WGS Statistics
Organism WGS Record. Vs Total IGHV IGLV IGKV TRAV TRBV TRGV TRDV
Ailuropoda melanoleuca LNAT00000000.1 (LNAT01) 141 14 35 16 44 16 10 6
Ailuropoda melanoleuca ACTA00000000.1 (ACTA01) 105 4 23 13 36 17 9 3
Vgene Table
Organism Vgene Locus contig Contig Pos. AA sequence
Ailuropoda melanoleuca V62 igkv LNAT01000116.1 4788924 CGGRLLVLTQTPETLAASQDSFISITCRSNMEVGTSMAWYQQKPNEAPRLLIFGASARAAGTPSRFRGSGSGSDFSLTIHGVEAEDVGVYYCQ
Ailuropoda melanoleuca V63 igkv LNAT01000116.1 4797461 ASSEIQMTQSPSLLSASPGDRVTITCRASQNANKWLTWYQQKPGKPPKPRIYEASKLQTGVPSRFSGSGSGTDFTLTISSLEPEDAGTYYCHQYNSNP
Ailuropoda melanoleuca V64 igkv LNAT01000116.1 4802400 VRGSTRLIQSPAFLSVSLRESVFITCRANDSISDYLSWYQQKPGQAPKLLIYDADNLGSGVPDRFSAIQSKTEFILKISTIEAEDAASYYCQQDYTLP
Ailuropoda melanoleuca V65 igkv LNAT01000116.1 4806821 SSGEVVMTQTPLPLPVTLGEPASISCKASQSLLYSNGYIYLYWYLQKPGQSPQLLIYLVSNRHSGVPDRFSGSGSGTDFTLKISRVEAEDVGVYYCMQG
Ailuropoda melanoleuca V66 igkv LNAT01000116.1 4812120 SGSTGEIVMTQSPASLPLSPGEKATFNCRASQSVSSYVAWYQQKAGQAPRLLIYHASSRATGIPDRFSGSGSGTDFTLTISSLQAEDVAVYYCQQYNSGC
Ailuropoda melanoleuca V67 igkv LNAT01000116.1 4822056 SSGEVVMTQTPLSLPITPGEPASISCRASQSLLHSDGKSYLNWYLQKPGQSPRALICEASKRFSGVPDRFSGSGSGTDFTLKISRVEAEDFGVYYCQQSIQSP
Ailuropoda melanoleuca V68 igkv LNAT01000116.1 4846795 SHGEIVLTQSPALLSKALIEKVTITCRASQSISTNLHWHQQKPNQAPKLLVKYASQTISGVPSQFSGSGSGTDFTLTISSLEPEDVATYYCQQSNSNP
Ailuropoda melanoleuca V69 igkv LNAT01000116.1 4855823 SSGEIVMTQSPLSLPVTPGEPASISCKASQSLLHSDGNTYLHWYLQKPVQSPKRLIYRVSNRAPGVPDRFSGSGSGTDFTLKISRVEADDVGVYYCGQGTKK
Ailuropoda melanoleuca V70 igkv LNAT01000116.1 4861356 SSGEIVMTQTPLSLPVTPGEPASISCKASQSLLHSDGNTYLHWYLQKPVQSPKRLIYRVSNRAPGVPDRFSGSGSGTDFTLKISRVEADDVGVYYCGQG
Ailuropoda melanoleuca V71 igkv LNAT01000116.1 4866076 SSGEIVMTQTPLSLPVTPGEPASISCKASQSLLHSNGNTYLHWFQQKPGQSPKRLIYRVSNRDPGVPDRFSGSGSGTDFTLKISRVEADDVGVYYCGQG
Ailuropoda melanoleuca V79 trgv LNAT01000128.1 4766189 LGAGLKLEQPAFVVARLPSDRSATLTCKVDSSVSYIHWYRHQEGEAPRRLLYLDMSRGYAQRDYPMKSDKVNAEKGRDGYSCTLSVLKLEKSDEGVYYCAAWE
Ailuropoda melanoleuca V80 trgv LNAT01000129.1 39109 GGVGLKLEQPALVMVRLPLKPSATLTCKVDSSVSYIHWYRHQEGMAPRRLLYLEMSSSKVERDFPMNADKVNAEKGSDGYSCSLSVLKLRKSDEGVYYCAAWE
Ailuropoda melanoleuca V81 trgv LNAT01000129.1 87369 SGAGLKLDQPDVVVERLGKTASLPCKVDTRVSYIHWYRYQEGSAPQRLLYFDVSGSFARRDLVLKADKVNAKKGRDGYSCNLSVLKLEKSDEGVYYCAAWE
Ailuropoda melanoleuca V82 trgv LNAT01000129.1 142126 SSGAISLEQPDVVVARTGNLAALPCKASTKVNYIHWYHHQEGMAPERILRLDMSGSSMYKDSVLKADKVMATKDKDGTSCNLFVLKLEKSDEGVYYCAAWE
Ailuropoda melanoleuca V83 trgv LNAT01000129.1 196558 GWAWNTLEQPIMVVAPAGSSATLPCKASSRVNYIHWYRLQEGMAPKRLLRVDMSGPYVRRDWVLKADKVNATSEEDSTSCTLSVLKLEKSDEGVYYCAAWQ
Ailuropoda melanoleuca V84 trgv LNAT01000129.1 241915 RLAGIRLEQPALVVARSGTWVTLSCRANTKVSYIHWYQHQEGNAPQRLLIVALFSSYVQTDSVLKGDKVTARRGSDGKSCNLLMSKLEKSDEGVYYCAAWE
Ailuropoda melanoleuca V85 trgv LNAT01000129.1 341665 GHAEIRLEQLTVVVARESSSASLLCTAKTKVSYIHWYRYQEGKAPQRLLRLAMYQSDVRWDPVEKADKVTTIEAKDGYSCTLSVLKLEKSDKGVYYCAAWE
Ailuropoda melanoleuca V86 trgv LNAT01000129.1 361475 TKADILITQLIPSITKKQGNTAFLECQIKTGGLRNNGYIHWYRQKPDQPLKRILYISSNENVVHEQEVDEERYEARKRQRDLSSSLRIHRVEEADAGLYYCACW
Ailuropoda melanoleuca V87 trgv LNAT01000129.1 390129 GLGQVKLEQPEISISRARDKSAHISCKVFISDFNNAKIHWYRQKPDQEIEHLTYIQASSGQVSLGGKKNKLEASKNALTSTSTLNINFLEKQDEAVYYCACWDWD
Ailuropoda melanoleuca V88 trgv LNAT01000130.1 194 GLGQVKLEQPEISISRARDKSAHISCKVFISDFNNAKIHWYRQKPDQEIEHLTYIQASSGQVSLGGKKNKLEASKNALTSTSTLNINFLEKQDEAVYYCACWDWD
Ailuropoda melanoleuca V147 trav LNAT01000226.1 19386452 TSDEDFQVIQPESSVSVRAGEILTLGCNVSARSPAGPVLWFRENGQERQLIYNFSGSQFPRVTQVENSEFNQTDYSIRISDVSPKDVGTYYCVKLTI
Ailuropoda melanoleuca V161 iglv LNAT01000253.1 19278 SLPQPVVTQPPSLSASLGSSARLTCTFSTGFSVGSYQTYWFQQQPGSPPRYLLRFYSDSDKYQGSGVPSCFSGSKDVSANAGVLLIFGLQLEKETDYYCAF
Ailuropoda melanoleuca V164 iglv LNAT01000253.1 137697 CSFPGSWAQSALTQHPSVSGALGWKITISCAGSSSNIRSGNYVSWFQQLPGTPPKLLIYDISSWPSGIPGHFSGSKLTSLTISGLQAEDEADYHCCSYRTS
Ailuropoda melanoleuca V165 iglv LNAT01000253.1 179064 SWAQSTLTQPASVSGALGQRVTISCTGTSNDIGKYNYVSWYQQYPGMAPKTLIYYANTRPSGIPDRFSGSKSGNTASLTISGLQAEDEAEYYCASYRSG
Ailuropoda melanoleuca V166 iglv LNAT01000253.1 202961 SWAQSTLTQPPSLSGALGSTVTISCAGSSSNIGGNNYISWYQQPPGTSPKLLIYRVSSRPSGIPNRFSGLKTGNTAILIISGLQVEDEGDYYCTSVTLSDN
Ailuropoda melanoleuca V167 iglv LNAT01000253.1 213597 SWAQSALTQPPSVAGTLGNTITISCAGSSSNIESYNFVFWYQQLSGTPPKLLIYNVNTRPSGIPDHFSGSKSGNIASLTISGLLAEDEADYYCCSYTTSGT
Ailuropoda melanoleuca V168 iglv LNAT01000254.1 3431 SMASYVLTQPPSMSVNLGQTAKITCGGNSIGDKYSYWYQQKPGQAPVLIIYSDSNWPSGIPDRFSGSNSGNTATLTISGTRAEDEADYYCQTYDSSAD
Ailuropoda melanoleuca V169 iglv LNAT01000255.1 3491 SVASSGLTQPPSVSVALAQTATIICSGDVLGKRYAYWYQQKASQAPVLVINKNNERPSGISDRFSGSNSGNTATLTTSGARAEDEADYYCQSYDSSGN
Ailuropoda melanoleuca V170 iglv LNAT01000255.1 8245 SMASSGLTQSPSVSVSLGQTASITCSGEILSKAYTQWFQQKAGRAPVRVIYKDTEQPSGIPERFSGSSSGNTHTLTVSRARAKDEADYYCQAWDSNVK
