WGS Statistics
Organism WGS Record. Vs Total IGHV IGLV IGKV TRAV TRBV TRGV TRDV
Camelus bactrianus JARL00000000.1 (JARL01) 114 5 26 11 36 24 3 9
Camelus bactrianus CAOW000000000.1 (CAOW01) 24 0 0 2 10 10 1 1
Vgene Table
Organism Vgene Locus contig Contig Pos. AA sequence
Camelus bactrianus V2 trbv JARL01000609.1 30691 VRAQTIHQRPPTVVQPMGSSLSLECTVKGTSNPSLYWYRQAAGGALQLLFYSFSADQVDSEEPQNFEASVSQDGSFILSSKKLLLNNSGFYLCAWS
Camelus bactrianus V5 ighv JARL01001032.1 8415 VQAEVQLVESGGGLVQPGGSPRLSCAASGFTFSSYAMSWVRQAPGKGLEWVSAINSRGSTHYADSMKGRFTISRDNAKNTLYLQMNSLKPEDTAVYYCAR
Camelus bactrianus V7 trgv JARL01001204.1 173255 GLALSKVEQSQVSVSTEVRKSIEINCKIESRDFESETVYWYRQKRKQALEHLIFVISTTTTARNLIDGKNNKVEARKNSQKLTSTLTVNFIEKEDTGIYYCAGWY
Camelus bactrianus V8 trgv JARL01001204.1 178681 GLMLPQLEQPEVSVTGVRDKSVVLSCKVPSDSFDKDYIHWYQQKPDQGLKQLMYVLTASALGDLGGKKNKLEARKYASISTSTLKISFLKKEDEATYYCALWIS
Camelus bactrianus V9 trgv JARL01001207.1 6682 DQEEVRLVQPSLVMAHTRGSTTLPCRTYGSVTYVHWYRQLEGRAPERLLYLALSKRDVQWDSVLRGDKVNAQVNNDGRSCFLSLMKLEKADEGTYYCAAWD
Camelus bactrianus V15 ighv JARL01001898.1 607 VQAEVQLVESGGGLVQPGGSLRLSCAASGFTFSSYYMSWVRQAPGKGLEWVSSIYTDGSSTYYADSVKGRFTISKDNAKNTLYLQMNSLKPEDTAVYYCAA
Camelus bactrianus V16 ighv JARL01001898.1 4870 VHAQVQLEQPVAELKMPGEALRISCKTSGYSFTSYWIGWVRQMPGKGLEWMGAIYPGDSDTRYSPSFQGHITISADKSTSTAYLQWSSLKSTDSAVYYCAK
Camelus bactrianus V38 iglv JARL01004366.1 3738 SWAQSALTQPPSVSGTPGQTVTISCAGTSSDVGYGSYVSWYKQLPGTAPKLLIYEDSNAATAIPDHFSSSKSGNTASLTISGLQSEDEADYYCASYRND
Camelus bactrianus V48 ighv JARL01005357.1 4825 VQAEVQLVESGGGSVQAGGSLRLSCTASGFTFDDSDMGWYRQAPGNECELVSTISSDGSTYYADSVKGRFTISQDNAKNTVYLQMNSLKPEDTAVYYCAA
Camelus bactrianus V115 iglv JARL01013204.1 2803 TWAHSAVTQPPSVSGTPGQTVTISCAGRSSDVGNTYYVSWYQHLPRTAPKLLIYWDSSRASGIPDRFSGSKPGNMASLTISGLQSEDEADYYCASY
Camelus bactrianus V141 trav JARL01015522.1 48186 AHSQVVQVNDSMYGFIGTDVVLHCSFANPLPGVKITQVTWQKATNGSKQNVAIYNPAMGVSVLAPYRERVEFLRPSFTDGTIRLSRLELEDEGVYICEF
Camelus bactrianus V152 trav JARL01016796.1 3674 VNGQQLKQIPEFVPLQEGENFTTYCNTSSPLDSLHWYKQQPGGRPVFLMLLTKGGDVKRPERLTARFGETRKDSFLHIPAAQTADVGTYFCAG
Camelus bactrianus V153 trav JARL01016797.1 1844 IVIEAEIDQPKSKDFAEGEDVNLPCNQSTIGVSDYIHWYRQKPSQSPQYIIHGFRDTVTNNMASLTIATDRKSSSLVLPRVALRDSAVYYCALRE
Camelus bactrianus V154 trav JARL01016798.1 8408 VTGEDVEQSPPVLSLQEGATSTLWCKFSTTVSSLHWYRQNPGGRLIHLFYVASGTKHDGRFSATTVAKERRSSLSISSSQTTDSATYFCAVSTVLP
Camelus bactrianus V155 trdv JARL01016798.1 22370 SAVAQTVTQAQPALSSHVGESATLNCQYETSYTEYYIFWYKQPPSGEMTFLIQQYSSSGNAKSGRYSVNFRKAEKSLSLTISNLQLEDSAKYFCALWE
Camelus bactrianus V156 trav JARL01016798.1 38235 TVIEAAIEQPKSKDFTEGEDVTLPCNHSTIGLNDYIHWYWQNPNQSPQYIIHGLQDTVTNNMASLTTATDRKSSTLVLPWVALRDSAVYYCALTE
