WGS Statistics
Organism WGS Record. Vs Total IGHV IGLV IGKV TRAV TRBV TRGV TRDV
Anolis carolinensis AAWZ00000000.2 (AAWZ02) 164 89 30 15 23 7 0 0
Vgene Table
Organism Vgene Locus contig Contig Pos. AA sequence
Anolis carolinensis Vs210 iglv AAWZ02023250.1 106179 TLGQYVVSQPPSASVSLGENGQITCSGNKIGGKYVQWYQQKPGKAPVLIVYGSILGSLSILDRFSGTNSGNTATLSISRAQAEDEADYYCQVWDS
Anolis carolinensis Vs473 trav AAWZ02011390.1 38326 SDSAVTVTQEPLLTSLLQQEKLTIKCSVNSQNYNFLWYRQLPGKIELQVLGNLYSYESKLADVDSTLDARLSGEWLDSGKEKMNLHLQSLQPGDTGLYLCAAK
Anolis carolinensis Vs189 iglv AAWZ02023250.1 49999 VHSQGTLTQPASVSGSPGQTITLSCTKGSGNWDSTVSWYQQKSGEAPRYVHANGYNRGPGIPDRFTATSSGDTGSLTITNVQAGDEANYYCMRWY
Anolis carolinensis Vs188 iglv AAWZ02023250.1 47077 VHSQGTLTQPSSVSGSPGQTVTLSCTKDSGNWYSYASWYQQKSGEGPRFVHCNGCSRGPGIPDRFTATKSGDTGTLTITNVQAEDEAYYYCAWWY
Anolis carolinensis Vs187 iglv AAWZ02023250.1 44883 VHSQGTLTQPASVSGSPGQTVTLSCTKDSGNWGSYVNWYQQKSGEGPRFIHCSSCGSTRGPGIPDRFTATASGNTGSLTITNVQAGDEANYYCAWWY
Anolis carolinensis Vs186 iglv AAWZ02023250.1 37333 ARAQFVLTQPPSIAADTGTTVQISCTRNSGSISSYYVSWYQQKPGNAPKLVIYQFSNRPTGIPDRFTGSYEKSANSATLSISNLQAEDEADYYCLSYDGSY
Anolis carolinensis Vs185 iglv AAWZ02023250.1 33146 VSSQIVPIQPASQSVSLGQTVKLSCTFSDSSSFKIAWFQQRPVLGPRFVQYTGSSRGEGIPDRFTASQSGNTGYLTITNTQAEDEAEYYCGRWNNAGIL
Anolis carolinensis Vs183 iglv AAWZ02023250.1 29064 PSVQQLQSLKDPESVAQGGTITLFCKYNSGNIVNGNYPWWAQQIPGSRPHLVMHHTSTRPSDVPARFSGSRSGNVMSLTITGVQEEDEAVYYCAVVTEIG
Anolis carolinensis Vs182 iglv AAWZ02023250.1 27656 SSVQQLQTLKDPESVAQGGTVTLSCRYNSGNIGDNNHPSWVQQIPGSIPRLVMHSTSTRPTGVPNRFSGSRSGNMMSLTITGALVEDEAMYYCVIWTGSE
Anolis carolinensis Vs181 iglv AAWZ02023250.1 26211 PSVQQLQTLKDSESVAQGGTVILSCRYNSGNIGDSNYPSWVQQIPGTKPRRMMYHTSTRPSDVPARFSGSRSGNVMSLTITGALAEDEAVYYCAVWTGNG
Anolis carolinensis Vs180 iglv AAWZ02023250.1 24602 SSVQQLQSLKDPELVALGGTVTLSCTYNSGNITDNNYPWWIQQNPGSKPRRMMYYTSIRPWDVPARFSGSRSGNVMSLNITGVQAEDEAVYYCAVWTESG
Anolis carolinensis Vs208 iglv AAWZ02023250.1 102367 ARSQPSLTQPRSASVSLGGTMKLSCAMSSGFDIGSYSVYWYQQKPGSAPRYLLRFNSDSSKHQGTGVPSRFSGSKDTSRNTGYLNIAGTLAEDEADYHCAV
Anolis carolinensis Vs209 iglv AAWZ02023250.1 104404 SLGQYVVSQPPSVSVSLGQNGQITCSGNSIENRYVQWYQQKPGKAPVLIIYQDRRRPSGIPDRFSGTNSGDTATLNITQAQEEDEADYYCQVWNSNI
Anolis carolinensis Vs204 iglv AAWZ02023250.1 94164 ARSQPSLTQPRSASVSLGGTMKLSCAMSSGFNIGSYSVYWYQQKPGSAPRYLLWFNSDSSKHQGTGVPSRFSGSKDTSRNTGYLNIAGTLAEDEADYHCAV
Anolis carolinensis Vs205 iglv AAWZ02023250.1 96171 TLGQYVVSQPPSASVSLGENGQITCSGNSIEKKYVHWYQQKPGKAPVLIIYKDSQRPSEISDQFSGTNSGDTATLNITRAQAEDEADYYCQVWDGNSE
Anolis carolinensis Vs206 iglv AAWZ02023250.1 98537 SDAQLTVSQPTSDSVSLGKTVKLSCSVSVSGRYIYWYQQKPGNAPRYLLYYYSASNKHQGSGVPSRFSGSKDASGNIGYLTISGALAEDEAVYYCAAWQSNV
Anolis carolinensis Vs207 iglv AAWZ02023250.1 100139 SDAQLTVSQPTSDSVSLGKTVKLSCSVNPGGRNIYWYQQKPGNAPRYLLYYYSDSSKGQGSGVPSRFSGSMHASNNIGYLTISGALAEDEAVYYCAAWANNV
Anolis carolinensis Vs200 iglv AAWZ02023250.1 82544 VTSQPTLTQPTSASEALGQTMKLSCSISSNPSNVYWLQQTSGRAPRFIHCDGCNRGPGISDRFTGTRSGNMGYLTITNLQAEDEAVYYCYMWYGSGSM
Anolis carolinensis Vs201 iglv AAWZ02023250.1 84322 SSAGYVLTQPSFVSIRLQQNGQITCSGNSIGGKNVHWYQQKPGKAPVLIIYNDSNRPLGISERFSGTNSGNTATLSISRAQAEDEADYYCQVWDS