Ailuropoda melanoleuca V171 iglv LNAT01000255.1 24221 SVASYALTQPPSVSVTLGQTTSITCGGDNIGSTYVSWHQQKPGQAPVTIIYTDSNRPSGIPDRFAGSNSGNTATLTISGVQAEDEADYYCLSNSGSTGT
Ailuropoda melanoleuca V173 iglv LNAT01000255.1 1171938 SQPGLAQPEALLVFPGQVAQLSCMLSPRHATVGEYGVSWYQQRAGSAPRYLLYYRSEDDCHRPPDIPERFSAATDAAHNACILTISPVQPEDDADYYCSVG
Ailuropoda melanoleuca V291 trav LNAT01000406.1 5481806 GPHAQVVQVNDSMYGFVGTDVVLHCSFANPLPGVKITQVTWQKATNGSKQNVAIYNPAMGVSVLAPYRERVEFLRPSFTDGTIRLSRLELDDEGVYICEF
Ailuropoda melanoleuca V336 trav LNAT01000451.1 6431 QTHGDSVTQTEGQVTLSEEASLTLNCTYSASGSLTLFWYVQYPGEGPQLLLKALRDKEKGISKGFEATYDKDSKSFHLEKGSVQASDSAVYYCALN
Ailuropoda melanoleuca V337 trav LNAT01000451.1 10766 VRGLDVEQSPSALSPQEGAGAALKCNFSSSVNSVQWFRQNLRGGGLTSLFFIASGMKQSGRLNCTVNMRERSSTLHIAASQLEDAASYLCAAE
Ailuropoda melanoleuca V338 trav LNAT01000451.1 16876 FSRGETVEQRPSTLSVQQGRSSVINCSYSDSASDYFPWYKQELGKGPRLLIYIRSTMTTKEDQRLTVSLNKTARHLSLHIADTQPEDSAVYFCAA
Ailuropoda melanoleuca V339 trav LNAT01000451.1 34529 VRGLEVEQSPSALSLQEGASTALKCNFSQAVDSVQWFRQNPGGSGLTRLVYVASGTKQSGRLNCTLNTRERSSTLHIVDSQLEDAASYLCATE
Ailuropoda melanoleuca V340 trav LNAT01000451.1 69720 LSNKQEVKQSPEAPNVRERDSVVVNCSYTDGALYSLQWFRQDPGQGLTFLLLIQSNQREQTSGRIKVSLHTLTRQSVLYIAASQPSDSATYLCAV
Ailuropoda melanoleuca V341 trav LNAT01000451.1 75460 LSNKQEVKQSPEAPNVRERDSVVVNCSYTDGALYSLQWFRQDPGQGLTFLLLIQSNQREQTSGRIKVSLHTLTRQSVLYIAASQPSDLATYLCAV
Ailuropoda melanoleuca V342 trav LNAT01000451.1 120521 VGSVLNVQQNPPWLRVQEGEDTNFTCRFPSTTFYSLHWYRWEPAKSPTFLFSVSLNGDEKKKGRVKTTLNTQEGYSSLYIKGSQPEDAATYLCAM
Ailuropoda melanoleuca V343 trav LNAT01000451.1 128711 INGQEIQQNPQFLLLQEGEDFTVYCNSSVTLNGLRWYRQRPGSGPVLLITLLKGGEEKQKRLTARFGEARKDSSLHVEASQIADAGTYFCTGAQCSQ
Ailuropoda melanoleuca V344 trav LNAT01000451.1 154668 VRAQMKVEQSPKVLTLQEGRNASMMCNCSSSMTGVQWFQQSPEGRLTSLSYIASGIQQKGRLIFTVYTKERNSHLYITDSQPGDPFTYFCAVE
Ailuropoda melanoleuca V345 trdv LNAT01000451.1 173157 SSTAEKVIQTQSEVTMQEGQAATIFCKYETSWSNYYTLYWYKQPPSGEMIFLIYQDESKPNAKQGRFSVNFRKTEKSISLTISPLQLTDSAVYFCALGSP
Ailuropoda melanoleuca V346 trav LNAT01000451.1 176326 IMSDAKTTQPNAMESTEEEPVHLPCNHSTISGNEYIYWYRQIPNQGPEYMIRGLKDNVTDGKATLIIAVARESSTLILPRVTLGDAGVYYCILRE
Ailuropoda melanoleuca V348 trav LNAT01000451.1 260399 VSGKMGVEHPPLYLSAQEGDSVTVNCSYSIGMTTLHWLQQNPGGGFVSLFILSLEMKTKGRVRATINTEELHRTLYITASQPRDSATYLCAV
Ailuropoda melanoleuca V349 trdv LNAT01000451.1 330704 SSDADKVRQSPSTVRGEEGQSVTMDCSFTLNYNYYVMNWYHQPPNGKMTQIISMFSDSSSQKQGRYALSFQKGSKYLKLTITGLQLSDTGVYFCAVGET
Ailuropoda melanoleuca V350 trav LNAT01000451.1 360475 GSCRTEIIQPSNLAAVIGADVTFQCEYSILDGNYDSVYWYLQRADQRLTCIHHTSQGTMESEHYQLSVNRELSSSTLTIKHVQPRDKATYYCAL
Ailuropoda melanoleuca V351 trdv LNAT01000451.1 367541 VSLGILLEPDTKTLTVLVGEPATLRCSVTGGDLKNYQVSWYKKTEDSSLILAYRPSNNTNEDSRSNFKGNTNASKSQLDIQRTTVEDAGTYYCACD
Ailuropoda melanoleuca V392 iglv LNAT01000535.1 19235 SWAQSTLTQPASVSGALGQTVTISCTGTSNDIGSYNHVSWHQQYPGMALKTLIYDVNTRPSGIPDRFSGSKSGNTASLTISGLQAEDEAEYYCA
Ailuropoda melanoleuca V393 iglv LNAT01000535.1 43226 SWAKSALTQPASVSGALGQTVTISCTGTSNDIGSYNAVSWHQQYPGMAPKTLIYRVNNRPSGIPDRFSGSKSGNTASLTISGLQAEDEAEYYCASYRSG
Ailuropoda melanoleuca V405 trav LNAT01001228.1 5603 VSSKQEVTQSPEALNVRERDSVVVNCSYTDGALYSLQWFRQDPGQGLTFLLLIQSNQREQTGGRIKVSLDTATRQSVLYIAASQPSDSATYLCAV
Ailuropoda melanoleuca V407 trav LNAT01001993.1 417 QTQGDSVTQTEGQLTLLEKDSLTINCTFSTTWSPTLFWYVQYPGEGLQLLLKAVKEKEKGINKGFEATYDKDSKSFHLEKGSVQASDSAVYYCAMS
Ailuropoda melanoleuca V408 iglv LNAT01002732.1 10022 SWAQSVLTQPTSVSGALGQKVTISCTGSSSNIGGGNYVSWHQQLPGTAPRMVIYGNNNRPSGIPDRFSGSKSHSSATLTITGLQAEDEAYYYCTSWDSSIN
Ailuropoda melanoleuca V409 iglv LNAT01002745.1 5610 SWAQSVLTQPLSVSAALGQKVTISCTGSSSNIGDNYVSWFQQLPGTAPRTVIYSSNNRTSGIPDRFSGSKSGSSSTLTITGLQAEDEVDYYCAAWDWSLN
Ailuropoda melanoleuca V410 trdv LNAT01004193.1 1866 SSMAEKVIQTRSAVTMQEGQAATIFCKYETSWSNYYTLYWYKQPPSGEMIFLIYQDENKPNAKQGRFSVNFQKTEKSISLTISPLQLTDLVVYFCALGS
Ailuropoda melanoleuca V411 trav LNAT01004193.1 5388 IMSDAKTTQPNAMESTEEKPVHLPCNHSTISGNEYIYWYQQIPSQGPEYMIHGLKDNVTDRKATLIVAVARESSTLILPRVTLGDAGVYYCILIE
Ailuropoda melanoleuca V412 iglv LNAT01005268.1 17659 SMASYVLTQPPSMSVNLGQTAKVTCGGNNIGDKYSYWYQQKPGQAPVLIIYEDNKRPSGIPDRFSGSNSGNTATLTISGAQAEDEADYYCQTYDSSAN
Ailuropoda melanoleuca V413 iglv LNAT01005268.1 40529 SMASYVLTQPPSMSVNLGQTAKITCGGNSIGRKYASWYQQKPGQAPVLIIYQNSKRPSGIPDRFSGSNSGNTATLTISGARAEDEADYYCQTYDSSAD
Ailuropoda melanoleuca V414 iglv LNAT01005268.1 44941 SVASSELTQPPFVSVTLGQTATITCSGEELEDFYVQWYQQKPGQAPVLVIYEDSDGPSGLLDRFSGSRSGNTATLTISGARAEDEADYYCQTYDSSAD
Ailuropoda melanoleuca V415 iglv LNAT01005442.1 4746 SWAQFGLTQPPSVSGSLGQKVTISCTGSSSNIGSNYVNWFQQLPGTAPRTVIYGNNNRPSGIPDRFSGSKSGNSGTLTITGLQAEDEADYYCASWDDNLS
Ailuropoda melanoleuca V417 iglv LNAT01006514.1 14649 SMASYVLTQPHSMSVNLGQTAKITCGGNSIGSKNAQWYQQKPGQAPVLIIYNDSNRPSGIPDRFSGSNSGNTATLTISGARAEDEADYYCQVWDSSTD
