751 SSGQIVLTQTPESLAVSPGDRVTINCKASSSLTSSSYHLLAWYQQKSGQAPKLLIYLASNRASGIPDRFSGSGSGTDYTLTISRVEAEDAGDYYCQQHKS
Chelonia mydas Vs597 igkv AJIM01144271.1 14341 ASGQIVMTQTPESLAVSPGDRVTINCKASSSVGSWMSWYQQKSGQAPKLLIYSASTRPSGVPDRFSGSGSGTDFTFTISRVEADDAGDYYCLQSYSLP
Chelonia mydas Vs36 ighv AJIM01142256.1 9111 VQSEIQLVQSGAEMKKPGESVKLSCKTSGFTFTSVYMQWVRQAPGKGLLWLGRIDPEDGSTSYSQSFKDRISITADNSISTAYLQVSSLKTEDTAVYYCA
Chelonia mydas Vs112 iglv AJIM01156191.1 1097 VSLQPVVTQEPSMSVAPGGAVTLSCSLSTGAVTTSNYPGWFQQKPGSSPWQLIYSTNSRPSGIPARFSGSISSNNAALTITGVQAEDEADYYCIVWTGSV
Chelonia mydas Vs575 trav AJIM01139635.1 9620 AALGDSVQSKESQVSGVEGASVTFSCSYKTTDTSGVYLSWYRQSPNRAPQYILRRGTKLYAAYGDTADFAQERFSSQADESSILLNITALELADIAVYYCALQR
Chelonia mydas Vs835 iglv AJIM01213283.1 17580 VESQHVLTQKPSVSITSGESVTLKCVMSGVKFKDFCVVWNQQKSGSAPSFLLQYCAKSGLKRGEGVPERFSGSKNHSLDEGYLNISRVHPEDEADYYCSIWDD
Chelonia mydas Vs704 trav AJIM01173174.1 4128 GTYGADSVTQTEGSVTISQGDPVRLNCTYQFSVAAYPFWYAQFPNRPPRLFLRDLGREDSDEGIRKGFNATHDKTHKSFHLWKPSSELSDSATYYCAAS
Chelonia mydas Vs73 igkv AJIM01147921.1 6735 SSGQIVLTQTPESLAVSPGDRVTINCKASSSVSYMAWYQQKSGQAPKLLIYDASSRPSGIPDRFSGSGSGTDFTFTISRVEADDAGDYYCLQGSSWT
Chelonia mydas Vs520 ighv AJIM01268517.1 5135 VLSEIQLVESGPGALKPGETFKLTCAVSGYSISRGDWWPWIRKSPGKGLGWMAEMYGDGRTFSAQSLKRRLAISVDASKNEFSLQLSTLTTADTATYYCARE
Chelonia mydas Vs54 trav AJIM01144284.1 2264 SCCEAQVVQSPEWLVTGEGEVSTMSCSFTSTYRTFQWYQQLPGQGPTHLLTASSNDNVTVGRFIGERLESGKRSSLHITGSQLGDSGSYLCVVY
Chelonia mydas Vs506 ighv AJIM01266401.1 5133 IQSKLDFVASGGEVKMLGDSLRISCKTSGFTFGDYGMTWVRHIPGKGLQWVAYISKSSGDTKSYADSVKGRFTISRDNSRSLLYLHMTNLRREDAAEYYCG