Anolis carolinensis Vs202 iglv AAWZ02023250.1 88652 ANAQRVLSQPASASVSLGGTVKVSCALDRGASINDYIVSWYQRKSGSSPRYLLQYKSHTEKDHGSGVPPRFSASKDLSSNTGYLSIAGALAEDEADYYCVIW
Anolis carolinensis Vs203 iglv AAWZ02023250.1 91466 ISQVASVSVSPANTAKIPCAMRSGLSIGSYWVSWYQQKPGAAPRFLLEYYSDSSKNHGSGVPSRFFGSKDTSSNSCYLNIGGVLAEDEADYYCAVWYNSE
Anolis carolinensis Vs261 trav AAWZ02028512.1 36882 ILLYKAEKITQVPLMDALEGTGLELSCSHPSASAAETIFWYQQFPNQGLRYIVSAYNKEEKSNILEEVTLVVSEDRKSSILSFKRATLEDSAVYYCALG
Anolis carolinensis Vs198 iglv AAWZ02023250.1 76068 VHSQGMLTQPASVSGSPGEMFTLSCTKGSGNWNSAVYWIQQKSGEAPRFVHCNGCSSRGPGIPARFTATGSGNTGTLTITNIQAEDEADYYCVC
Anolis carolinensis Vs190 iglv AAWZ02023250.1 52182 VHSQGMLTQPSLASGSPGQTVTLSCTKGEGNWNSEVYWIQEKSGEAPRIVHCDICSRGEGIPDRFTATSSGNTGSLTITDIEAEDEADYYCIAWYKTGSV
Anolis carolinensis Vs191 iglv AAWZ02023250.1 56985 PSFQQLQTLKDPESVAQGGTVTMSCRYNSGNIGDGNYPWWTQHVSGSKPRQVMHSTSTRPSGVPARFSGSRSGNVMSLTITGALAEDEAVYYCAVWTGSE
Anolis carolinensis Vs192 iglv AAWZ02023250.1 60729 AHSQRTVSQPDSMSVSLGKTIPLSCSVSSGGWEGAFRWVQQKSGEGPRFIHCNGCSRGAGISDRFTATASGNTGTLTITNVQAEDEADYYCFC
Anolis carolinensis Vs193 iglv AAWZ02023250.1 64194 VHSQRTVTQPASTSVSPGNTIQLSCSRNSGGWDGYFRWIQQKSGERPRFVHCNGCSRGPGIPDRFTATASGDTGTLTITNVQAEDEAVYYCVC
Anolis carolinensis Vs194 iglv AAWZ02023250.1 66265 VHSQRTVTQPASTSVSLGNTIQISCSRSGSGWSSYVHWIQQKSGEVPRYVHGNGYNRGPGIPDRFTATASGGTGTLTITNVQAEDEADYYCVC
Anolis carolinensis Vs195 iglv AAWZ02023250.1 67698 VHSQRTVTQPASTSVSPGNTIQLSCSRSGSGWSSYISWIQQKSGERPRFVHCNGCSRGPGIPDRFTATASGDTGTLTITNVQAEDEAVYYCVC
Anolis carolinensis Vs196 iglv AAWZ02023250.1 71885 VHSQRTVTQPASKSVSTGQTLKLSCSKSSGSWDNRFWWIQQKSGGKPHYVQCSDGSSRGEGIPDRFTASGSGNTGFLTITNVQAEDEADYYCYCWY
Anolis carolinensis Vs197 iglv AAWZ02023250.1 74418 VHSQGTLSQPASVSGSLGQTVTLSCTKSGGNWNSAVHWIQQKSGEVPRFVHCNGCSSRGPGIPDRFTATGSGNTGSLTITNVQAEDEADYYCACWYQTGSS
Anolis carolinensis Vs299 ighv AAWZ02029002.1 44467 VRSNVQLVESGPNILQPGQSLRLTCTITGASVKGTYWEWVRQPPGKGLEWVGEIVWASNKWRPYYDPSVQNRCTFSADSSKNEYYLELKSLSASDTATYYCSGG
Anolis carolinensis Vs298 ighv AAWZ02029002.1 43055 IQSDIQLVESGGDVKRPGESLHLSCQGSGVNFGSYHMNWIRQAPGKGLEWIAIIWYDASQQYYADSVKGRFTISRNNPSSMLHLQMNNLKTEDTATYYCAR
Anolis carolinensis Vs293 ighv AAWZ02029002.1 22698 VHSSVQLVESGPNIRQPGQSLRLTCTVTGESVTNRYWEWVRQAPGKKLEWVSEIYWSSNNWYTNYNPSVQSRSTLTADSSKNEFYLELRSLTAADSATYYCARG
Anolis carolinensis Vs291 ighv AAWZ02029002.1 18874 IQSDIQLVESGGDVKRPGESLRLSCQGSGFNFGSYGMHWIRQAPGKGLEWIAVIWYDASKQYYADSVKGRFTISRNNPSSMLYLQMNDLKTEDTATYYCAR
Anolis carolinensis Vs290 ighv AAWZ02029000.1 44826 INSQSVVLTQTGSELKRPGESVQLTCATSGFVPNDWWMNWVRQKPGKGLEWLARYWKSSVTNYYSPTIQGRFTASKDSSNFYLQMNNLILEDTAVYYCAR
Anolis carolinensis Vs297 ighv AAWZ02029002.1 37778 VHTSVQLVESGPNIRQPGQSLRLTCTVTGDSVENVYWEWVRQPLGKGLEWLGQIDWSGSEWRTFYAPSVQSRSTLSADSSRNEYYLELRSLTVADSATYYCARN
Anolis carolinensis Vs296 ighv AAWZ02029002.1 34560 IQSDIQLVESGGDVKRPAESLRLSCQGSGYNFGDYHMSWIRQAPGKGLEWIAYISYNGNTQYYADVVKGRFTISRNNPSSMLYLQMNGLKTEDTAMYYCAR
Anolis carolinensis Vs295 ighv AAWZ02029002.1 28830 VHSSVQLVESGPNIRQPGQSLRLTCTVTGDSVENNYWEWVRQPLGKGLEWLGEIDWSGSEWRTYYAPSVQSRSTLSADSSKNEHYLELGSLTAADSATYYCARQ
Anolis carolinensis Vs294 ighv AAWZ02029002.1 27454 IQSDVQLVESGGDMKRPGESLRLSCQGSGYNFGGYGMSWIRQAPGKGLEWVAYIYSDASEQYYADSVKGRFTVSRNNPSNMLYLQMNDLKTEDTAMYYCAR