Ailuropoda melanoleuca V418 iglv LNAT01006747.1 2020 CADSSILRVWALGQTVTSSCTGSSSNIGSYALSWYQQLPGTPPKTVIYYDDSSPTGVPSRFSGSKSGSSGTLTISGLQAEDEADYYCSSWDDSLS
Ailuropoda melanoleuca V419 iglv LNAT01006776.1 18992 SWAQSVLTQPSSLSGTLGQKLIISCTGSSSNIGGGYYVSWHQQLPGIGHRTIIYDNSKQPLGIPDRFPGSKSGSSGTLTITGLQAEDEADYYCALLDSSLS
Ailuropoda melanoleuca V423 trdv LNAT01007468.1 211 SSMAEKVIQTRSAVTMQEGQAATIFCKYETSWSNYYTLYWYKQPPSGEMIFLIYQDENKPNAKQGRFSVNFQKTEKSISLTISPLQLTDSAVYFCALGS
Ailuropoda melanoleuca V426 ighv LNAT01008037.1 7093 VQCEVQLVESAGDLVKPGGSLRLSCAASGFTFSSYAMSWFRQAPGKGLQWVAYISYNGGSTYYTDSVKGRFTISRDNGKNTLYLQMNSLRVDDTAVYYCAG
Ailuropoda melanoleuca V427 iglv LNAT01010440.1 1236 SWAQSGLTQPPSMTGSLGQRVTISCTGSSSNIGGNYVSWHQQLPGTAPRTVIYGNNNRPSGIPDRFSGSQSGSSATLTITGLQAEDEADYYCASWDDNLS
Ailuropoda melanoleuca V428 iglv LNAT01011322.1 2948 SWAQAVLTQPPSVSGSLGQRVTISCTGSGFSIGIVAVSWYQQLPGKSPKLLIYGNDKRPSGVPDRFSGSKSGNSGSLTITGLQAEDEADYYCQSVDFSQG
Ailuropoda melanoleuca V429 iglv LNAT01011322.1 11116 SWAQAVLTQPPSVSGSLGQRVTISCTGSGFSIGIVAVSWYQQLPGKSPKLLIYGNDKRPSGVPDRFSGSKSGNSGSLTITGLQAEDEADYYCQSVDVSQG
Ailuropoda melanoleuca V430 igkv LNAT01011349.1 4457 SSGEVVMTQTPVSLPVTLGEPASISCKASQSLLHSNGNNYLHWYLQKPGQAPQLLIYIASNRFTGVPDRFSGSGSGTDFTLKISRVEAEDVGVYYCQQT
Ailuropoda melanoleuca V433 trav LNAT01013537.1 48941 QTHGDSVTQTEGQVTLSEEASLTMNCTYSTTGYPTLFWYVQYPGEGPQLLLKASRDMEKGINKGFEATYDKDSKSFHLEKGSLQASDSAVYYCVLS
Ailuropoda melanoleuca V434 trav LNAT01013537.1 55806 VSGKNQVEQNPPYLIVLEGVNCTVQCNYTVNPFSNLRWYKQSTGRGPASLAVMTYGDSKKSDGRYTETLDATTKHSSLHITAVQLSDSAVYICVVS
Ailuropoda melanoleuca V435 trav LNAT01013537.1 64146 MKSQQKGMEQSLGSLRVLQGATASLNCNYSDSASQYFVWYRQYSGKGPELLVYLYSKGDKKEGRFSAQVDAAKQNVFLLISDSQSRDSATYLCAV
Ailuropoda melanoleuca V436 trav LNAT01013537.1 93685 SGMTQKVTQAQPAVSTLENEAATLDCVYEVSGSSYYLFWYKQPPSGEMIFLIRQDSYSEQNATEGRYSLNFQKSDRSISLTITALQPADSAVYFCALR
Ailuropoda melanoleuca V437 iglv LNAT01013856.1 5738 SWAQSGLTQIPSVTGSLGQRVTISCTGSSSNIGGNFVSWFQQLPGTAPRAVIYSSNYRPSEIPDRFSGSKSGSSATLTITGLQAEDEVDYYCTSWDDNLS
Ailuropoda melanoleuca V438 iglv LNAT01014319.1 583 SWAQSTLTQPASVSGALGQTVTISCTGTSNDIGSYNRVSWHQQYPGMAPKTLIYDVNTRPSGIPVRFSGSKSGNTASLTISGLQAEDEAEYYCASYRSG
Ailuropoda melanoleuca V439 ighv LNAT01014408.1 3131 VQCEVQLVESGGDLVKPGGSLRLSCAASGFTFSSYSMSWVRQAPGKGLQWVASIYTDGSSTYYADSVKGRFTISRDNGKNTLYLQMNSLRADDTAVYYCAS
Ailuropoda melanoleuca V441 iglv LNAT01015497.1 733 SMAAYVVTQPPLVSVTPGQTASITCGGDNIASRYVSWHQQKPGQTPVTIINGNNNQPSGIPEQFSGSKSGNMATLTISGVQAKDEADYYCLPYQGGS
Ailuropoda melanoleuca V442 trav LNAT01015535.1 505 FSQGEMVEQRPSTLSVRQGRSSVINCSYSDSASVYFPWYKQELGKGPQLLIDIRSTTATKEDQRLTVSLSRTARHLSLHIADTQPEDSAVYFCAA
Ailuropoda melanoleuca V443 trav LNAT01015535.1 2637 QTQGDSVTQSEGQLTLLEKESLTINCTFSTTWSPTLFWYVQHPGEGLQLLLKAMKEKEKGINKGFEATYDKDSKSFHLEKGSVQASDSAVYYCAMS
Ailuropoda melanoleuca V449 trav LNAT01032439.1 90 VSGKTGVEHRPPYLTVQEGDSVTVNCSYSKGMTTLHWLQQNPGGGIVSLFILSLEMKTKGRVRATINTEELHSTLYITASQPRDSATYLCAV
Ailuropoda melanoleuca V451 igkv LNAT01043419.1 78 ARGDIQMTQSPSSLSASVGDRVTITCRASQNIRYHLNWYQHKPGKAPNLLIYTASSLQSGVPSRFSGSGSGTDFTLTISSLRPEDFATYYCQESYAT
Ailuropoda melanoleuca V456 igkv LNAT01056907.1 1597 SSGEIEMTQTPLSLPITPGEPASVSCKASQSLLHSNGNTYLNWYLQKPGLAPKRLIYMLPNRASGVPDRFSGSGSGKDFTLKISRVEADDAGVYYCQQTLQNR
Ailuropoda melanoleuca V457 trbv LNAT01057147.1 4106 SMDAGITQTPKNGIIKTGKSILLECSQTKGHDYMHWYRQDPGLGLQLIYYSYVNDINEGEVSHGYKASREDLSKFSLSLGSAIPNQTALYFCAISD
Ailuropoda melanoleuca V509 trav LNAT01000082.1 352668 GSCRTEIIQPSDLAAVIGADVTFQCEYSILDGNYDPVYWYLQRADRRLTYIHHTSQGTMESEHYQLSVNRELSSSTLTIKHVQPRDKPTYYCAL
Ailuropoda melanoleuca V517 trbv LNAT01000094.1 2957904 GTMDTGVTQIPKHLVTGMGRNVTLKCKQHLGHNAMYWYKQSAQNAPKLMFAYNYQVLAENKTDSSRFSLWRPDNSQLDLHMGGVQREDSAMYLCASSK
Ailuropoda melanoleuca V518 trbv LNAT01000094.1 2934981 HAGAGVTQFPRHRVTRKGKNVTLSCDPISGHVGLYWYQQTVGQGPEFLVYFQNRDPLDKSGMTNNRFSAERDEGTRSTLQIQRAEQGDSAVYLCASSL
Ailuropoda melanoleuca V519 trbv LNAT01000094.1 2931751 GPMDAVITQTPRYQIIQIGTKMTLECSQDMNHFAMFWYRQDPGQGLRLIHYSSGVTGTAKENVAEGYSVSRNKQEHFSLTLESAGTNQTSVYLCASSE
Ailuropoda melanoleuca V520 trbv LNAT01000094.1 2919343 HAGAGVTQFPRHRVTRKGQNVTLSCDPISGHVGLYWYRQTVGQGPEFLVYFQNRDPLDKSGMTNNRFSAERQEGTRSTLQIQHAEQGDSAVYLCASSL
Ailuropoda melanoleuca V521 trbv LNAT01000094.1 2913567 PVGAEVIQTPRHLIQGRGGKAVLKCHPIPGHLSVSWYQQAPGQGLRFLIEYYNQGQRDKGDIPGRFSAQQFGNYSSQLDLSSLELGDSALYLCASS
Ailuropoda melanoleuca V522 trbv LNAT01000094.1 2907689 CMDAGVTQGPRYEIARTGKKVTLRCHQTENYDYMYWYRQDLGHGLRLLYYSINIGSTEKGEVSDGYTVFRSNMEDFHLILLSVTSSQTSVYFCA
Ailuropoda melanoleuca V523 trbv LNAT01000094.1 2893717 FTVGGVIQTPGHKVPKMGQEVTLRCEPISGHTALDWYRQTSGQGPGLLIYFNDRAPVDDSGMPKERFSAEMTEKTLSTLKIEPTEPKDSATYLCASSV
Ailuropoda melanoleuca V524 trbv LNAT01000094.1 2877301 TLNAEVTQTPGHLVTGKGQKAEMHCVPIKGHSYVFWYQQIPAKELKFLISFQDGVILDKTGMPEKRFSAVCPQNSPCSLEIKPTEMQDLAVYFCASSE