Camelus bactrianus V157 trdv JARL01016799.1 13511 SAVAQTVTQDQPAVSSHVGETATLNCQYETSYSTYYIFWYKQPPSGEMTFLIRQDYNRGNAKSGRYSVNFRKAEKSLSLTISNLQLEDSAKYFCALDE
Camelus bactrianus V158 trav JARL01016799.1 24208 VNGQQLKQIPEFVPLQEGENFTTYCNTTSPLNTLQWYKQQPGGRPVFLMTLTKSGDVTRQGRLTARFGETRKDSFLHIPAAQTADVGTYFCAG
Camelus bactrianus V159 trdv JARL01016799.1 37103 SAVAQTVTQDQPAVSSHVGETATLNCRYETSWSYYYIVWYKQPPSGEMTFLIHQDSSSGNAKSGRYSINFRKAEKSLSLTISNLQLEDSAKYFCALWE
Camelus bactrianus V160 trav JARL01016800.1 4163 LRVQMKVEQSPGVLTLQEGENSSLTCNFSVSLTSLQWFQQKPDGRLISLFYIASGIKQNGRLTATVNIRESYSHLHIRDSQPGDSATYFCAVE
Camelus bactrianus V161 trav JARL01016802.1 4380 TLGDAKTTQPTSVESTEEEPVALPCDHATISGNEYIYWYRQIPHQGPEYLIHGLKNNVTNNMASLSIAIDRKSSSLVLPQVTLRESAVYYCALRE
Camelus bactrianus V162 trdv JARL01016802.1 10285 SGMAAKVTQTQTTETAQEGQAVTMHCTYETTAQRYTLYWYKQGPSGRMAFLIYQDDNKASAKRDRYSVNFQKAKQSISLTISSSQLADSGKYFCALWR
Camelus bactrianus V163 trav JARL01016802.1 17926 VSSDDKVIQSPPSLVVHEGTSATLNCSYKVTNFQSLYWYKQEEKGLAFLFVLISTGIEKKSGRLRGTLDKKELLRTLHITATEPEDSATYLCAVE
Camelus bactrianus V164 trav JARL01016802.1 22858 PGRADWIRPQETEVSGTEGKTVSLLCNYDTSSMGPVDLYWFRQYPNQAPEYILHRGWRHSGKGYASFATERFYSENTANTTSLYIRRVVLADAALYHCALNSE
Camelus bactrianus V165 trdv JARL01016802.1 41210 ASVAQMVTQPQPEVSVREAQTATLDCTYNTVQSDYYLFWYKQPPSGEMIFIIHQEAYKQQNATANRYSVNFQKAAKSFSLRISDSQLEDAAMYFCA
Camelus bactrianus V166 trav JARL01016803.1 7084 GTSGNSVQQTSQVTVSEGTSVTMNCTYTSAGYPTLFWYVQYPNKALRFLQEETMKNSKNFGARNIKDKSSPITIYPAQIADSAVYYCLLRLTVPR
Camelus bactrianus V167 trav JARL01016803.1 11043 ISGENEVEQSPPYLSAQEGDFVTVNCSYSVVMTTLQWLQQKPGGGIESLFILSLEMKKEGRVSATINRKERHGSLHITAAQPRDSAVYICAV
Camelus bactrianus V168 trdv JARL01016803.1 70902 VSLGIILEPETKTLTVPLGGPATFRCNVTGGDLGSYQMSWYKKNEDQSLTSVYRQGNNATEGARSKFKGKVDALKSQYILDIQNATAEDVGTYYCGSD
Camelus bactrianus V169 trdv JARL01016804.1 3993 IMSADVLVPQDAAVTVSVGGSVTLRCSMKGGPISDYYNYWYRKIPGSTMTFVFREGGTYGPGFRENFRGEVDQVNNQVLLEILKASEGDKGSYYCAAT
Camelus bactrianus V176 iglv JARL01017764.1 1846 SWAQSALTQPPSVSRTPGQTVTISCAATSNDVGRYNYVSWYQQLPGTAPKLLIYEDTSRASGIPDRFSGSKSGNTASLTISGLQSEDEADYFCASYTTS
Camelus bactrianus V177 iglv JARL01017764.1 7821 SWAQSALTQPSSVSGTPGQTVTISCAGTSSDVGSGNYVSWYQQLPGTAPKLLIYQVNKRASGIADRFSGSKSGNTASMTISGLQSADEADYYCASYRSSNN
Camelus bactrianus V178 iglv JARL01017764.1 10158 SWAQSALTQPSSVSGTPGQTVTISCAGTSSDVGYGNYVSWYQQLPGTAPKLLIYQVNKRASGIADRFSGSKSGNTASMTISGLQSADEADYYCASYRSSNN
Camelus bactrianus V179 iglv JARL01017764.1 14916 SVASSSALTQPSTVSVSLGQTARITCKVDSLGSYAAQWYQQKPGQAPVLVIYGNRNRPSGIPERFSGSKSGVTAPLTISGAQAEDEADYYCQSGSSNAN