Anolis carolinensis Vs279 ighv AAWZ02028999.1 14932 IVSQVTLTESGGGMKKPGETLCLICTVSGFSLTDNSYSVAWVRQFAGKTLEWIVLIWVDGSSTSNSALQNRISTNKNPSKSQVVFQLNTLKPEDTAMYYCARR
Anolis carolinensis Vs278 ighv AAWZ02028999.1 13281 VSSQIVFTQSEPEVKKPGESTRLTCSVKGFDLNTYAMSWFRQRPGKRLEWLIYYYTPPRNKYSPSIQGRFFASKDSSNLYLQMDNLKQEDTAVYYCAR
Anolis carolinensis Vs271 ighv AAWZ02028997.1 9722 SLGSVTLTQPTAVLGLPGGSITVDCVVSGYDINMHHMHWVRQAAGKGLVYIGGFRTGDPVIVAQEFKGRATPFTSASTAKLRIDALTAEDTSVYYCGRG
Anolis carolinensis Vs273 ighv AAWZ02028997.1 18783 VLSQIQFIQSGSEVKKPGESVKMTCKASGYTFTDYSISWIRQAPGKGLEWVARIRTDNFDTFYLKTLEGRVTISVDTSISTSYLLLTNLKAEDTAVYYCAR
Anolis carolinensis Vs272 ighv AAWZ02028997.1 13350 GSPGAITLTQPSEIKASPGDSLTLDCVVSGFNIDDHHMHWVRRPPGKGLIYIAGFRAGYSTPIANEFKGRVTPSRSGSTAKLRINTLTVKDTAVYYCTR
Anolis carolinensis Vs275 ighv AAWZ02028998.1 2261 VSSQVVLTQSGQEVKKPGESTRLTCPVRGFDLSSYGMVWIRQRPGKGLEWLAYYYTAFSNNYSPTIQGRFFASKDSSNLYLQINNLKQEDTAVYYCAR
Anolis carolinensis Vs274 ighv AAWZ02028997.1 22707 VSSQTGITESGGGIKRPEETVTLTCSVSGFSVGASYMDWVRLPHGKRLQWIGRISNSGTNYYNSALQNRISVTRDTSKNQVFLQLRSLKPEDTAVYYCTNN
Anolis carolinensis Vs277 ighv AAWZ02028999.1 7000 VSSQIILIQSGQEVKKPGESTRVTCSVSGFDLSSYGMHWIRQRPGKGLEWLIYYYTPSSNYYSPTIQGRFFASKDSSNLYLQMNNLKQEDTAVYYCAR
Anolis carolinensis Vs276 ighv AAWZ02028999.1 1117 VSSQVVLSQSGQEVKRPGESTRLTCSVSGSDLSSSNMHWIRQHPGKGLEWLVYYYSASSNSYSPTIQGRFFASKDSSNFYLQMNNLKQEDTAVYYCARE
Anolis carolinensis Vs611 trbv AAWZ02029211.1 11751 YSIAGISQTPSLVLQKGQDASLECTQTEEHERMFWYRQDAGLRLQFLYHFYFENLIEKGTLSNRFVANRPQTKRCNLNILLVERQDSAVYFCASSL
Anolis carolinensis Vs610 trbv AAWZ02029211.1 14121 SSNAEIKQPWSLVLSQGDSATLACSQSHGHNSMYWYRQDRGKGLQLLYSFYSKQLQAQGTVPDRFKADQPQNERCNLNISSAEPGDSAVYFCASSI
Anolis carolinensis Vs284 ighv AAWZ02029000.1 16128 ISSQVTLTVSGGGAKKPGETLHLTCTVSGISLTNCDMHWIRQVPGKGLEWAGVIWRISGSNHYNSALQNRIRITRDISKKQVVLQLNSLNSEDTAAYYCVG
Anolis carolinensis Vs286 ighv AAWZ02029000.1 23075 ISSQITLTETGGGAKKPGETLDMTCIVSGFSLTDYGVQWIRQAPGKGLEWVGGIWSGGSTYYNSALQNRIRITRDTSKKQVFMQLSSLKPEDTAVYYCAR
Anolis carolinensis Vs287 ighv AAWZ02029000.1 25956 ISSQITLTESGGGIKKPGETLHLICTVSGSSLTSLGVHWLRQAPGKGLEWAGAIWTGGGNNYNTALQNRIRITRDTSKHQVFLQLSSLNSEDTAIYYCVGE
Anolis carolinensis Vs280 ighv AAWZ02029000.1 1685 VFSQTLTETGGGVKKPGETLWLTCTVSGFSLTSYAVDWMRQPPGKRLEWVAAIWSNGSPFYNSALQNRMTITKDNSKNQVFLYWTSLTPDDTAIYYCAR
Anolis carolinensis Vs281 ighv AAWZ02029000.1 5132 VCSQVTIIESGGDVKKPGETLRLICTVSGFSITDIKYAVGWIRQPSEKNLEWIGEIWYDGSTYYKSGFQNQISISKDISKSQVILQLNSLKTEDTAVYYCTR
Anolis carolinensis Vs282 ighv AAWZ02029000.1 7334 ISSQVTLTESGGDVKRPGESLDLTCVVSGFSLTDATYAVDWVRQAPGKGLEWTGAIWDDGTSRYDSDLQDRVTITKDNSKKKVFLHMSNLKPEDTAIYYCARHT
Anolis carolinensis Vs283 ighv AAWZ02029000.1 13199 ISTQITLETGGGEKKPGETLDMTCIASGFSLTSYHMHWIRQAPGKGLEWAGAIWTGGSNAYNSALQNRIRITRDTSKKHVFLQLSSLKPEDTAVYYCVRE
Anolis carolinensis Vs288 ighv AAWZ02029000.1 36028 ISSQVTLRESGGGAKNLGETLHLTCTVSGISLTSLGGHWIRQAPGKGLEWAGVIWSISGSNHYNSALQNRIRITRDTSKNQVFLQLSSLNSEDTGIYYCVG
Anolis carolinensis Vs289 ighv AAWZ02029000.1 38775 VDSQNVVLTQVGSEMKTPGESVRLKCATSGFEPNTWYMAWIRQKPGKGLQWLVSYWKPSETNYYLPAIQGRFTASKDSSNFYLHMSNLIPKDTAVYYCAR