Ailuropoda melanoleuca V525 trbv LNAT01000094.1 2866476 PVNAGVTQNPRHLVRRTGQEATLTCRPEKGHGYFYWYQQPLGEGLKFMVYLQKENIIDDSGMPKNRFSTEFSKDGLSVLKIQPVELGDSAGYFCASSY
Ailuropoda melanoleuca V526 trbv LNAT01000094.1 2862679 TADGGITQTPKYLFREEGQEATLECEQDFNHDYMYWYRQDPGQGLGLIYYSLVENEIQKGDIPDGYSASWKKTTFSLTVTRIRKNQTALYLCASSR
Ailuropoda melanoleuca V528 trbv LNAT01000094.1 2833536 SMDAGITQTPKNGIIKTGKSILLECSQTKGHDYMHWYRQDPGLGLQLIYYSYVNDINEGEVSHGYKASREDLSKFSLSLGSAIPNQTALYFCAISD
Ailuropoda melanoleuca V529 trbv LNAT01000094.1 2827596 LVDAGVSQMPRHCVSGTGKKIVLECSQTLGHDNMYWYRQDPGKALQLIHYSYGVNTTEETELSSGSTVSRIKKEHFPLTLESASPSQTSLYLCASSE
Ailuropoda melanoleuca V530 trbv LNAT01000094.1 2822460 LKDAVVAQFPRHRVLGTGKELTLQCSQDMSYVSMYWYRQDPGFGLRLICYSTGIHTFEKGDVPQGYRVSRNELQSFPLTLESASANQTSVYLCASSE
Ailuropoda melanoleuca V531 trbv LNAT01000094.1 2804314 LAAARVTQTPRHLIKRVGAKVLMECSQNMDHENMFWYRQDPGLGLQLLYWSYGIDGIEQGDLPFGYNVSRKKKEAFPLILESASTNQTSVYLCASS
Ailuropoda melanoleuca V532 trbv LNAT01000094.1 2798617 SVFGALLSQKPRRDICQRGTSTTIQCEVDSQLALMFWYRQLAGQGLILIATANQGTKATYESGFTEEKFPISRPTSTFSTLTVNNVSLPDSSFYFCSAG
Ailuropoda melanoleuca V548 igkv LNAT01000116.1 4841725 VSGDIVMSQSPGPLTESAGEHVAINCKSGQSLLSSYNQKSYLAWCRQKPGQAPKLLIYRASTRASGVPDRFSGSGSGTHLTLTSGSLQAEDVGVYYCPQSYNTP
Ailuropoda melanoleuca V815 trdv LNAT01000451.1 438622 KGVLCDEVTQSSPDQTVASGSKVTLLCTYYTTQSNPDLYWYRIRPDHAFQFILYRDNTRSKNADFTGHRFSVLHDQSRRTFHLVISPVEPEDSATYYCAMN
Ailuropoda melanoleuca V855 trav LNAT01000556.1 51018 VRGLEVEQSPSALSLQEGAGAALKCNFSQAVNSVQWFRQNPGGGSLTRLISVASGIKQSGRLNCTLNTRERSSTLHITASQLEDAASYLCAVE
Ailuropoda melanoleuca V856 trav LNAT01000556.1 38391 QTHGESVTQTEGEVTLSEKASLTMNCTYSASGYPALFWYVQYPGEGPQLLLKASRDKEKGIDKGFEATYNRDSKSFHLEKGSVQASDSAVYYCAMS
Ailuropoda melanoleuca V857 trav LNAT01000556.1 34026 STIAQKVTQAQPAMLVQEKGAVTLECTDSTVDPSYSLLWYKQPSSGAMIFLICQDSYSQQNATDGHYSLNFQKTRKSIQLVMSASELEDSAVYFCALRE
Ailuropoda melanoleuca V858 trav LNAT01000556.1 28374 QTQGNSVTQTEGQVTLSEKASLTINCTYSTTGSPTLFWYVQYPGEGLQLLLRAFSDKKESNKGFEATLDSKSKSFHLEKGSVQASDSAVYYCAMN
Ailuropoda melanoleuca V859 trav LNAT01000556.1 20392 VRGLEVEQSPSTLSPREGAGAALKCNFSQTVRSVQWFRQNPGGGGLTRLISVASGTKQSGRLNCTLNTRERSSTLHIADSQLEDAASYLCAAE
Ailuropoda melanoleuca V860 trav LNAT01000556.1 8695 QTHGDSVTQTEGQVTLLEEASLTMNCTYSTIGSPTLFWYVQYPGEGLKLLLKSSRDQEKKSNNGFEATLDSKSKSFHLEKGSVQGSDAAMYYCAMS
Ailuropoda melanoleuca V861 ighv LNAT01000561.1 71391 VLCEVQLVESGGKLVKPGGSLRLSCASSGFTLSSYWMSWVRQALGKRPQWVTYVSHGGSTYYADSVKGRFTISRDNGKNTLYLQMNSLRTEDTALYYCVK
Ailuropoda melanoleuca V862 ighv LNAT01000561.1 36399 VQCEVKLVESGGDLVQPGGSLRLSCAASGFTFSSYDMSWVRQAPGKGLQWVADISSSGSTYYADSMKGRFTISREDAKNMLYLQMNSLGAEDTAIYFCVS
Ailuropoda melanoleuca V873 iglv LNAT01001063.1 4315 SWAQSTLTQPASVSGALGQTVTISCTGTSNDIGSYNHVSWHQQYPGMALKTLIYDVNTRPSGIPDRFSGSKSGNTASFTISGLQAEDEAEYYCA
Ailuropoda melanoleuca V875 iglv LNAT01001563.1 2100 SWAQSTLTQPASVSGALGQTITISCTGTSNDIGRYNAVSWHQQYPGKAPKALIYGVNTRPSGIPDRFSGSKSGNTASLTISGLQAEDEAEYYCASARSG
Ailuropoda melanoleuca V877 iglv LNAT01001748.1 30205 SWAQSVLTQPPSLSGALGQKVTISCTGSSTNIGGYYVSWHQQLPGTAPRTIIDSSNNRPSGIPDRFSGSTSGSSATLTITGLQAEDEADYYCASWDSSLK
Ailuropoda melanoleuca V879 trav LNAT01002232.1 55143 VRGLEVEQSPSALSPQEGAGAALKCNFSQTVRSVQWFRQNPGGGGLTSLFFMASGLKQSGRLNCTLNTRERSSTLHIAASQLEDAASYLCATE
Ailuropoda melanoleuca V880 trav LNAT01002232.1 21843 VRGLDVEQSPSALSLQEGAGAALKCNFSQAVNSVQWFRQNPGGGGLTRLISVASGLKQSGRLNCTLNTRERSSTLHIADSQLEDAASYLCAAE
Ailuropoda melanoleuca V881 trav LNAT01002232.1 1733 QIHGDSVTQMEGLVTLSEKASLTINCTYITTSYPTLFWYIQCLGEGLKLLLKASRDQKGSNKGFVAMYNRDSKSFHLEKGSVQASDSAVYYCAMN
Ailuropoda melanoleuca V882 ighv LNAT01002862.1 16307 VHCEVQLVESGGDLVKPGGSLRLSCAASGFTFSDYAMSWVRQAPGKGLQWVAGIDDDGSSTYYADSVKGRFTISRDNGKNTLYLQMKSLRADDTAVYYCAK
Ailuropoda melanoleuca V884 iglv LNAT01003288.1 8892 SWSQSLLSQPSSMSGALGQKVTVSCTGSSSNIGGGWNVNWIQQLPGKVPRTVIYSNNNRPSGIPDRFSGSRSGSSGTLTITGLQAEGEADYYCTSWDSSLS
Ailuropoda melanoleuca V888 iglv LNAT01005001.1 4381 SWAQSVLTQPSSVSGALGQTVTISCTGSSSNIGSYALSWYQQLPGTAPKTVIYYDDSSPTGVPSRLSGSKSGSSGTLTISGLQAEDEADYYCSSWDDSLS
Ailuropoda melanoleuca V889 ighv LNAT01005628.1 933 VQCEVQLVESGGDLVKPGGSLRLSCAASGFTFSSYAMSWVRQAPGKGLQWVAGISSGGSTYYADSVKGRFTISRDNGKNTLHLQMNSLRADDTAMYYCAK
Ailuropoda melanoleuca V890 iglv LNAT01005889.1 7122 SWAQAVLTQPPSVSGALGQTVTISCTGSSSNIGGGYYVSWHQQLPGTAPRTVIYSNNNRPSGIPDRFSGSKSGSSATLTITGLQAEDEVDYYCQSYDSSPS
Ailuropoda melanoleuca V891 ighv LNAT01005918.1 1018 VQCEVQLVESGGDLVKPGGSLRLSCAASGFTFSSYAMSWVRQAPGKGLQWVAYISSSGSSTYYADSVKGRFTISRDNGKNTLYLQMNSLRADDTAVYYCA
Ailuropoda melanoleuca V892 ighv LNAT01005934.1 2050 VQCEVQLVETGGDLVKPGGSLRLSCAASGFTFSSYSMSWVRQAPGKGLQWVAYISYGGGSTYYTDSVKGRFTISRDNGKNTLYLQMNSLRADDTAVYYCAK
Ailuropoda melanoleuca V893 iglv LNAT01006676.1 3320 SWAQSVLTQPPSVSGALGQSVTISCTGIPTNTDYDGEEYQSYVNWYQQFPGKRPILLIYGDENRNTGVSDRFSGSKTESSASLTITSLQAEDEADYYCQ