Camelus bactrianus V211 igkv JARL01022870.1 29464 VSGDIVMTQSPSSVTASAGEKVTINCKSSQSVLYSSNQKSYLAWYQQRPGQSPRLLIYYASTRESGVPDRFSGSGSTTDFTLTISSVQPEDAAVYYCQQGYSA
Camelus bactrianus V212 igkv JARL01022870.1 41230 VCGDIVMTQSPSSVTASVGEKVTINCKSSQSVFSSSSQKSLLAWHQQRNGQSPRRLIYYASTRASGVPDRFSGSGSTTDFTLTISSVQPEDAAVYYCQQAYSS
Camelus bactrianus V213 igkv JARL01022870.1 57425 VCGDIVMTQSPSSVTASVGEKVTINCKSSQSVFSSSSQKSLLAWHQQRNGQSPRRLIYYASTRESGVPDRFSGSGSTTDFTLTISSVQPEDAAVYYCQQAYSAP
Camelus bactrianus V242 trav JARL01026511.1 2988 MRSRQKGAAQSLNVPEGATASLTCSYSVSDSQNFMWYRQYSGRGPEWLMTFYPNNDKQEGRYTAQVNKSSRYVSLHIRDSQPSDSAAYLCAES
Camelus bactrianus V243 trav JARL01026511.1 7794 GAGAQSVTQPEDHVSVFARAPVQVKCNYSSSGSPELFWYVQYPKQSLQLLLKHISKESVKGFTADLNTREASFHLKKPSAQEEDSAMYYCAVS
Camelus bactrianus V244 trav JARL01026511.1 10982 GTSGDSVTQTEVPVTLSERELLMLNCTYQTTDSDPYLFWYVQYVNKAPQLLLKGSTANPRPEHQGFQATLVKSSRTFHLQKPSVQTSDSAVYYCALR
Camelus bactrianus V245 trav JARL01026511.1 16585 GTSGDSVTQTEVPVTLPEEALLILNCTYQSTGSDPYLLWYVQYVNRAPQLLLKGSTANPRPEHQGFQATLVKSSRTFHLQKPSVQTSDSAVYYCALR
Camelus bactrianus V246 trav JARL01026512.1 4744 GTSGDSVTQTEVPVTLPEEASVFLNCIYQTAGSNPYLFWYVQYVNKAPQLLLKGSTANPRPEHQGFQATLVKSNRTFHLQKPSVQTSDSAVYYCALS
Camelus bactrianus V247 trav JARL01026512.1 6824 SVKAQKVTQDQPAISRPEEEAATLDCVYEAKGYSYYLLWYKQAASGEMLFLIHQESYNERNTTEGRYFLNFQKSASSISLTITALELGDSAVYFCALN
Camelus bactrianus V248 trav JARL01026512.1 13382 GAAAQSVTQPDRHGITVPEGARLELRCNYSSSYPPSLFWYVQYPNQGLQLLLKYTSGNGLVSGIKGFEAEFRRNESSFHLKKTSAHWSDSAEYFCALS
Camelus bactrianus V249 trav JARL01026513.1 211 VTGEDVEQSPPVLSLQEGATSTLWCKFSTTVSNLRWYRQNPGGRLIHLFYVASGTKHDRRFSATTVAKERRSSLNISSSQTTDSVTYFCAVSTVLP
Camelus bactrianus V264 iglv JARL01028659.1 152 SVASSALTQPSVLSVSLGQTARITCQAGNFGRYYAHWYQQKPGQVPVLVIYEYSKRASGIPERFSGSSSGGTATLTISGAQAEDEADYYCQSYDSSGYN
Camelus bactrianus V314 trbv JARL01035654.1 363 HLLAGVAQFPSHRVIEKKQAVSVRCDPVSGHEYLVWYQHAVGKEMKFLMSFLRDTVRDASGMLKDRFSAERTEGTYSTLKVHPAEPEDSGVYFCASSL
Camelus bactrianus V319 trav JARL01036133.1 5831 VNGQQLKQIPEFVPLQEGENFTAYCNTSSPLDSLQWYKQQPGGCPVFLMLLTKGGDVKRQGRLTARFGETRKDSFLHIPAAQTADVGTYFCAG
Camelus bactrianus V320 trav JARL01036133.1 11264 IVIEAEIDQPKSKDFAEGEDVNLPCNHSTISVNYYIHWYREKPSQSPQHIIHGFRDTVTNNMASLTIATDRKSSSLVLPWVALRDSAVYYCALTE
Camelus bactrianus V372 iglv JARL01000556.1 2462 SWAQSALTQPPLVSGTPEQMVTISCAVTSSDVGYGNYVSWYQQLPGTAPRLLIYDVSSLSSGIPNHFSGSKSGNTASLTISRLQSEDEADYYCASYGSSYN
Camelus bactrianus V373 iglv JARL01000557.1 59190 VNSQTVVTQEPSLSVSPGGTVTLTCGLSSGSVTTSNYPGWYQQKPGQSLRTLIYSTNSRHSGVPNRFSGSISGKKAALTITGAQPEDEADYYCAL
Camelus bactrianus V374 iglv JARL01000557.1 53690 SWAQSVLTQPPSVSGSLSQRVTISCTGSSSNIGGNYVNWYQHLPGTAPKLLIYDNSNRASGVPERFSGSKSGSSASLTITGLQAEDEGDYYCASWDDSLS