Anolis carolinensis Vs367 ighv AAWZ02035138.1 9596 CLSQVSLAEKGREGIITPGTSLRLSCKASGFTFTDYEMYWFRQARGKGLEWVAKVSKPTGSSQWYNSKVMGRFTISRDNPQTLVNLQMNSLKPEDSGMYYCTR
Anolis carolinensis Vs366 ighv AAWZ02035138.1 1821 VFSQVVLTQSGSVLKKPGESHKMTCATSGFTLSSTWMQWVRQKPGKRLEWLLQYYDASSNNYSPAIQGRFTASKDTANFYLQMNNLKAEDTAIYYCAR
Anolis carolinensis Vs474 trav AAWZ02011390.1 27220 TAVTVTQELLSTSLVQEETFTIKCLVNGTGYNFFWYHQLPGKVELESLYFHSDDLQDIVDATLKNHLAGTWLKKGERMSLNFQNLQPSEAGLYLCAAR
Anolis carolinensis Vs369 ighv AAWZ02035139.1 2411 ALSEVLLTQSDLMLTTPGESHKMTCATSGFALSGTWMIWVRQKPGKGLEWLLWYSDTSSNNYSPAIQGRFTASKDTTNFYLQMNNLKVDDTAIYYCAR
Anolis carolinensis Vs368 ighv AAWZ02035138.1 11343 AQSEIRLEESGGGLKKPGGSAHLSCRTTGFPFSSYWMEWVRQGPGKGLEWVARMHPTDSAYIYYSNAVRGRFIISRDNTNSLLYLQMNSLKPEDTAVYYCAR
Anolis carolinensis Vs305 ighv AAWZ02029003.1 9829 VQSEIKLEESGGGVRRPGETVLTSCKASGFTFSSHYMEWARQAPGKGLEWVARIGTSSSYLAYSDAVKGRFVISRDDSNSLLYLQMNNLKTEDTAVYYCSRD
Anolis carolinensis Vs304 ighv AAWZ02029003.1 7916 VKSEVKLEESGGGVKRPGDSLSLSCKGSGFTFRDYYMNWVRQAPGKGLEWVAEIGTSSNPLRYSNAVRGRFIISRDDSNSLLSLQMNNLKTEDSAVYYCAR
Anolis carolinensis Vs307 ighv AAWZ02029003.1 16033 VFSQVVLTQSDSVLKKPGESHKMTCVTSGFALSSYYMQWVRQKPGQGLEWLLEYKNAGSNNYSPTIRGRFTASKDSTNFYLQMNNLKAEDTAVYYCA
Anolis carolinensis Vs306 ighv AAWZ02029003.1 13291 VFSQVVLTQSDPVLKKPGESHKMTCATSGFTLSSTTMQWVRQKPGKGLEWLVEYYSAGSNYYSPSIQGRFTASKDSTNLYLQMNNLKGEDSAVYYCA
Anolis carolinensis Vs301 ighv AAWZ02029002.1 76402 VISEVVLTQSDSVLKKPGDSHKLTCSVTGFDPDSYWMDWVRQKPGSGLEWLVSYLRSGSTNYYSPTIQGRFTASKDSSNFYLQMANLKVEDSAVYYCAR
Anolis carolinensis Vs303 ighv AAWZ02029003.1 5310 VFLDVQLVSSGPGTVRPGETLHMLCKVTGFSISTQYYAWHWVRQPRGKGLEWVTGIYPYDGRKFYATSLKSRITISSDTSKNEFSLQLSSVTSEDSAVYFCAR
Anolis carolinensis Vs302 ighv AAWZ02029003.1 2862 IFLDVQLESSGPGTVRPGETLNLLCKVTGISISTQNYAWHWIRQPRDKGLEWITGIYLYGGRKYYATSLKSRITISSDSSKNEFSLQLSSVTPEDSAVYFCAQE
Anolis carolinensis Vs262 trav AAWZ02028512.1 39778 ILLSNSEISQDLLVEGSDGKELNLSCKLPSASKGDAIHWYRQFPSQVPHFIVSGYNGKVKSDQVEGVFLFIQKDQQSSILSFTGVTLEDSASYYCAVS
Anolis carolinensis Vs263 trav AAWZ02028512.1 43586 ILLCSAEKITQEPFMVGSDGKEVNLSCIHPSAESSTDSIFWYRQFPNQGPEFVVSGYRGEARSGNLKDVLLLISGDRKSSNLSFARANLEDTAMYYCALS
Anolis carolinensis Vs260 trav AAWZ02028512.1 33117 ISQSDSVSQEPSEMEFQEGETAVLHCKFTTTDTAPYLFWYRQYVGRDPRMVVWAYKTSKGNHFTEGNFLTTLFWENKTVPLTIKNISLQDEAVYFCALR
Anolis carolinensis Vs250 trav AAWZ02028511.1 62960 GGTKSEVTQKPASKQVWEGNRFTISCEYATQFSTYFWYKQLPGKAPSLLLYITSAKNETADHFTAEYLDKGKKSVLHLSSAQLEDSGTYFCAVR
Anolis carolinensis Vs309 ighv AAWZ02029005.1 1170 VLSQVVLTQADSVLTKPGESHKLACATSGITLSSTWMHWVRQKPGKGLEWLVQYLNAGSNYYSPTIQGRFTASKDSTNFYLQMNNLKVDDTGVYYCAR
Anolis carolinensis Vs308 ighv AAWZ02029003.1 17727 VLSQVVLTQSDPVMKKSGESHKLACATSGITLSTTWMEWVRQKPGKGLEWLVEYKNAASNSYSPTIQGRFTASKDSTNFYLEMNNLKAEDTAVYYCAS
Anolis carolinensis Vs264 trav AAWZ02028513.1 2292 RTQGQSVSQPEHFVSIQEGQPILLPCIYETAYLSPTLYWYEQLPHQGPQLMLSNYDFANKETEKHKKGFSPKAGGKFFNLTKTSAELRDSAVYFCILS
Anolis carolinensis Vs265 trav AAWZ02028514.1 6388 RRVGASVDQMDGIVTVTQGGHISIDCHYKMSSDYRATPFWYIQPLGEHPRLLLSDFGNGNLSEQFHQGFEAKHERKNKTYNLEKKASQLNDSAVYFCAVS
Anolis carolinensis Vs251 trav AAWZ02028512.1 2923 SLGSAQKTEQAGSATTRDGARFSLTCNLTSVTNQMTVWYRQFPGQGPQYITGAYPGFNGESSHPKSTLHVTKKKDSATLELHHASLGDAAVYFCALQD