Ailuropoda melanoleuca V894 ighv LNAT01006898.1 1270 VQCEVQLVESGGDLVKPGGSLRLSCAASGFTFSSYGMSWVRQAPGKGLQCVAYISSSGGSTYYADSVKGRFTISRDNGKNTLYLQMNSLRVDDTAVYYCAS
Ailuropoda melanoleuca V895 igkv LNAT01007287.1 5808 STGDVVMTQTPVSLPVTPGEPASISCKASQSLLHSNGYNYLYWFRQKPGHSPQPLIYAASNRFTGVPDRFSGSGSGTDFTLKISRVEADDVGVYYCGQNFLAP
Ailuropoda melanoleuca V896 iglv LNAT01007474.1 5471 CADSAALPVWALGQMVTIFCTGSSSNIGYGCYAHWYQQLPGSAPRTIIYDNNNRPSGIPDRFSGSKSGSSATLTITGLQAEDEVDYYCSLWDDRLR
Ailuropoda melanoleuca V897 ighv LNAT01007478.1 14170 VQCEVQLVESAGDLVKPGGSQRLSCEASGFSFSSYGMAWVRQAPGKGLQGVASISTRGGSTSYADSVKGQFTISRDNGKNTLYLQMNSLRADDTAVYYCAK
Ailuropoda melanoleuca V898 trav LNAT01007992.1 7520 VRAQMKVEQSPKVLTLQEGRNASMMCNCSSSMTGVQWFQQNPEGRLTSLSYIASGTQQKGRLIFTVYTKERNSHLYITDSQPGDSFTYFCAAE
Ailuropoda melanoleuca V900 trav LNAT01010300.1 51244 FSQGETVEQRPSTLSVRQGRSSVINCSYSDSASVYFPWYKQELGKGPQLLIDIRSTTATKEDQRLTVSLSRTARHLSLHIADTQPEDSAVYFCAA
Ailuropoda melanoleuca V901 trav LNAT01010300.1 44656 QTHGDSVTQTEGQVSLSEEASLTINCTYTTTLYPTLLWYVQYPGEGPQLLLSVSWGQEKGSNKGFEATLDSNSKSFHLEKGSVQASDSAVYYCAMS
Ailuropoda melanoleuca V902 trav LNAT01010300.1 34783 VSGKNQVEQNPPYLMVLEGANCTMQCNYTVNPFSNLRWYKQSTGRGPASLTVMTYGDSKKSDGRYTVTLDATTKHSSLHITAAQLSDSAIYICVVS
Ailuropoda melanoleuca V903 trav LNAT01010300.1 20679 MKSQQKGVEQSLGSLSVLEGATASLNCNYSDSASQYFMWYRQYSGKGPELLVYLYSKGDKKEGRFLAQVDTAKQYVSLLISDSQASDSATYFCAV
Ailuropoda melanoleuca V904 trav LNAT01010300.1 17021 GTGAQSVTQPDAHVTVSEGSPLELRCNYSYSGTPYLYWYVQYPSQGLQLLLRYFSGDTLVKGIRGFEAEFRKAETSFHLRKPSAHGSNTAKYFCAAS
Ailuropoda melanoleuca V905 igkv LNAT01010936.1 6953 STGDIVMTQTPVSLPVTLGEPASISCKASQSLLHSNGYNYLYWFRQKPGHSPQPLIYAASNRFTGVPDRFSGSGSGTDFTLKISRVEADDVGVYYCEQAIQYP
Ailuropoda melanoleuca V906 trav LNAT01014224.1 575 GTRGDTVTQTEGPVTLLEGTLLTLNCTYESSYSVSVFWYVQHQNKEPELLLKSSSENQRAERHGFQAHRKSDKSFPLEKRGAQTSDSAVYYCALG
Ailuropoda melanoleuca V907 trav LNAT01015968.1 1535 FSRGETVEQRPSTLSVRQGRSSVINCSYSDSASVYFPWYKQELGKGPRLLIDIRSNMATKEDQRLTVSLNKTARQLSLHIADSQPEDSAVYFCAA
Ailuropoda melanoleuca V909 trav LNAT01019352.1 1167 VRAQMKVEQSPKVLTLQEGRNASMMCNCSSSMTSVQWFQQSREGRLTSLAYIASGTQQKGRLIFTVNTKERNSHLYITDSQPGDSFTYFCAVE
Ailuropoda melanoleuca V911 ighv LNAT01024644.1 912 VQCEVQLVESGGDLVKPGGSLRLSCAASGFTFSSYGMSWVRQAPGKGLQWVAVISNSGGSTYYADSVKGRFTISSDNSKNTLYLQMNSLRADDTAVYYCAS
Ailuropoda melanoleuca V912 ighv LNAT01025009.1 658 VQCEVQLVESGGDLVKPGGSLRLSCAASGFTFSSYWMYWVPQAPGKGLQGVAGIYDDGSSTSYADSVKSRFTISRDNGKNTLYLQMNSLRADDTAVYYCEP
Ailuropoda melanoleuca V913 ighv LNAT01026223.1 1037 VQCEVQLVESGGDLVKPGGSLRLSCAASGFTFSDYAMSWVRQAPGKGLQWVAYISYNAGSTYYAGSMKGRFTISRDNGKNMLYLQMNSLRADDTAVYYCAK
Ailuropoda melanoleuca V915 ighv LNAT01028689.1 698 VQCEVQLVESGGDLVKPGGSLRLSCAASGFTFSSYSMSWVRQAPGKGMQWVIYISYSGGSTYYPDSMKGRFTISRDNGKNTLYLQMNSLRAHDTAVYYCAK
Ailuropoda melanoleuca V916 trav LNAT01044821.1 957 LHGEDSVEQSPQTLRLQEGDSVSLNCTYTVSSFNGLQWYRQASGQGPEFLFLLYSVGAEKQKERLTATLLNKESSLHIEASKPEDSATYFCAVE
Ailuropoda melanoleuca V11 trdv ACTA01003783.1 6670 VSLGILLEPDTKTLTVLVGEPATLRCSVTGGDLKNYQVSWYKKTEDSSLILAYRPSNNTNEDSRSNFKGNTNASKSQLDIQRTTVEDAGTYYCACD
Ailuropoda melanoleuca V14 iglv ACTA01004645.1 5045 SWAQSTLTQPASVSGALGQRVTISCTGTSNDIGKYNYVSWYQQYPGMAPKTLIYYANTRPSGIPDRFSGSKSGNTASLTISGLQAEDEAEYYCASYRSG
Ailuropoda melanoleuca V49 trbv ACTA01023577.1 184 HAGAGVTQFPRHRVTRKGKNVTLSCDPISGHVGLYWYRQTVGQGPEFLVYFQNRDPLDKSGMTNNRFSAERDEGTRSTLQIQHAEQGDSAVYLCASSL
Ailuropoda melanoleuca V68 trav ACTA01027983.1 9967 SSTAQKVTQTQPDMSVWETETVTLHCMYDTSDSNYYLFWYKQPPSGELILIHQEGFKQENARKDCFSVDFQKAKKPFSLRISESWLEDASMYFCALIE
Ailuropoda melanoleuca V73 iglv ACTA01029047.1 6270 SWAQAVLTQPPSESGSLGQRVTISCTGSGFSIGIVAVSWYQQLPGKSPKLLIYGNDKRPSGVPDRFSGSKSGNSGSLTITGLQAEDEADYYCQSVDVSQG
Ailuropoda melanoleuca V96 iglv ACTA01044288.1 9262 CPDSASFSVRGLGQTVTISCTGTSNDIGSYNAVSWHQQYPGMAPKTLIYRVNNRPSGIPDRFSGSKSGNTASLTISGLQAEDEAEYYCASYRSG
Ailuropoda melanoleuca V114 iglv ACTA01052644.1 1904 SWAQSTLTQPPSLSGALGSTVTISCAGSSSNIGGNNYISWYQQPPGTSPKLLIYRVSSRPSGIPNRFSGLKTGNTAILIISGLQVEDEGDYYCTSVTLSDN
Ailuropoda melanoleuca V115 iglv ACTA01052644.1 12492 SWAQSALTQPPSVAGTLGNTITISCAGSSSNIESYNFVFWYQQLSGTPPKLLIYNVNTRPSGIPDHFSGSKSGNIASLTISGLLAEDEADYYCCSYTTSGT
Ailuropoda melanoleuca V132 trav ACTA01060380.1 100 QTQGDSVTQSEGQLTLLEKESLTINCTFSTTWSPTLFWYVQYPGEGLQLLLKAVKEKEKGINKGFEATYDKDSKSFHLEKGSVQASDSAVYYCAMS
Ailuropoda melanoleuca V164 iglv ACTA01076712.1 286 SMASYVLTQPPSMSVNLGQTAKITCGGNSIGDKYSYWYQQKPGQAPVLIIYSDSNWPSGIPDRFSGSNSGNTATLTISGTRAEDEADYYCQTYDSSAD
Ailuropoda melanoleuca V185 igkv ACTA01090802.1 17212 SAGDIVLTQSPASLTMSPGQRATISCKASEKVSGIWGITNYITWYQQKSGQSPKILIYKATSRESGVPARFSGGGSGTDFTLTIDPVEAGDAASYYCQQGQKEP
Ailuropoda melanoleuca V202 igkv ACTA01098802.1 24254 VSGDIVMSQSPGPLTESAGEHVAINCKSGQSLLSSYNQKSYLAWCRQKPGQAPKLLIYRASTRASGVPDRFSGSGSGTHLTLTSGSLQAEDVGAYYCPQSYNTP