Camelus bactrianus V375 iglv JARL01000557.1 39014 SWAQSVLTQPPSVSGSPGQRVIISCTGSSSNIGGGYSVQWYKQLPGTAPILLIYGNSNRASGVPDRFSGSKSGSSASLTITGLQAEDEANYYCGCYDSSLS
Camelus bactrianus V376 iglv JARL01000557.1 28194 SWAQSVLTQLSSMSGSPGQTVTITCTGSSSNIGGGYYLSWYQQLPGTVPKLLIYNAHNRASGVPNRFSGSKSGSLAFLTITGLQAEDEADYYCGCYDSSLSA
Camelus bactrianus V377 iglv JARL01000558.1 6919 SLSQPVLTQPPSLSASPGASARLNCTLSSGTVVGGYHINWFQKKAGSPPRYLLRFYSDSNKHQGSGVPSRFSGSKDASANAGLLLISGLQLEDEADYYCGT
Camelus bactrianus V378 iglv JARL01000560.1 14749 SWAQSVLTQPPSMSGSPRQSVTISCTGSSSNIGGNYVNWYQHLPGTAPKLLIYDNSNRASGVPERFSGSKSGSSASLTITGLQAEDEGDYYCASWDDSLS
Camelus bactrianus V379 iglv JARL01000560.1 9642 VVSQTVVTQEPSLSVSPGGTVTLTCGLSSGSVSSSNYPGWIQQTPGQVPRTLIYSTSSRPSGIPSRFAGTISGNKATLTITGAQPEDEADYYCALYPGSYL
Camelus bactrianus V380 iglv JARL01000561.1 90778 SLSQPVLTQPSSLSVSLGASARLTCTLSSGFKVGDFWIRWHQQKPGNPPRYLLTFHSDSDKHQGSGVPSRFSGSSDASANAGLLLISGLQPEDEADYYCAT
Camelus bactrianus V381 iglv JARL01000561.1 79815 SWAQSVLTQPPSMSGSLGQRVTISCTGSSSNIGGGYGVQWFQQLPGTAPKLLIYGNSNRASGVPDRFSGSKSGSSASLTITGLQADDEADYYCGRYDNSLSG
Camelus bactrianus V382 iglv JARL01000561.1 68630 VNSQTVVTQEPSMSVSPGGTVTLTCGLSSGSVTTSNYPGWIQQTPGQAPSTLIYRTSNRLSGVPSRFSGSISGNKAALTITGAQPEDEADYYCAVYMGSGS
Camelus bactrianus V383 iglv JARL01000561.1 61469 SWAPSVLTQPPSVSGSPGQRATISCTGSSSNIGRGNYVEWYQQLPGKAPRLLIYDVNNRASGVPNRFSGSKSGNSVSLTITGLQAEDKADYYCEDWDNSLNG
Camelus bactrianus V384 iglv JARL01000561.1 56085 VDSQTVVIQNSSLTLSPGETVTLTCGPSSGSVTTSNYPSWYQQTPGQAPQVLSIAEAAEGPQSGVPSRLSGSISGIKATLTNTEALPKDKADYYCALYPGS
Camelus bactrianus V385 iglv JARL01000561.1 45613 VDSPTVVTQEPSLSVSPGWTVTLTCGLSSGSVTTSNDPGWIQQTPGQVPRTLIYRTSSHLSGVPSCFFRSISGNKAALTIMGAQPKDEADYYCALDMGSGS
Camelus bactrianus V386 iglv JARL01000561.1 39361 TLSQLVLTQPPSLSASLGASARLTCTLSSGNSVGSYYITWYQQSDSRRPRGPGVPSRFSGSKNASASAGLLLISGLQPKDEADYYCAAVDSSSN
Camelus bactrianus V387 iglv JARL01000561.1 28179 VDSQTVVTQEPSLSVSPGGTVTLTCGLSSGSVTTSNYPGWYQQTPGQAPRALIYNTNSRPSGVPSRFSGSISGNKAALTITGAQPEDEAEYYCALYMGSGS
Camelus bactrianus V388 iglv JARL01000561.1 11362 SLSQPVLSQPPSASASLGASAKLTCTLSSGYSSYSVDWYQQVPGKSPRFLMRVGTSGVGSKGGGVSDRFSGSGSGLERYLTIQNIQEEDEAEYICGADYGSYM
Camelus bactrianus V389 trbv JARL01000612.1 68667 SMDTGVTQSPGHLVREKEQRAKMYCVPKEGHAYVYWYRKKLEEAFEFLVYLRNEDIVEKIAGFEQRYSAKCPKNSPCSLEINSTQAGDSARYFCASSE
Camelus bactrianus V390 trbv JARL01000612.1 53816 SMDTGVTQTPRNRITNTGNSVLLECSQTKGHDYMYWYRQDPGLGLRLIYSSYNVNDTNKGELSNGYRVSRMEKEKFFLFLETPVPNQTALYFCASSY
Camelus bactrianus V391 trbv JARL01000612.1 48814 LTNADVNQTPRYAVIGTGKKITLECNQAMDHESMYWYRQDPGMEPQLIHYSRGVNTTEKGDRPSESTVSRIRKDQFPLTLEATSPSQTSTYFCASSE