Anolis carolinensis Vs370 ighv AAWZ02035139.1 4606 AQSEIRLEESGGGLKKPGGSAHLSCRTTGFPFSGYWMSWVRQGPGKGLEWVARMHPTDSAHIYYSNAVRGRFIISRDNTNSLLYLQMNGLKPEDTAVYYCAR
Anolis carolinensis Vs371 ighv AAWZ02035139.1 8372 VKSEVKLEESEGGVKRPGDSLSLSCKASGFTFSSFYMDWVRQAPGKDLEWIAEIGTSSSPLRYSDAVKGRFIISRDDSNSLLYLQMNSLKKEDSAIYYCV
Anolis carolinensis Vs372 ighv AAWZ02035140.1 1397 VLSQVVLTQSDPVMKKPGESHKMTCATSGFTLSSTWMGWVRQKAGKGLEWLVWYYSTTRNYYSPTIQGRFTASKDSTNFYLQMNNLKAEDTAVYYCAK
Anolis carolinensis Vs373 ighv AAWZ02035140.1 2960 CLSQVLLVKKGGEGIVTPGSSLHLSCKAFGFTFTDYEMHWVRQAKGKGLEWVAGVSKPTGSSQWYNPKVKGRFNISRDNPQTSVNLQMNNLKPEDSGMYYCTR
Anolis carolinensis Vs374 ighv AAWZ02035140.1 5213 AQSEIRLEESGGGLKKPGGSAHLSCQITGFTGYYMSWVRQAPGKGLEWVAQMHPTDSAYIYYSNAVRGRFIISRDNANNILYLQMNSLKPEDTAVYYCAR
Anolis carolinensis Vs375 ighv AAWZ02035141.1 2861 IQSEIHLKESGGGVKKPGGSFRLSCQASGFPFSNHWMSWVREKPGKVFEWIGQINQDGSSKYYAASVDGRISISRNNPSNMLYLEMNSLIMEDIAVYYCARDR
Anolis carolinensis Vs377 ighv AAWZ02035142.1 9412 SPSEIRLIQSDRETLKPGESLKLTCAASGEAIRKGAGWNWVREPPGKRLEWLGWGFFNGPTWITHYGSAFRGRLSVTLDASRNEYYLQQSSMTTADSGIYYCAR
Anolis carolinensis Vs258 trav AAWZ02028512.1 28083 VAQGDSVSQSLSEVSITEGQDALLHCDFSTTSSTPYLFWYHQFPNHPPGHILTKHKYLPDEPDGKYSGTLNSEGNAVTLKIWEVSPADEAVYYCALS
Anolis carolinensis Vs670 trbv AAWZ02039725.1 2736 PRSGEGLLFQVPKWVSRKIGEEIAMQCFQNDTDHSWMYWYQQKATGRQMEFIGMLVRGSPTPTFEDKFKDKGFVIQNYREKDCILKIHNLTAEDSAMYFCASS
Anolis carolinensis Vs316 ighv AAWZ02029007.1 5299 IKSEVKLEESEGGVKRPGDPLSLSCKASGFTFSSFYMDWVRQAPGKDLEWVAEIGTSSSPLRYSNAVKGRFIISRDDSNSLLYLQMNSLKKEDSAIYYCV
Anolis carolinensis Vs317 ighv AAWZ02029007.1 8743 VLSQVVLTQSDPVLKKPGESHKMTCATSGFILSSYWMHWVRQKPGKGLEWLLQYYDASSNNYSPTIQGRFTASKDTTNFYLQMNNLKVDDTGVYYCAR
Anolis carolinensis Vs314 ighv AAWZ02029006.1 1354 VFSQVVLTQSDPVLKKPGESHKMTCATSGFPLSDNWMQWIRQKPGQGLEWLLEYKNAGSNNYSPTIRGRFTASKDSTNFYLQMNNLKAEDTAVYYCA
Anolis carolinensis Vs315 ighv AAWZ02029007.1 1411 AQSEIRLEESGGGLKKPGGSAHLSCRTTGFPLSSYWMSWVRQGPGKGLEWVARMHPTDSAHIYYSNAVRGRFIISRDNTNSLLYLQMNGLKPEDTAVYYCAR
Anolis carolinensis Vs312 ighv AAWZ02029005.1 17500 VFAQVVLTQSDPVLKKPGESHKMTCATSGFTLSSTTMEWVRQKPGKGLEWLVEYYSAGSNYYSPSIQGRFTASKDSTNFYLQMNSLKAEDTAVYYCAR
Anolis carolinensis Vs313 ighv AAWZ02029005.1 21264 VLSQVVLTQSDPVMKKPGESHKMTCATSGFTLSSTWMGWVRQKAGKGLEWLVWYYSDGNKHYSPTIQGRFTASKDSTNFYLQLNNLKEEDTAVYYCAR
Anolis carolinensis Vs311 ighv AAWZ02029005.1 10937 CLSQVSLAEKGREGIITPGTSLRLSCKASGFTDYEMYWVRQAKGKGLEWVAKVSKPTGSSQWYNSKVMGRFTISRDNPQTLVNLQMNSLKPEDSGMYYCTR
Anolis carolinensis Vs318 ighv AAWZ02029007.1 10132 CLSQVLLVKKGGEGIVTPGSSLHLSCKAFGFTFTDYEMHWVRQAKGKGLEWVAGVSKPTGSSQWYNPKVKGRFNISRDNPQTSVNLQMNNLKPEDSGMYYCTR
Anolis carolinensis Vs319 ighv AAWZ02029008.1 1719 CHSEVQLVESGGGVEAPGGSLLLTCKASGFPFTNYSMYWIRQAPGKGLEWVAQVSYPTGSKQWYNPKVQGRFNISRNNPQTSAYLQMEDLKPEDSATYYCAR
Anolis carolinensis Vs389 ighv AAWZ02037302.1 263 VFSQVVLTQSDSVLKKPGESHKMTCVTSGFALSSYYMQWVRQKPGQGLEWLLEYKNAGSNNYSPTIRGRFTASKDSTNFYLQMNNLKAEDTAVYYCA
Anolis carolinensis Vs664 ighv AAWZ02037858.1 5825 IVSQVTLTESGGGMKKPGETLCLICTVSGFSLTDNSYSVAWVRQFAGKTLEWIVLIWVDGSSTSNSALQNRISTNKNPSKSQVVFQLNTLKPEDTAMYYCARR
Anolis carolinensis Vs663 ighv AAWZ02037858.1 7476 VSSQIVFTQSEPEVKKPGESTRLTCSVKGFDLNTYAMSWFRQRPGKRLEWLIYYYTPPRNKYSPSIQGRFFASKDSSNLYLQMDNLKQEDTAVYYCAR