Ailuropoda melanoleuca V206 trbv ACTA01099569.1 40480 GTMDTGVTQIPKHLVTGMGRNVTLKCKQHLGHNAMYWYKQSAQNAPKLMFAYNYQVLAENKTDSSRFSLWRPDNSQLDLHMGGVQREDSAMYLCASSK
Ailuropoda melanoleuca V207 trbv ACTA01099569.1 63355 HAGAGVTQFPRHRVTRKGKNVTLSCDPISGHVGLYWYQQTVGQGPEFLVYFQNRDPLDKSGMTNNRFSAERDEGTRSTLQIQHAEQGDSAVYLCASSL
Ailuropoda melanoleuca V208 trbv ACTA01099569.1 66585 GPMDAVITQTPRYQIIQIGTKMTLECSQDMNHFAMFWYRQDPGQGLRLIHYSSGVTGTAKENVAEGYSVSRNKQEHFSLTLESAGTNQTSVYLCASSE
Ailuropoda melanoleuca V218 iglv ACTA01106760.1 7753 CADSAALPVWALGQMVTIFCTGSSSNIGYGCYAHWYQQLPGTVPRTIIYDDNNRPSGIPDRFSGSKSGSSATLTITGLQAEDEADYYCQSYDSS
Ailuropoda melanoleuca V222 trbv ACTA01107569.1 11987 HAGAGVTQFPRHRVTRKGQNVTLSCDPISGHVGLYWYRQTVGQGPEFLVYFQNRDPLDKSGMTNNRFSAERQEGTRSTLQIQHAEQGDSAVYLCASSL
Ailuropoda melanoleuca V223 trbv ACTA01107569.1 17763 PVGAEVIQTPRHLIQGRGGKAVLKCHPIPGHLSVSWYQQAPGQGLRFLIEYYNQGQRDKGDIPGRFSAQQFGNYSSQLDLSSLELGDSALYLCASS
Ailuropoda melanoleuca V224 trbv ACTA01107569.1 23619 CMDAGVTQGPRYEIARTGKKVTLRCHQTENYDYMYWYRQDLGHGLRLLYYSINIGSTEKGEVSDGYTVFRSNMEDFHLILLSVTSSQTSVYFCA
Ailuropoda melanoleuca V245 trbv ACTA01115569.1 5099 FTVGGVIQTPGHKVPKMGQEVTLRCEPISGHTALDWYRQTSGQGPGLLIYFNDRAPVDDSGMPKERFSAEMTEKTLSTLKIEPTEPKDSATYLCASSV
Ailuropoda melanoleuca V246 trbv ACTA01115569.1 12968 FTDAGVIQTPRNKVTKMGQEVTLRCEPISGHTALDWYRQTSGQGPGLLIYFNDRAPVDDSGMPKERFSAEMTEKTLSTLKIEPTEPKDSATYLCASSV
Ailuropoda melanoleuca V247 trbv ACTA01115569.1 21508 TLNAEVTQTPGHLVTGKGQKAEMHCVPIKGHSYVFWYQQIPAKELKFLISFQDGVILDKTGMPEKRFSAVCPQNSPCSLEIKPTEMQDLAVYFCASSE
Ailuropoda melanoleuca V248 trbv ACTA01115569.1 32545 PVNAGVTQNPRHLVRRTGQEATLTCRPEKGHGYFYWYQQPLGEGLKFMVYLQKENIIDDSGMPKNRFSTEFSKDGLSVLKIQPVELGDSAGYFCASSY
Ailuropoda melanoleuca V249 trbv ACTA01115569.1 36180 TADGGITQTPKYLFREEGQEATLECEQDFNHDYMYWYRQDPGQGLGLIYYSLVENEIQKGDIPDGYSASWKKTTFSLTVTRIRKNQTALYLCASSR
Ailuropoda melanoleuca V255 iglv ACTA01116843.1 2281 SWAQSVLTQPLSVSAALGQKVTISCTGSSSNIGDNYVSWFQQLPGTAPRTVIYSSNNRTSGIPDRFSGSKSGSSSTLTITGLQAEDEVDYYCAAWDWSLN
Ailuropoda melanoleuca V277 trav ACTA01128927.1 45212 GPHAQVVQVNDSMYGFVGTDVVLHCSFANPLPGVKITQVTWQKATNGSKQNVAIYNPAMGVSVLAPYRERVEFLRPSFTDGTIRLSRLELDDEGVYICEF
Ailuropoda melanoleuca V279 trav ACTA01129052.1 30767 TSDEDFQVIQPESSVSVRAGEILTLGCNVSARSPAGPVLWFRENGQERQLIYNFSGSQFPRVTQVENSEFNQTDYSIRISDVSPKDVGTYYCVKLTI
Ailuropoda melanoleuca V287 trdv ACTA01132547.1 2052 SSDADKVRQSPSTVRGEEGQSVTMDCSFTLNYNYYVMNWYHQPPNGKMTQIISMFSDSSSQKQGRYALSFQKGSKYLKLTITGLQLSDTGVYFCAVGET
Ailuropoda melanoleuca V304 trbv ACTA01139569.1 4569 SMDAGITQTPKNGIIKTGKSILLECSQTKGHDYMHWYRQDPGLGLQLIYYSYVNDINEGEVSHGYKASREDLSKFSLSLGSAIPNQTALYFCAISD
Ailuropoda melanoleuca V305 trbv ACTA01139569.1 10505 LVDAGVSQMPRHCVSGTGKKIVLECSQTLGHDNMYWYRQDPGKALQLIHYSYGVNTTEETELSSGSTVSRIKKEHFPLTLESASPSQTSLYLCASSE
Ailuropoda melanoleuca V306 trbv ACTA01139569.1 15641 LKDAVVAQFPRHRVLGTGKELTLQCSQDMSYVSMYWYRQDPGFGLRLICYSTGIHTFEKGDVPQGYRVSRNELQSFPLTLESASANQTSVYLCASSE
Ailuropoda melanoleuca V307 trbv ACTA01139569.1 33582 LAAARVTQTPRHLIKRVGAKVLMECSQNMDHENMFWYRQDPGLGLQLLYWSYGIDGIEQGDLPFGYNVSRKKKEAFPLILESASTNQTSVYLCASS
Ailuropoda melanoleuca V308 trbv ACTA01139569.1 39279 SVFGALLSQKPRRDICQRGTSTTIQCEVDSQLALMFWYRQLAGQGLILIATANQGTKATYESGFTEEKFPISRPTSTFSTLTVNNVSLPDSSFYFCSAG
Ailuropoda melanoleuca V310 ighv ACTA01140568.1 3644 VQCEVQLVESGGDLVKPGGSLRLSCAASGFTFSDYAMSWVRQAPGKGLQWVAGIDDDGSSTYYADSVKGRFTISRDNGKNTLYLQMKSLRADDTAVYYCAK
Ailuropoda melanoleuca V336 iglv ACTA01156642.1 9356 SMAAYVVTQPPLVSVTPGQTASITCGGDNIASRYVSWHQQKPGQTPVTIINGNNNQPSGIPEQFSGSKSGNMATLTISGVQAKDEADYYCLPYQGGS
Ailuropoda melanoleuca V337 ighv ACTA01156859.1 39 VQCEVQLVESAGDLVKPGGSRRLSCEASGFSFSSYGMAWVHQAPGKGLQWVASISSHGGSTSYADSVKGQFTISRDNGNYTLYLQINSLRADDTAAYYCAK
Ailuropoda melanoleuca V345 trav ACTA01165035.1 699 SSTAQKVTQTQPDTSVLETEAVTLHCTYDTSDSNYYLFWYKQPPSGELILIHQEGFKQENATKDRFSVDFQKAKKSFSLRISESRLEDAAMYFCALVE
Ailuropoda melanoleuca V388 iglv ACTA01188529.1 5132 SVASSELTQPPFVSVTLGQTATITCSGEELEDFYVQWYQQKPGQAPVLVIYEDSDGPSGLLDRFSGSRSGNTANLTISGAQAEDEADYYCQTYDSSAD
Ailuropoda melanoleuca V389 iglv ACTA01188734.1 781 SWSQSLLSQPSSMSGALGQKVTVSCTGSSSNIGGGWNVNWIQQLPGKVPRTVIYSNNNRPSGIPDRFSGSRSGSSGTLTITGLQAEGEADYYCTSWDSSLS
Ailuropoda melanoleuca V406 iglv ACTA01196276.1 6681 SWAQSTLTQPASVSGALGQTVTISCTGTSNDIGSYNHVSWHQQYPGMALKTLIYDVNTRPSGIPDRFSGSKSGNTASLTISGLQAEDEAEYYCA
Ailuropoda melanoleuca V407 iglv ACTA01196710.1 973 CSFPGSWAQSALTQHPSVSGALGWKITISCAGSSSNIRSGNYVSWFQQLPGTPPKLLIYDISSWPSGIPGHFSGSKLTSLTISGLQAEDEADYHCCSYRTS
Ailuropoda melanoleuca V420 trav ACTA01004186.1 7400 VGTVLNVQQNPPWLRVQEGEDTNFTCRFPSTTFYSLHWYRWEPAKSPTFLFSVSLNGDEKKKGRVKTTLNTQEDYSSLYIKGSQPEDAATYLCAM
Ailuropoda melanoleuca V421 trav ACTA01004563.1 916 VRGLEVEQSPSALSLQEGAGAALKCNFSSSVNSVQWFRQNPGGSGLTRLVYVASGTKQSGRLNCTVNMRERSSTLHIAASQLEDAASYLCATE