Camelus bactrianus V392 trbv JARL01000612.1 42710 LKEAAVTQSPRHRILKTEQKLTLQCSQRMNHYSMYWYRQDPGFGLRLIYYSTGTRTTKQGDVPEGYHVSREDQADFPLTLQSASTNQTSVYFCASSE
Camelus bactrianus V393 trbv JARL01000612.1 37382 LSPSPTGPVEADVTQSPTHCITETRKKLTVTCSQNMNHDAMYWYRQDPGLGLRLIYFSRNVNFTEKGDIPDGYTVSRKEKKDFSLTLESASITQTSLYLCASSV
Camelus bactrianus V394 trbv JARL01000612.1 29015 LMDAKVTQIPRYLVKRMGEKVLIDCVQDMGHERMFWYRQDSALGLRLLHYSYDVDIVEKGDMPEGYNVSRKKKERFALTLESASTSQTSVYLCASSI
Camelus bactrianus V395 trbv JARL01000612.1 23241 SAFGALVSQKPSRAICQHGVSMMIQCEADSQVISMYWYRQRPGQSLSLIATANQGSQATYESGFAKEKFPISRPSLNFSVLTVSSVSPEDSSSYFCSA
Camelus bactrianus V460 trbv JARL01007731.1 12801 SGLGAQVSQHPSRAIRERGASVTFQCRAEDFQATIMFWYRQFPEQGLTLIATSNQGSNATYEQGFTKDKFPINHPSLTFSSLTVTSVSPADSSLYFCSAS
Camelus bactrianus V461 trbv JARL01007731.1 5124 STDTGVTQSPGHLVREKEQRAKMDCVPKEGHNYVYWYRKKLEEAFEFLVYLRNGGDIMEEAEGFKQRFSAKCPKNSPCSLEINSTQAGDSARYFCASSE
Camelus bactrianus V462 trbv JARL01007732.1 1489 TVDGGITQTPKYVLKEEGRDVTLECEQDFNYDTMYWYRQDPGQRPRLIYFSLSAKDVQKGDMAEGYGASREKKPLFPLTVTLTQKNQTAVYLCASSI
Camelus bactrianus V463 trbv JARL01007733.1 70869 ALDTGVFQMPKYLITQMGNKMSLKCEQKLGYDSMYWYKQGSKQLLKIMFIYNNKELILNETVPSRFSPESTDKAHLNLHVDSLEPDDSAMYFCASS
Camelus bactrianus V464 trbv JARL01007733.1 61632 PVDSGVTQTPRHLIKARGQQVTLSCSPISGHTSVSWYQQAPSEGPQFLFEFYEKMQRAKGNFPDRFSGQQFDNYSSELIVNFLEVTDSALYFCASSL
Camelus bactrianus V465 trbv JARL01007733.1 58165 QVDSEVTQTPKYLIKPRKQQVTLRCSPVSGHLSVYWYQQALGQGPQFLIQYYRQKETERGNISRRFSGQQFDNSSSELNVSSLELTDSALYLCASSR
Camelus bactrianus V466 trbv JARL01007733.1 54286 PVNAGVIQTPKFQVLKMGQGVTLKCAQDLKHNYMYWYRQDPGHGLRLIHYSAGSGTTNKGDIPDGYSVSRSDVENFTLKLEYATPNQTSVYLCASSY
Camelus bactrianus V467 trbv JARL01007733.1 48926 PTDAEITQTPRYRIVSTGHKTVLECSQHMNHFGMFWYQQDPGQGPRLIHYSNDIGSTAEGEVTEGYRVSRPEKAHFPLTLESASTNQTSLYLCASSV
Camelus bactrianus V468 trbv JARL01007733.1 43809 PLEAGVTQTPRHLIKTTGQMVTLRCSPISGHLGISWYQQAWSQGPQLLFEFYERRQTAKGNFPDRFLAQQFGDSRSELNVSSLQLSDSALYLCASSL
Camelus bactrianus V469 trbv JARL01007733.1 36872 HTKAGVSQSPRHRVTGRGQNVTLRCDPVSDHNRLYWYRQMLGQGLEILTYFQDDDALDKSGMPDARFSAERPQGLSSTLKIQRVEPGDSAEYLCASSL
Camelus bactrianus V470 trbv JARL01007733.1 28734 QVEAGITQSPRYKIAVIGETLTLQCHQTDNHDYMYWYRQDLGHGLKLIYYTYDVNKTDKGEIPDGYSVSRSNIGDFPLTLESVVPSRTSAYLCASSN
Camelus bactrianus V471 trbv JARL01007733.1 23483 LTEGGVAQSPRHKITEERQAVALWCDPISGHSFLYWYRQTLEQDLELLILFEETAGINVLQSPKNRFSAERPSGANSTLKIQSAELGDSAVYLCASSL
Camelus bactrianus V472 trbv JARL01007733.1 3981 HLLAGVAQFPSHRVIEKKQAVSVRCDPVSGHEYLVWYQHAVGREMKFLMSFLRDTVRDASGMLKDRFSAERTEGTYSTLKVHPAEPEDSGVYFCASSL