Anolis carolinensis Vs612 trbv AAWZ02029211.1 4363 HTDGEIQQPPSFIVEKGASVRFQCKKSNNHDAMYWYQQQQGKGPQLLYFSRANIPDSEQKETNDDRFSAQRLKFEDFDLSISSVEMEDSATYFCASS
Anolis carolinensis Vs323 ighv AAWZ02029009.1 2508 VHSQVVLTQSGGALKKPGESLQMTCGTSGFTLSSTWMSWVRQKPGQGLEWLVLYYNTASGNSHYSSIIQGRFTASKSGSNFYLHMSNLKIEDTAVYYCA
Anolis carolinensis Vs322 ighv AAWZ02029008.1 15342 IHSQVTLDQDSSVRLRPSETLRLTCKVSGMSLTTSGYAVSWIRQPTGKGLEWLCLIYWDDDTRYSNSLKTRLTISRDVSKSEVYLEMSGMETKDTGRYYCARR
Anolis carolinensis Vs321 ighv AAWZ02029008.1 8588 IPSEAQLVESGGGVRRPGESLQLSCLASGITFSSYGMNWVRQAPAKGLEWVAYISPSSGTIYYLDQVKGRCTISRDNSKNLLYLQMNNLKPEDSAVYYCAR
Anolis carolinensis Vs327 ighv AAWZ02029009.1 16279 ALSEIQLIQPKSMAVAPGEMLNLNCNAKGFSVSGGTYLNWVRRPPGKKMVWLGFVDWTGITWRRMYAPFLQGRITISADTSTNSYSLQLRFLTAEDTATYYCAK
Anolis carolinensis Vs326 ighv AAWZ02029009.1 12989 ICSEIKLVETGGGIKTPGNDFNLICTAFGFSVTDYGVNWIRQVTGKAPQWMGVQWGGGSIDYNPALRSRITITRDPAKRQSYLRVNDASEHDSGTYYCAIQYGT
Anolis carolinensis Vs325 ighv AAWZ02029009.1 10502 VHSQVVLTQSGEALKNPGESHQMTCGTSGFTLSSTWMNWVRQKPGQGLEWLVHYYGTSSGQSFYSSAIQGRFTASKSGSNFYLHMTNLKIEDTAVYYCAR
Anolis carolinensis Vs324 ighv AAWZ02029009.1 7568 SSSEIQLTQSDGQTLKPGEILKMTCAVSGYSISSSNWNWIRQPPGKGLEWLGRGYFSSSSWRTQYSSAFSSRISITADASRNEYSLQLSSVTTADSGVYYCAR
Anolis carolinensis Vs329 ighv AAWZ02029010.1 16310 SPSEIRLTQSDGQTLKPGEILKMTCAVSGYSISSGYNWNWIRQIPGKGLEWLGRGYFSSSSWRTNYGSAFSSRISITVDASRNEYYLQLSSMTTADSGVYYCARE
Anolis carolinensis Vs328 ighv AAWZ02029010.1 12658 VHSQVVLTQSGEALKKPGESHQMTCGTSGFTLSNTWMNWVRQKLGQGLEWLVFYYGTSSGQSYYSSTIQGRFTASKSGSNFYLHMSNLKIEDSAVYYCAR
Anolis carolinensis Vs179 iglv AAWZ02023250.1 22598 FGSALTQTSLASVGLGATATISCRMPGVDFISSVSPSWYQQKPGRAPRLLIYKSKERAPRVSERFSGDSSDNTATLTIVRVQAEDEGDYYCTVWHNSK
Anolis carolinensis Vs257 trav AAWZ02028512.1 23880 FSQSDAVSQWPSQQEIQEGETVTLHCNFTTLGSSPNLFWYRQDVSRAPQLIIQAYKTVAKENRFLEGKYSTFLFMENKTVPLTIKDVSLQEEVVYYCALS
Anolis carolinensis Vs256 trav AAWZ02028512.1 23459 AGQSESVTQPHREMSVKEGQDALLLCSFNTTSSNPDLFWYRQFPSQYLQHILTINKYYSLMDPVGKYSGTLKKNTVDLKIGGVSPADEAVYYCALR
Anolis carolinensis Vs255 trav AAWZ02028512.1 18787 ILQSRADIVQDSFKTALDGKPVDLSCTHSSATTETIFWYRQFPNQGPQYIASGYSGVVKSTTLDGSLHISSDRKSNRFAFTKVTLEDSAVYYCALS
Anolis carolinensis Vs254 trav AAWZ02028512.1 14826 GSLGLPINQTEGVVTVTEGSRIVLKCNYDSTIYYLYWYIQHPGQPPKLFLKDFSDSSAEGSVRGFHAPKDNTLRIFSLEKAASQLSDSAVYFCAGG
Anolis carolinensis Vs253 trav AAWZ02028512.1 9579 KVYGQSVTQTEGPVAVQEGQNILLPCKYETSGSPFLFWYEQYPNNPPRLLLTSYDGQDAKTNIRTRDFFHQHDKTNKNFDLRKHSAELKDAAVYFCALS
Anolis carolinensis Vs252 trav AAWZ02028512.1 7455 LSLGLPISQPEAIVSVTQGDPIILKCIYDTTVDYLFWYIQHPGCPPTVFWRELGSETSNEGHIRNFSAAKNKSAKTFNMKKSVSQLSDSTVYFCAGR
Anolis carolinensis Vs398 ighv AAWZ02040808.1 1546 VLSQVVLTQSDPVLKKPGESHKMTCATSGITLSTTWMYWIRQKPGQGLEWLVEYYDAGSNKNYSPTIQGRFIASKDSTNFYLQMNNLRADDTAVYYCTR
Anolis carolinensis Vs399 ighv AAWZ02040808.1 4813 VFSQVVLTQSDPVLKKPGESHKMTCATSGFPLSDNWMQWVRQKPGQGLEWLLEYKNAGSNNYSPTIRGRFTASKDSTNFYLQMNNLKAEDTAVYYCA
Anolis carolinensis Vs402 ighv AAWZ02041295.1 4327 VLSQVVLTQADSVLTKPGESHKLACATSGITLSTTWMEWVRQKPGKGLEWLVEYLNAGSNYYSPTIQGRFTASKDNTNFYLQMNNLKAEDTAVYYCAS