Ailuropoda melanoleuca V422 igkv ACTA01004605.1 7789 CGGRLLVLTQTPETLAASQDSFISITCRSNMEVGTSMAWYQQKPNEAPRLLIFGASARAAGTPSRFRGSGSGSDFSLTIHGVEAEDVGVYYCQ
Ailuropoda melanoleuca V423 trav ACTA01004836.1 1813 QIHGDSVTQMEGLVTLSEKASLTINCTYITTSYPTLFWYIQCLGEGLKLLLKASRDQKGSNKGFVAMYNRDSKSFHLEKGSVQASDSAVYYCAMN
Ailuropoda melanoleuca V438 trgv ACTA01010350.1 56286 GGVGLKLEQPALVMVRLPLKPSATLTCKVDSSVSYIHWYRHQEGMAPRRLLYLEMSSSKVERDFPMNADKVNAEKGSDGYSCSLSVLKLRKSDEGVYYCAAWE
Ailuropoda melanoleuca V439 trgv ACTA01010350.1 11603 SGAGLKLDQPDVVVERLGKTASLPCKVDTRVSYIHWYRYQEGSAPQRLLYFDVSGSFARRDLVLKADKVNAKKGRDGYSCNLSVLKLEKSDEGVYYCAAWE
Ailuropoda melanoleuca V443 trgv ACTA01011721.1 16930 GWAWNTLEQPIMVVAPAGSSATLPCKASSRVNYIHWYRLQEGMAPKRLLRVDMSGPYVRRDWVLKADKVNATSEEDSTSCTLSVLKLEKSDEGVYYCAAWQ
Ailuropoda melanoleuca V444 trdv ACTA01011783.1 20344 KGVLCDEVTQSSPDQTVASGSKVTLLCTYYTTQSNPDLYWYRIRPDHAFQFILYRDNTRSKNADFTGHRFSVLHDQSRRTFHLVISPVEPEDSATYYCAMN
Ailuropoda melanoleuca V449 trav ACTA01012563.1 51260 QTHGESVTQTEGEVTLSEKASLTMNCTYSASGYPALFWYVQYPGEGPQLLLKASRDKEKGIDKGFEATYNRDSKSFHLEKGSVQASDSAVYYCAMS
Ailuropoda melanoleuca V450 trav ACTA01012563.1 46911 STIAQKVTQAQPVMLVQEKGAVTLECTDSTVDPSYSLLWYKQPSSGAMIFLICQDSYSQQNATDGHYSLNFQKTRKSIQLVMSASELEDSAVYFCALRE
Ailuropoda melanoleuca V451 trav ACTA01012563.1 41260 QTQGNSVTQTEGQVTLSEKASLTINCTYSTTGSPTLFWYVQYPGEGLQLLLRAFSDKKESNKGFEATLDSKSKSFHLEKGSVQASDSAVYYCAMN
Ailuropoda melanoleuca V452 trav ACTA01012563.1 33334 VRGLEVEQSPSTLSPREGAGAALKCNFSQTVRSVQWFRQNPGGSGLTRLVYVASGTKQSGRLNCTLNTRERSSTLHIADSQLEDAASYLCAAE
Ailuropoda melanoleuca V453 trav ACTA01012563.1 20727 QTHGDSVTQTEGQVTLLEEASLTMNCTYSTIGSPTLFWYVQYPGEGLKLLLKSSRDQEKKSNNGFEATLDSKSKSFHLEKGSVQGSDAAMYYCAMS
Ailuropoda melanoleuca V455 trav ACTA01012563.1 4778 QTHGDSVTQTEGQVTLSEEASLTLNCTYSASGSLTLFWYVQYPGEGPQLLLKALRDKEKGISKGFEATYDKDSKSFHLEKGSVQASDSAVYYCALN
Ailuropoda melanoleuca V456 trav ACTA01012563.1 466 VRGLDVEQSPSALSLQEGAGAALKCNFSKAVNSVQWFRQNLRGGGLTSLFFIASGMKQSGRLNCTVNMRERSSTLHIAASQLEDAASYLCAAE
Ailuropoda melanoleuca V458 trav ACTA01012836.1 3245 VRGLEVEQSPSALSLQEGAGAALKCNFSQAVNSVQWFRQNPGGGGLTRLISVASGIKQSGRLNCTLNTRERSSTLHIADSQLEDAASYLCAAE
Ailuropoda melanoleuca V471 trgv ACTA01019721.1 39018 SSGAISLEQPDVVVARTGNLAALPCKASTKVNYIHWYHHQEGMAPERILRLDMSGSSMYKDSVLKADKVMATKDKDGTSCNLFVLKLEKSDEGVYYCAAWE
Ailuropoda melanoleuca V476 trav ACTA01020563.1 2171 FSQGETVEQRPSTLSERQGRSSVINCSYSDSASVYFPWYKQELGKGPRLLIYIRSSMTTKEDQRLTVSLSRTARHLSLHIADTQPEDSAVYFCAA
Ailuropoda melanoleuca V477 iglv ACTA01020602.1 10068 SMASYVLTQPSSMSGNLGQTAKITCGGNSIGRKYASWYQQKPGQAPVLIIYQNSKRPSGIPDRFSGSNSGNTATLTISGARAEDEADYYCQTYDSSAD
Ailuropoda melanoleuca V478 trav ACTA01023509.1 375 VRAQMKVEQSPKVLTLQEGRNASMMCNCSSSMTGVQWFQQSPEGRLTSLSYIASGIQQKGRLIFTVYTKERNSHLYITDSQPGDSFTYFCAVE
Ailuropoda melanoleuca V493 trav ACTA01028256.1 2015 SGMTQKVTQAQPAVSTLENEAATLDCVYEVSGSSYYLFWYKQPPSGEMIFLIRQDSYSEQNAIEGRYSLNFQKSDRSISLTITALQPEDSAVYFCALR
Ailuropoda melanoleuca V495 trav ACTA01028836.1 1778 QTHGDSVTQTEGQVTLSEKASLNINCTYITTSFPTLFWYVQYTGEGPQLLLKALKDKEKGTRDKEKGIDKGFEATYNRDSKSFHLEKGSVQASDSAVYYCAMN
Ailuropoda melanoleuca V500 trgv ACTA01034350.1 1235 LGAGLKLEQPAFVVARLPSDRSATLTCKVDSSVSYIHWYRHQEGEAPRRLLYLDMSRGYAQRDYPMKSDKVNAEKGRDGYSCTLSVLKLEKSDEGMYYCAAWE
Ailuropoda melanoleuca V508 trav ACTA01042840.1 19842 QTHGDSVTQTEGQVTLSEEASLTMNCTYSTTGYPTLFWYVQYPGEGPQLLLKASRDMEKGINKGFEATYDKDSKSFHLEKGSLQASDSAVYYCVLS
Ailuropoda melanoleuca V509 trav ACTA01042840.1 13188 VSGKNQVEQNPPYLIVLEGVNCTVQCNYTVNPFSNLRWYKQSTGRGPASLTVMTYGDSKKSDGRYTETLDATTKHSSLHITAAQLSDSAIYICVVS
Ailuropoda melanoleuca V510 trav ACTA01042840.1 4897 MKSQQKGMEQSLGSLRVLQGATASLNCNYSDSASQYFVWYRQYSGKGPELLVYLYSKGDKKEGRFSAQVDAAKQNVFLLISDSQSRDSATYLCAV
Ailuropoda melanoleuca V519 trav ACTA01045052.1 834 LHGEDSVEQSPQTLRLQEGDSVSLNCTYTVSSFNGLQWYRQASGQGPEFLFLLYSVGAEKQKERLTATLLNKESSLHIEASKPEDSATYFCAVE
Ailuropoda melanoleuca V520 trav ACTA01047834.1 389 VGSVLNVQQNPPWLRVQEGEDTNFTCRFPSTTFYSLHWYRWEPAKSPTFLFSVSLNGDEKKKGRVKTTLNTQEGYSSLYIKGSQPEDAATYLCAM
Ailuropoda melanoleuca V532 iglv ACTA01051866.1 1582 SQPGLAQPEALLVFPGQVAQLSCMLSPRHATVGEYGVSWYQQRAGSAPRYLLYYRSEDDCHRPPDIPERFSAATDAAHNACILTISPVQPEDDADYYCSVG
Ailuropoda melanoleuca V586 iglv ACTA01084209.1 1697 SMASYVLTQPPSMSVNLGQTAKVTCGGNNIGDKYSYWYQQKPGQAPVLIIYEDNKRPSGIPDRFSGSNSGNTATLTISGAQAEDEADYYCQTYDSSAN
Ailuropoda melanoleuca V587 trav ACTA01084255.1 4312 MKSQQKGVEQSLGSLSVLEGATASLNCNYSDSASQYFVWYRQYSGKGPELLVYLYSKGDKKEGRFLAQVDTAKQYVSLLISDSQASDSATYFCAV
Ailuropoda melanoleuca V591 trav ACTA01084861.1 1221 VSSKQEVTQSPEALNVRERDSVVVNCSYTDGALYSLQWFRQDPGQGLTFLLLIQSNQREQTGGRIKVSLDTATRQSVLYIAASQPSDSATYLCAV
Ailuropoda melanoleuca V592 iglv ACTA01084880.1 6373 SWAQSVLTQPPSLSGALGQKVTISCTGSSTNIGGYYVSWHQQLPGTAPRTIIDSSNNRPSGIPDRFSGSTSGSSATLTITGLQAEDEADYYCASWDSSLK