Camelus bactrianus V473 trbv JARL01007733.1 1863 PVGAMVNQTPRYWVTGTGKPVTLNCSQTLNHDTMYWYQQKPSQAPKLLLYYYITQLNRETDTSDNFQSRQFNTSSCSLDIRSAGVGDSAMYLCASSR
Camelus bactrianus V494 iglv JARL01009257.1 6776 YVASSALTQPSAVSVSLGQTARITCQGGNFGKYYAHWYQQKPGQAPVLVIYKDSERPSGIPERFSGSSSGDTATLTISGAQAEDEADYYCHSAESSAD
Camelus bactrianus V499 trav JARL01010100.1 17083 VSRGENVEQSPPSLSVQEGNSSVITCTYTDSRSDFFPWYKQEPGKGLRFLISIRSNKVKEEDQGLTVLLNKTAKHLSLHITATQAGDAAVYFCAAS
Camelus bactrianus V500 trav JARL01010100.1 11281 SSIAQTVTQEQPPMLVQEKEAVTLDCTYDTSDPTYSLSWYKQPSSGAMTFLIRQDSYNQQNATEGHYSLNFQKASKSIKLVISASQLEDSAVYFCALSE
Camelus bactrianus V501 trav JARL01010100.1 6973 RTRGDSVTQTEGPVTLPESAALTMNCNYSTTTYPTLFWYVQYPGEGPQLLLKASRDKEKGHNKGFEATYHREQSSFHLEKASVRGADSAVYYCALT
Camelus bactrianus V503 trav JARL01010101.1 119003 TVGQGVQQPTDLMAMEGEFVQVNCTYQTSRFDGLSWYQQHDGRAPVFLSYNVLNGWERRGRFSSFLSRSDAHSYLLLKELRTEDSASYLCAVI
Camelus bactrianus V504 trav JARL01010101.1 67422 TLSLAKTIQPVFIDSYEGQEVNIPCNHTNIATSEYIFWYRQFPNQGPQFVIQGYKTNAANEVASLFIPTDRKSSTLSLPWATLRDTAVYYCIVS
Camelus bactrianus V505 trav JARL01010101.1 61426 GAGAQSVTQPDRHGITVPEGARLELRCNYSSSYPPSLFWYVQYPNQGLQLLLKYTSGNGLVSGIKGFVAEFRRNETSFHLKKTSAHWSDSAEYFCAVG
Camelus bactrianus V506 trav JARL01010101.1 56291 GSNEDSVSQTEGQVTPSEGDSLIVNCSYETTQYPALFWYVQYPGEGPQLLLKASRDNEMASNKGFKATYHRKPNSFHLEKASVQGADSAVYYCALG
Camelus bactrianus V507 trav JARL01010101.1 51090 QTVTQPDDHVLISEKASLELRCNYSYGASVYLFWYVQYPCQGLQVLLKYFSGDPLVQGIKSFEAEFKRSESSFNLRKSSVHWSDSAEYFCAVS
Camelus bactrianus V508 trav JARL01010101.1 41506 GVRGMNVEQSPSALSIQEGTSSTLQCNFSNPVNYVQWFRQNPGGGLINLFYITLGMKQNGRLNSTLNSKERYSTLHITASQLEDSATYLCAAE
Camelus bactrianus V509 trav JARL01010101.1 34820 VSRGENVEQSPPSLSVQEGNSSVITCTYTDSASSYFPWYKQEPGKGLRFLISIRSNKVKEEDQGLTVLLNKTAKHLSLHITATQAGDAAVYFCAAS
Camelus bactrianus V510 trav JARL01010101.1 30099 SSIAQTVTQEQPPMLVQEKEAVTLDCTYDTSDPTYSLSWYKQPSSGAITFLISQDSYNQQNATEGRYSLNFQKASKSIKLVISASQLEDSAVYFCALSE
Camelus bactrianus V511 trav JARL01010101.1 23644 RTHGDSVMQTEGPVTLSETAALTINCSYSTTTYPTLFWYVQYSGEGPQLLLKASRDKEKVLKKGFEATYHREQTSFHLEKASVRGADSAVYYCALT
Camelus bactrianus V512 trav JARL01010101.1 16355 VSQGENVKQSPPSLSVQEGNSSVITCTYTDSNSDFFPWYKQEPGKGLRFLISIRSNKVKEEDQGLTVLLNKTAKHLSLHITATQAGDAAVYFCAAS
Camelus bactrianus V513 trav JARL01010101.1 6500 RTCGDSVTQMEGPVTLPESAALTMNCNYSAAGYPTLFWYVQYPGEGPQLLLKASRDKEKVLKKGFEATYHREQTSFHLEKASVRGADSAVYYCALG
Camelus bactrianus V517 iglv JARL01010752.1 3220 SWAQSALIQPPSVSRTLGKTVTIPCAGTSSDVGSGNYVSWYQQLPGTAPKLLIYRVSNRASGIPDGVSDSKSGNKASLIISGLQSEDEADYFCASYRNG
Camelus bactrianus V559 trdv JARL01016805.1 50308 KGVLSAKETQTSRDQTVASGSEVTLPCTFETEYSDPDLYWYRMRPGLSLEFVLYRDNTESLNADFAQGRFSVQHNVAQKTFHLVMSSVRAEDSATYYCVLEY