Anolis carolinensis Vs400 ighv AAWZ02041188.1 696 IKSEVKLEESGGGVKRPGDSLSLSCKGSGFTFRDYYMNWVRQAPGKGLEWVAEIGTSSSPLRYSNAVRGRFIISRDDSNSLLSLQMNNLKTEDSAVYYCAR
Anolis carolinensis Vs401 ighv AAWZ02041188.1 2635 VQSEIKLEESGGGVRRPGETVLISCKASGFTFSSHYMEWARQAPGKGLEWVARIGTSSSYLAYSDAVKGRFVISRDDSNSLLYLQMNNLKTEDTAVYYCSRD
Anolis carolinensis Vs392 ighv AAWZ02037303.1 2798 VLSQVVLTQSDPVMKKPGESHKMTCATSGFTLGSYWMYWVRQKPGKGLEWLVWYYDTTRNYYSPTIQGRFTASKDSTNFYLQMNNLKVEDTAVYYCAK
Anolis carolinensis Vs390 ighv AAWZ02037302.1 5837 VLSQVVLTQADSVLTKPGESHKLTCATSGFTLSSTWMNWVRQKPGKGLEWLVWYGSAASNSYSPTIQGRFTASKDNTNFYLQMNNLKAEDTAVYYCAS
Anolis carolinensis Vs391 ighv AAWZ02037303.1 1103 VVSQVVLTQSGSVLKKHGESHKMTCATSGFTLSSYYMHWVRQKPGKGLEWLLRYYDASSNNYSPAIQGRFTASKDTTNFYLQMNNLKAEDTAVYYCAR
Anolis carolinensis Vs338 trbv AAWZ02029208.1 31544 NGQSPVLHQSPRSVVQDPGNNTSLDCSLEGYPNPNLYWYRQVPGGAIEHLSYSISKGSATDSGLTHIKGTRPSDVRFILEIDNLSTSDTGTYYCAW
Anolis carolinensis Vs334 ighv AAWZ02029010.1 35638 ALSEIQLIQSKSMAVSPGEMLRLNCKAKGFSVSDRIYLHWVRRPPGKRMVWMGFVDWTGITWRSIYAPFLQGRITISADTSTNSFSLQLRFLTAEDTATYYCAK
Anolis carolinensis Vs335 ighv AAWZ02029010.1 38079 VLSSPQLTQSGPELVIPGGSFKLTCTITGAQASGNYWGWIRQAVGKSLEWLGNIRRAGDGGNDYNPAFVSRISISRDTSKNAVYLHLNSLTAADTAVYYCAR
Anolis carolinensis Vs336 ighv AAWZ02029010.1 39758 SSFQIQLTESGRGLLKPGETLELTCSVTGETITSSYWWDWVRQVSGKGLESMGGWSGSSYYSPALQNRLTISVDPSKTKYFLRLSSLVAADSGMYYCAR
Anolis carolinensis Vs337 ighv AAWZ02029011.1 1947 VLSSPQLTQSGPELVTPGGSFKLTCTITGVQVSDYYWGWIRQTVGKSLEWLGYIQSTAGGGASYYNAAFGSRVTISRDTSKNEIYLQLNSLTTADTAVYYCAR
Anolis carolinensis Vs331 ighv AAWZ02029010.1 22209 ICSEIKLVETGGGIKSLGDDFNLICTASGFSVTDYGVNWIRQVTGKAPEWMGVQWGGGSIDYNPALRSRITITREPAKSQSYLRVNDASEHDSGTYYCAIYYGT
Anolis carolinensis Vs332 ighv AAWZ02029010.1 27942 SSSQIQLTESGRGLLKPGETLELTCTVTGETITSSYWWNWVQQVSGKGLEWMGGWAGSSYYSTALRDRLTISVDPSKTKYFLRLSSLVAADSGMYYCAR
Anolis carolinensis Vs333 ighv AAWZ02029010.1 29758 VHSQVVLTQSSGALKKPGESHEMICGTSGFTLSSTWMSWVRQKPGQGLEWLVYYYGTSSGYSYYSSSIQGRFTASKSGSNFYLHMTNLKIEDTAVYYCAR
Anolis carolinensis Vs245 trav AAWZ02028511.1 34690 VRCQDKVHQEEWKVSQVGENCTITCRYETANFYSLHWYRQYLGEKPTYLFQIVSDKVRQEPNFSAELDKKNRSSQLHVTSVEFGNAATYFCALE
Anolis carolinensis Vs246 trav AAWZ02028511.1 50494 MHGQVRLEQTPATKEMHEGQNATLTCSISIGSLQWYKQSPGQEPIFLMFVHGSQKKDETKHFISEYDFKERRGYLHIVDAQLDHGANYFCVW
Anolis carolinensis Vs247 trav AAWZ02028511.1 53419 TELNADISQPPEVVVSAGKTAQIPCNHGISTYNSLYWYMQKQDVAPDYIISGYSAPVRNGRFNMTIDKGNTSTELSIGEVEIADAGVYYCAV
Anolis carolinensis Vs248 trav AAWZ02028511.1 56149 ETNGQTVNQTEGTMVITEGDQISLDCTYESSYLTYPFWYIQNPGQAPRLFLKDFWKDSERNLQGFNASHDKNKKSVNMKKSASQLSDSAIYFCAVA
Anolis carolinensis Vs249 trav AAWZ02028511.1 59411 ISGQETVLQEDHFAFAKEGEALQLNCSYKGTPNNIQWYKQILGDQIHHMAILYSTKTESYSHFSVSLDKKLKTTSLQWKSIQLNDSAVYFCAM
Anolis carolinensis Vs608 trbv AAWZ02029209.1 959 PRSGEGLLFQVPKWVSRKIGEEIAMQCFQNDTDHSWMYWYQQKATGRQMEFIGMLVRGSPTPTFEDKFKDKGFVIQNYREKDCILKIHNLTAEDSAMYFCASS
Anolis carolinensis Vs259 trav AAWZ02028512.1 29169 ISQSDSVSQEPSEIEFQEGGTVILNCKFTTIDTTPYLFWYRQYVGREPQMVVQAYKTSKENHFTEGNFVTTLFWESKTVPLTIKNISLQDEAVYFCALR
Anolis carolinensis Vs609 trbv AAWZ02029211.1 23812 VCHAVTVTQKERYKIIQVGIQTSIDCNHNDNTYLTILWYRQDSNSADRTLQLVGYSVHGNDPEMTMTTYTIHASLSVPARQAADSAVYFCAVGK