Ailuropoda melanoleuca V608 iglv ACTA01092809.1 8511 SMASSGLTQSPSVSVSLGQTATITCSGEILSKAYTQWFQQKAGRAPVRVIYKDTEQPSGILERFSGSGSGNTHTLTISGARAKDEADYYCQAWDRNVK
Ailuropoda melanoleuca V609 iglv ACTA01092809.1 1738 SVASSGLTQPPSVSVALAQTATIICSGDVLGKRYAYWYQQKASQAPVLVINKNNERPSGISDRFSGSNSGNTATLTTSGARAEDEADYYCQSYDSSGN
Ailuropoda melanoleuca V616 igkv ACTA01098802.1 19184 SHGEIVLTQSPALLSKALIEKVTITCRASQSISTNLHWHQQKPNQAPKLLVKYASQTISGVPSQFSGSGSGTDFTLTISSLEPEDVATYYCQQSNSNP
Ailuropoda melanoleuca V617 igkv ACTA01098802.1 10301 SSGEIVMTQTPLSLPVTPGEPASISCKASQSLLHSDGNTYLHWYLQKPVQSPKRLIYRVSNRAPGVPDRFSGSGSGTDFTLKISRVEADDVGVYYCGQGTKK
Ailuropoda melanoleuca V618 igkv ACTA01098802.1 3545 SSGEIVMTQTPLSLPVTPGEPASISCKASQSLLHSDGNTYLHWFRQKPGQSPEGLIYKVSNRFSGVPDRFSGSGSGTDFTLKISRVEADDVGVYYCGQG
Ailuropoda melanoleuca V644 trav ACTA01108255.1 10737 QTHGDSVTQTEGQVSLSEEASLTINCTYTTTLYPTLLWYVQYPGEGPQLLLSVSWGQEKGSNKGFEATLDSKSKSFHLEKGSVQASDSAVYYCAMS
Ailuropoda melanoleuca V645 trav ACTA01108255.1 5399 VSGKNQVEQNPPYLMVLEGANCTMQCNYTVNPFSNLRWYKQSTGRGPASLTVMTYGDSKKSDGRYTETLDATTKHSSLHITAAQLSDSAIYICVVS
Ailuropoda melanoleuca V665 iglv ACTA01122766.1 4145 SVASYALTQPPLVSVTLGQTASITCGGDNIGSTYVSWHQQKPGQAPVTIIYTDSNRPSGIPDRFAGSNSGNTATLTISGVQAEDEADYYCLSNSGSTGT
Ailuropoda melanoleuca V667 igkv ACTA01122802.1 2320 SGSTGEIVMTQSPASLPLSPGEKATFNCRASQSVSSYVAWYQQKAGQAPRLLIYHASSRATGIPDRFSGSGSGTDFTLTISSLQAEDVAVYYCQQYNSGC
Ailuropoda melanoleuca V671 ighv ACTA01123562.1 3905 VQCEVKLVESGGDLVQPGGSLRLSCAASGFTFSSYDMSWVRQAPGKGLQWVADISSSGSTYYADSMKGRFTISREDAKNMLYLQMNSLGAEDTAIYFCVS
Ailuropoda melanoleuca V672 iglv ACTA01124243.1 3746 QSVLTQPPSVSGTLGQGVTISCTGIPTDTNYDGEEYQYNVNWYQKFPGKAPILLIYNDENRNSGVPDRFSGSRSGSSASLTITSLQAEDEADYYCQ
Ailuropoda melanoleuca V688 iglv ACTA01130766.1 3277 SMASSGLTQSPSVSVSLGQTASITCSGEILSKEYTQWLQQKAGRAPVTAIYKDTERPSGIPERFSGSSSGNTHTLTVSRARAKDEADYYCQAWDSNVK
Ailuropoda melanoleuca V689 igkv ACTA01130802.1 2911 CDDTDPSLPSRHPWRAGLVSCKASQSLLYSNGYTYLYWYLQKPGQSPQLLIYLVSNRHSGVPDRFSGSGSGTDFTLKISRVEAEDVGVYYCMQG
Ailuropoda melanoleuca V708 trav ACTA01139974.1 2823 QTHGDSVTQTEGQVSLSEEASLTINCTYTTTGYPTLLWYVQYPGEGLQLLLSSSTDQEKKSNKGFEATLDSKSKSFHLEKGSVQASDSAVYYCALR
Ailuropoda melanoleuca V712 trgv ACTA01140563.1 6775 GLGQVKLEQPEISISRARDKSAHISCKVFISDFNNAKIHWYRQKPDQEIEHLTYIQASSGQVSLGGKKNKLEASKNALTSTSTLNINFLEKQDEAVYYCACWDWD
Ailuropoda melanoleuca V725 trav ACTA01147973.1 4015 FSRGETVEQRPSTLSVQQGRSSVINCSYSDSASDYFPWYKQELGKGPRLLIYIRSTMTTKEDQRLTVSLSRTARHLSLHIADSQPEDSAVYFCAA
Ailuropoda melanoleuca V727 trav ACTA01148037.1 3782 LSNKQEVKQSPEAPNVRERDSVVVNCSYTDGALYSLQWFRQDPGQGLTFLLLIQSNQREQTSGRIKVSLHTLTRQSVLYIAASQPSDSATYLCAV
Ailuropoda melanoleuca V737 igkv ACTA01154800.1 6711 SSGEVVMTQTPVSLPVTLGEPASISCKASQSLLHSNGNNYLHWYLQKPGQAPQLLIYIASNRFTGVPDRFSGSGSGTDFTLKISRVEAEDVGVYYCQQT
Ailuropoda melanoleuca V738 igkv ACTA01154800.1 2490 SSGEIVMTQMPLSLSVTPGEPASISCKASRSLLHSNGKTYLYWFRQKPGQSPEGLIYEVSNRYSWVPDRFSGSRSGTDFTLKISRVEADDVGVYYCGQGIQSP
Ailuropoda melanoleuca V741 ighv ACTA01155560.1 10329 VLCEVQLVESGGKLVKPGGSLRLSCASSGFTLSSYWMSWVRQALGKRPQWVTYVSHGGSTYYADSVKGRFTISRDNGKNTLYLQMNSLRTEDTALYYCVK
Ailuropoda melanoleuca V756 trgv ACTA01164560.1 25927 GHAEIRLEQLTVVVARESSSASLLCTAKTKVSYIHWYRYQEGKAPQRLLRLAMYQSDVRWDPVEKADKVTTIEAKDGYSCTLSVLKLEKSDKGVYYCAAWE
Ailuropoda melanoleuca V757 trgv ACTA01164560.1 6115 TKADILITQLIPSITKKQGNTAFLECQIKTGGLRNNGYIHWYRQKPDQPLKRILYISSNENVVHEQEVDEERYEARKRQRDLSSSLRIHRVEEADAGLYYCACW
Ailuropoda melanoleuca V792 trav ACTA01180410.1 3166 INGQEIQQNPQFLLLQEGEDFTVYCNSSVTLNGLRWYRQRPGSGPVLLITLLKGGEEKQKRLTARFGEARKDSSLHVEASQTADAGTYFCTGAQCSQ
Ailuropoda melanoleuca V803 trav ACTA01188408.1 3662 VGTVLNVQQNPPWLRVQEGEDTNFTCRFPSTTFYSLHWYRWEPAKSPTFLFSVSLNGDEKKKGRVKTTLNTQEDYSSLYIKGSQPEDAATYLCAM
Ailuropoda melanoleuca V806 iglv ACTA01188750.1 1943 SWAQSVLTQPPSVSGALGQSVTISCTGIPTNTDYDGEEYQSYVNWYQQFPGKRPILLIYGDENRNTGVSDRFSGSKTESSASLTITSLQAEDEADYYCQ
Ailuropoda melanoleuca V807 trav ACTA01188942.1 433 IMSDAKTTQPNAMESTEEEPVHLPCNHSTISGNEYIYWYQQIPSQGPEYMIHGLKDNVTDRKATLIVAVARESSTLILPRVTLGDAGVYYCILIE
Ailuropoda melanoleuca V821 trgv ACTA01195708.1 55424 RLAGIRLEQPALVVARSGTWVTLSCRANTKVSYIHWYQHQEGNAPQRLLIVALFSSYVQTDSVLKGDKVTARRGSDGKSCNLLMSKLEKSDEGVYYCAAWE
Ailuropoda melanoleuca V823 igkv ACTA01196592.1 12913 ASSEIQMTQSPSLLSASPGDRVTITCRASQNANKWLTWYQQKPGKPPKPRIYEASKLQTGVPSRFSGSGSGTDFTLTISSLEPEDAGTYYCHQYNSNP
Ailuropoda melanoleuca V824 igkv ACTA01196592.1 8143 VRGSTRLIQSPAFLSVSLRESVFITCRANDSISDYLSWYQQKPGQAPKLLIYDADNLGSGVPDRFSAIQSKTEFILKISTIEAEDAASYYCQQDYTLP
Ailuropoda melanoleuca V825 igkv ACTA01196592.1 4071 SSGEIEMTQTPLSLPITPGEPASVSCKASQSLLHSNGNTYLNWYLQKPGLAPKRLIYMLPNRASGVPDRFSGSGSGKDFTLKISRVEADDAGVYYCQQTLQNR
Ailuropoda melanoleuca V827 trav ACTA01196823.1 3158 FSQGETVEQRPSTLSERQGRSSVINCSYSDSASVYFPWYKQELGKGPRLLIDIRSNMATKEDQRLTVSLSRTARHLSLHIADTQPEDSAVYFCAA