Camelus bactrianus V577 igkv JARL01018976.1 11990 ARCAIQMTQSPSSLSASLGDTVTIPCQASQSISNELSWYQQKSGQAPKLLIYGASRLQTGVPSRFSGSGSGTSFTLTISGLEAEHLATYYCLQDYSWP
Camelus bactrianus V578 igkv JARL01018976.1 510 SSGEVVLTQTPGSLSVTPGEPASISCKASQSLVHSDGKTYLYWLLQKPGQPPQRLIYQVSNRGSGVPDRFTGSGSGTDFTLKISGVKAEDAGVYYCAQA
Camelus bactrianus V579 trbv JARL01019030.1 979 FLEAEVTQTPGHLVKGTGQKAEMYCVPRKGHNYVCWYQQIPAKEFKFLISFQNNNELDKTGMPKERFSAVCYQNSSCTLKIQPAALQDSAVYLCASSE
Camelus bactrianus V613 igkv JARL01022870.1 68450 CWGQIALTQFPESLAASHGSLVSITCRSSIEVGTSMAWYQQKPKEAPRLLIFGASARASGTPSRFRGSGSGSDFSLAIHGVEAEDVGVYYCQ
Camelus bactrianus V614 igkv JARL01022870.1 64064 ARCATQVTQSPSSLSASLGDTVTITCQASQSISSYLAWYQQKPGQVPKLLIYDASSLYTGVPSRFSGSGSGTSFTLTISGVEAEDVGTYYCQQYNSAP
Camelus bactrianus V615 igkv JARL01022870.1 51124 SSGATVLTQSPALLSKAPGDKATITCRASQSVSNYLRWYKQKPNQPPKLLIQYTSQTISGVPARFIGSGSGTDFTLTISSLEAEDAAKYYCQQSYSSS
Camelus bactrianus V616 igkv JARL01022870.1 46391 ASGSAVLTQTPAILSVSLRESISITCTANESVSDYVSWYQQKPGQAPRLLIYDADDRYPGVPDRFVGLQSGTQFILTINKVEADDAASYYCQQG
Camelus bactrianus V617 igkv JARL01022870.1 37901 ARCATQMTQSPSSLSASLGDTVTITCQASQSISSYLAWHQQKPGQAPKLLIYGASSLHTGFPSRFSGSGSGTSFTLTISGVEAEDVGTYYCLQHNSYP
Camelus bactrianus V618 igkv JARL01022870.1 21915 TRAETVLTQSPALVSATPGDKVTLTCKASQDIDDDIMWYQQKPGQAPRLIIKYVSTLISGVPSRFSGSGYGTDFNLTIDNMKSEDAAYYFCQQDDN
Camelus bactrianus V649 trdv JARL01025262.1 656 SGVAQTVTQDQPAVSSHVGETATLNCRYETSYTEYYIFWYKQPPSGEMTFLIEQYSSSGNAKSGRYSVNFRKAEKSLSLTISNLQLEDSAKYFCALRE
Camelus bactrianus V770 ighv JARL01037190.1 4637 VQAEVQLVESGGGLVQPGGSLRLSCAASGFTFSNNWMHWVRQAPGKGLEWVSSIYTGDGSTNSADSVKGRFTISRDNTKNMLYLQMNSLKSEDTALYYCAK
Camelus bactrianus V2 trbv CAOW010001846.1 5183 PTDAGVTQTPRHQVAGMGQAVTLECEPVSDHTALFWYRQTSEQGLALLIYFRNQAPVDDTGMPKDRFLATMTNKSFSTLNIQPAEPRDSATYLCASSM
Camelus bactrianus V4 trbv CAOW010002522.1 935 LTNADVNQTPRYAVIGTGKKITLECNQAMDHESMYWYRQDPGMEPQLIHYSHGVNTTEKGDRPSESTVSRIRKDQFPLTLEATSPSQTSRYFCASSE
Camelus bactrianus V5 trbv CAOW010002522.1 7041 LKEAAVTQSPRHRILKTEQKLTLQCSQRMNHYSMYWYRQDPGFGLRLIYYSTGTRTTKQGDVPEGYHVSREDQADFPLTLQSASTNQTSVYFCASSE
Camelus bactrianus V8 trbv CAOW010008324.1 2470 SMDTGVTQTPRNRITNTGNSVLLECFQTKGHNYMYWYRQDPGLGLRLIFASYNVNDTNKGELSNGYRVSRAEKAKFFLFLETPVPNQTALYFCASSY
Camelus bactrianus V11 trbv CAOW010017149.1 3712 FLEAEVTQTPGHLVKGTGQKAEMYCVPRKGHNYVCWYQQIPAKEFKFLISFQNNNELDKTGMPKERFSAVCYQNSSCTLKIQPAALQDSAVYLCASSE
Camelus bactrianus V16 trbv CAOW010052183.1 4758 HLLAGVAQFPSHRVIEKKQAVSVRCDPVSGHEYLVWYQHAVGKEMKFLMSFLRDTVRDASGMLKDRFSAERTEGTYSTLKVHPAEPEDSGVYFCASSL