Anolis carolinensis Vs1 igkv AAWZ02015137.1 9106 TSGDIVVTQTPSSLQKNPGDRVDVQCKTSSSVTSSSYSYMNFYQLLPGQKPKLLIYYATNRFEGMPDRFSGRGSGTDFTFTINGVRPEDEGEYYCGQSYDSP
Anolis carolinensis Vs2 igkv AAWZ02015137.1 4844 SSGNVITQTPASLQKNPGDRVEIQCKTSSSVTSSYTNFINFYQILPGQKPKLLIYYATRRFEGTPDRFSGRGSGTDFTFTIDGVRPKDEGEYYCGQVNNSPL
Anolis carolinensis Vs3 igkv AAWZ02015135.1 34361 SSGDIVVTQTPSSLQKNPGDRVDVQCNTSSSVTGSSYSYMNFYQLRPGQKPKLLIYYATNRFEGTPDRFSGRGSGTDFTFTINVVRPEDKGEYYCGQGY
Anolis carolinensis Vs4 igkv AAWZ02015135.1 28189 SSGEIVVTQTPASLQKNPGDRVDIQCKGSSSLDGYINFFQLIPGQKPKLLIYYATNRFQGTPHRFSGQGSGTDYTFSINGVRPEDEGEYYCGHAISYP
Anolis carolinensis Vs5 igkv AAWZ02015135.1 24770 SSGDIVVTQTPASLQKNPGDRVDIQCKTSSTVSTYMNFYKLIPGQKPKLLIYYVTSRFEGTPDRFSGSGSGTDFTFTISVVCPDDEGEYYCGQGYDYP
Anolis carolinensis Vs6 igkv AAWZ02015135.1 20065 STGQIVITQTPALIQANPGDKVIFRCQTSSSMGSYMALYRLKDNQKPKLLIYDVTNRFEGTPYRFSGQGSGTDFTFTINGVQSEDEGEYYCCQRQSYP
Anolis carolinensis Vs7 igkv AAWZ02015135.1 17006 SSGQIVITQTPASLHVNPGDRVTIQCKASSSMSDDMALYQFIPGKNPKLLLYDSSSRFTGTPDRFSGSYSGTDFTFTISGVRPEDEREYYCG
Anolis carolinensis Vs8 igkv AAWZ02015135.1 12876 SSGQIVITQTPASLHVNPGDRVIIQCKAPSSMSNDMALYQFIPGKNPKLLLYESSTRFTGTPDRFSGSYSGTDFTFTISGVHPEDEAKYYCGQYYSRP
Anolis carolinensis Vs9 igkv AAWZ02015135.1 11835 SSGQIVITQAPASLHVNPGDRVSIQCKTSSSISNDMHLYQFIPGQNPKLLIYYATGLFEGTPDRFSGSYSGTDFTFTISGVRPEDEAEYYCGQSNSRP
Anolis carolinensis Vs10 igkv AAWZ02015135.1 10721 SSGEILITQTPVSLHVNPRDRVTLQCKASSSMSDDMALYQFIPGKNPILLLYESSTCFTGSPNHFSGSYSGTDFTFTISGVCPEDEGEYYCGQYYNQIL
Anolis carolinensis Vs11 igkv AAWZ02015135.1 6533 SSGQIVVTQSPASLHVNPGDTVTIKCKASSSISNEMDLYQFIPGQKPKLLIYHATYRFEGTPDRFSGSYSGTDFTFTISGVRPEDEAEYYCGQDY
Anolis carolinensis Vs12 igkv AAWZ02015135.1 2652 SSGQIVITQTPASLHVNPGDRVTIQCKASSSMSDDMALIQFILGQKPKLLIHDGDTRFEGTPDRFSGSYSGTDFTFTISGVRPEDAAEYYCGQDY
Anolis carolinensis Vs13 igkv AAWZ02015134.1 61132 SSGQIVITQTPASLHVNPGDRVTIQCKASSSISNYMHLYQFIPGQKPKLLIYRATSRFEGTPDRFSGSYSGTDFTFTISGVRPEDAAEYYCGQGY
Anolis carolinensis Vs14 igkv AAWZ02015134.1 58483 SSGQIVITQTPASLHVNPGDRVTIQCKASSSMSNDMALYQFILGQKPKLLIHDATSRFTGTPDHFSGSYSGTDFTFTISGVRPEDAAEYYCGQGY
Anolis carolinensis Vs292 ighv AAWZ02029002.1 20283 VHSSIQLVESGPNIRQPGQSVRLTCTITGASVKGPYWEWVRQAPGKGLEWLGQIDWASNNWRTYYNPSVQSRSTLTADSSKNEYYLELRSLTAADSATYYCARR
Anolis carolinensis Vs285 ighv AAWZ02029000.1 18856 INSQVTLTESGGDVKRPGESLDLTCVVSGFSLTDATYAVDWVRQASGKGLEWTGAIWQDGTSRYDSDLQDRVTITKDNSKKKVFLHMSNLKPEDTAIYYCARHT
Anolis carolinensis Vs300 ighv AAWZ02029002.1 73658 AFSDLQLVPTGPGMVRPGEDLSMVCKVTGLSITSSSSYAWYWIRQPSGKSFEAIAGINANTGGTWYAPSLKSRTVISTDTSKNEFSLLLKSLTPADSAVYFCAR
Anolis carolinensis Vs310 ighv AAWZ02029005.1 7083 AFSQVVLTQSGSMLKKPGESHKMTCATSGFTLSSYWMHWVRQKPGKGLEWLLRYYDASSNNYSPAIQGQFTASKDTTNFYLQMNNLKAEDTAVYYCAR
Anolis carolinensis Vs320 ighv AAWZ02029008.1 4199 VRSAIQLEESGGDTKKPGESVRLSCEGSGFTFSSYWMSWVRQAPGKGLEWVAYIHPTSASTYYPDVVKGRFTISRDNSNNMLYLQMNSLKPEDTATYYCAR
Anolis carolinensis Vs330 ighv AAWZ02029010.1 19507 VHSQVVLTQSGGALKKPGESHEMICGTSGFTLSSTWMNWVRQKLGQGLEWLVDYYGTSSGQSYYSSAIQGRFTASKSGSNFYLHMNNLKIEDTAVYYCAR
Anolis carolinensis Vs15 igkv AAWZ02015134.1 56128 SSGQIVITQTPASLHVNPGDTVTIRCKASSSMSNDMQLYQFIPGQNPKLLIYDATSRFTGTPDRFSGSYSGTDFTFTINGVRPEDEGEYYCGQDYSRP