Camelus bactrianus V17 trbv CAOW010052183.1 6982 PVGAMVNQTPRYWVTRTGKPVTLNCSQTLNHDTMYWYQQKPSQPPKLLLYYYDTQLNRETDTSDNFQSRRLNTSSCSLDIRSAGVGDSAMYLCASSR
Camelus bactrianus V24 trbv CAOW010065840.1 1116 TVDGGITQTLKYVLKEEGRDVTLECEQDFNYDTMYWYRQDPGQRPRLIYFSLSAKDVQKGDMAEGYGASREKKPLFPLTVTLTQKNQTAVYLCASSI
Camelus bactrianus V35 trav CAOW010093913.1 1287 QTVTQPDDHVLISEKASLELRCNYSYGASVYLFWYVQYPCQGLQVLLKYFSGDPLVQGIKSFEAEFKRSESSFNLRKSSVHWSDSAEYFCAVS
Camelus bactrianus V42 igkv CAOW010115374.1 3249 ASGSAVLTQTPAILSVSLRESISITCTANESVSDYVSWYQQKPGQAPRLLIYDADDRYPGVPDRFVGLQSGTQFILTINKVEADDAASYYCQQG
Camelus bactrianus V54 trav CAOW010156465.1 1390 TVIEAAIEQPKSKDFTEGEDVTLPCNHSTIGLNDYIHWYWQNPNQSPQYIIHGLQDTVTNNMASLTIATDRKSSTLVLPRVALRDSAVYYCALTE
Camelus bactrianus V76 trav CAOW010245563.1 28 VTGEDVEQSPPVLSLQEGATSTLWCKFSTTVSNLRWYRQNPGGRLIHLFYVASGTKHDGRFSATIVIQERRSSLNISSSQTTDSATYFCAVSTVLP
Camelus bactrianus V86 trgv CAOW010298662.1 3981 GLALSKVEQSQVSVSTEVRKSIEINCKIESRDFESETVYWYRQKRKQALEHLIFVISTTTTARNLIDGKNNKVEARKNSQKLTSTLTVNFIEKEDTGIYYCAGWY
Camelus bactrianus V94 trav CAOW010336682.1 57 SVKAQKVTQDQPAISRPEEEAATLDCVYEAKGYSYYLLWYKQAASGEMLFLIHQESYNERNTTEGRYFLNFQKSASSISLTITALELGDSAVYFCALN
Camelus bactrianus V98 trdv CAOW010382376.1 652 KSVLSAKVTQTSRDQTVASGSEVTLPCTFETEYSDPDLYWYRMRPGLSLEFVLYRDNTESLNADFAQGRFSVQHNVAQKTFHLVMSSVRAEDSATYYCVLEY
Camelus bactrianus V120 trbv CAOW010504636.1 162 HTKAGVSQSPRHRVTGRGQNVTLRCDPVSDHNRLYWYRQMLGQGLEILTYFQDDDALDKSGMPDARFSAERPQGLSSTLEIQRVEPGDSAEYLCASSL
Camelus bactrianus V157 trbv CAOW010050867.1 3879 ALDTGVFQMPKYLITQMGNKMSLKCEQKLGYDSMYWYKQGSKQLLKIMFIYNNKELILNETVPSRFSPESTDKAHLNLHVDSLEPDDSAMYFCASS
Camelus bactrianus V167 trav CAOW010099368.1 529 GAAAQSVTQPDRHGITVPEGARLELRCNYSSSYQPTLFWYVQYPNQGLQLLLKYTSGNGLVSGIKGFEAEFRRNETSFHLKKTSAHWSDSAEYFCALS
Camelus bactrianus V214 trav CAOW010255554.1 5948 SSIAQTVTQEQPPMLVQEKEAVTLDCTYDTSDPTYSLSWYKQPSSGAMTFLIRQDSYNQQNATEGRYSLNFQKASKSIKLVISASQLEDSAVYFCALSE
Camelus bactrianus V225 trav CAOW010309890.1 1380 GAGAQSVTQPEDHVSVFARAPVQVKCNYSYSGSPALFWYVQYPKQSLQLLLKHISKESVKGFTADLNTREASFHLKKPSAQEEDSAMYYCAVS
Camelus bactrianus V240 trav CAOW010428055.1 1374 CSIAQKVTQDQPPMLVQEKEAVTLDCTYDTSNPTYSLSWYKQPSSGAMTFLIRQDSYNQQNATEGRYSLNFQKASKSIKLVISASQLEDSAVYFCALSE
Camelus bactrianus V243 trav CAOW010432035.1 444 CWSLSGPHRVTGVVGGSLSVQCRYKKEFIDHTKYWCKSPCLLSWKMVETTESEREVRNDRVSIRDHPASLTFTVTLESLRMDDAGTYYCGIDK
Camelus bactrianus V262 trav CAOW010559296.1 555 TVGQGVQQPTDLMAMEGEFVQVNCTYQTSRFDGLSWYQQHDGRAPVFLSYNVLNGWERRGRFSSFLSRSDAHSYLLLKELRTEDSASYLCAVI
Camelus bactrianus V267 igkv CAOW010608471.1 658 TRAETVLTQSPALVSATPGDKVTLTCKASQDIDDDIMWYQQKPGQAPRLIIKYVSTLMSGVPSRFSGSGYGTDFNLTIDNMKSEDAAYYFCQQDDN