WGS Statistics
Organism WGS Record. Vs Total IGHV IGLV IGKV TRAV TRBV TRGV TRDV
Salmo salar AGKD00000000.1 (AGKD01) 287 67 2 73 92 38 7 8
Salmo salar AGKD00000000.4 (AGKD04) 285 77 2 61 93 33 11 8
Vgene Table
Organism Vgene Locus contig Contig Pos. AA sequence
Salmo salar Vs41 trav AGKD01005401.1 16283 VSHGNDITPTTDKVFGLEGDVINLSCNYSSASTLQWYQQYPGSSPIFLLLTGVSSNPSVVHATPPYPRLSVKLNDERTHVDLEMSSAEVTDSALYYCAL
Salmo salar Vs40 trav AGKD01005401.1 13214 CRAEENVIQPTKDVMVVEGQPIKLTCLFDTTSQSPYLFWYKQQTNSNPMFMLRRDTFGAGETATEFKERFHARLNVTAKSVPLTIQRVQLSDSAVYYCALR
Salmo salar Vs574 ighv AGKD01001158.1 7097 LIGQSLETIPSGLVLKKPGEMVSISCIESGYTFSSHGMRWIRQPAGKALEWIGAIWGDASGTAYGKNVERRIEITKDNLNNMTHLKLSDLREEDSAVYYCTR
Salmo salar Vs217 igkv AGKD01052008.1 5315 SSADIILTQSPKSQSVRLGETVSISCTASSSTGNNLHWYLQKPGEAPKLLVYSTTSRQSGIPGRFSGSGSGSSYTHYTLTISGVQAEDAGDYYCQQGNSSP
Salmo salar Vs749 ighv AGKD01034514.1 7952 VQGQSLTSSEPLVKSPGESVTLYCTVSGLPLSWLHWIRQKPGKGLEWIGRIDSGTGTIFSQSLQGQFTITKDNSKKQLYLEVKSLKTEDSAVYYCAR
Salmo salar Vs218 trgv AGKD01052023.1 5154 QRLQQDQISKTRREKQSVSFGCKVTGSCFGNLVHWYQKREGEPFSWILYFDFDDNSDSRATTHPQRADFSVRGESDSSNLMIKSVKVSHSATYYCACWVSG
Salmo salar Vs594 igkv AGKD01002883.1 18735 KNHQRSHYHTVVQRPVSDPVHPGDSVTLQCTVLSETCTGEHSVYWFRAGSGESHPGVIYTSGNRSDECQKNPETPSPTQSCVYSFSKNNLSLSDAGTYYCAV
Salmo salar Vs919 trav AGKD01087630.1 3723 CRAEDNVRQPKEDVMVVEGQPTTLTCQFDTTSQSPYIFWYKQLVNGKPIFMLRRDTFSPGEITTEFKDRFHAHLNVTAKSVPLTIQRLQLSDSAVYYCALR
Salmo salar Vs1040 igkv AGKD01191094.1 1368 ARGQYVLTQTPAVKAVVPGQQVSLNCKTSSDVYNDNCLAWYQQKPGGAPKLLIYYATTLQSGTPSRFSGSGSRSDFTLTISRVQAEDAGDYYCQS
Salmo salar Vs591 ighv AGKD01002588.1 7927 VYGQTLTESGPVVKKPGESHQLTCTASGFTFSSSRMGWIRQAPGKGLEWIAYIDTASTPISYSKSVQGRFTISRDDSSSKLYLQLNSLKSEDTAVYYCARE
Salmo salar Vs866 trav AGKD01073241.1 4112 DTYEQTIETNQHEVYAVVGSNVLLSCNYSSADSLLWYKQSPGSAPQYLLLIQAYTGTEHRAVSLDSRSSGKLKKEKTRVDLEISSAEETDSAMYYCALN
Salmo salar Vs911 igkv AGKD01086182.1 6030 QSLSSKVHQTPIAVLKGSKDNVQLTCNHTIQNYNVILWYQQSTGDTAMNLIGYAYTTSITMEKSFEKHFSVSGDGSKEAYLHLLSVRAPEDSAVYYCAAS
Salmo salar Vs598 trbv AGKD01003614.1 6865 LSQTDKVQQTPTAILKGPEDNVQLNCSHTIPNYDTILWYQQSAQNTALKLIGYVLLTSPTVEDSFKERFTVSGDAATGKMAYLHIRNLRGTEDSAVYFCAASK
Salmo salar Vs915 trbv AGKD01086757.1 5209 LSQTDKVQQTPTAILKGPEDNVQLNCSHTIPNYNTILWYQQSAQNTALKLIGYVFLTSPAVEDSFKERFTVSGDAATGKMAYLHIPKLRGTEDSGVYFCAASY
Salmo salar Vs622 trav AGKD01006354.1 36320 LSIGIITQSDLLKTFIDGDTVDLKCFISGTGGDYYNWFKLTVGQAPAMIVSLYLDSKDPTLYGEFDNNPRFSAEKNGDSFVLTISNAKPSDVGMYYCA
Salmo salar Vs473 trav AGKD01219782.1 1874 GNSFGDSINHATTEELVPEGRNVHLFCKYDGTVNNLLWYRQYPRSKPEFLLYITPEGSIFKATPPPPRLTVSIDKVDKRVDLKISSAEVTDTSLYYCAMK
Salmo salar Vs5 igkv AGKD01000742.1 4719 SRGQYTLTQTPAVKAVGTGETVNIGCKLSSSIYSNYLAWYLQRSGEAPKLLIYQINNKFTGTPSRFSGSGSGSDFTLTISGVQAEDAGDYYCQS
Salmo salar Vs6 igkv AGKD01000742.1 10328 SRGQVTVTQTPTMKTVLPEQTIIINCKTSVTVSFGCTGYYYCMAWYQQKPGGAPKLLMYSSNRLQSGTPSRFSGSGSGSNFTLTISGDQAEDAGDYYCQS
Salmo salar Vs7 igkv AGKD01000742.1 18607 SRGQYTVTQIPTVKAVLPGQTVSLNCKTSSNVYYNNLLAWYQQKPGGAPKLLIYRATTLQSGTPSRFSGSGSGSDFTLTISGVQAEDAGDYYCQS
Salmo salar Vs8 igkv AGKD01000742.1 20348 SRGQYTVTQTPTVKAVLPGQTVSLNCKTSSNVYSNNRLAWYQQKPGGAPKLLIYRATTLQSGTPSRFSGSGSRSDFTLTISGVLAEDAGDYYCQS
Salmo salar Vs184 igkv AGKD01041543.1 7922 SQSNSKTVEQQAKSDPVHPGDSVTLQCTVLSETCTGEQIVYWFRAGSGDSHPGVIYTPGNRSDECEKSPETPSPTQSCVYSLSKNNLSLSDAGTYYCAV
Salmo salar Vs750 trbv AGKD01034563.1 8877 LSPTDKVHQTPTAILKRPEDKVHLTCSHTVSSYDMILWYQQSAQNSALKLIGYVWNTSPTVEDSFKGRFNVSGDGAANKMAYLHFPKLTEAEDSAVYFCAASK
Salmo salar Vs107 igkv AGKD01018063.1 11225 QVTVTQPPVVTCSPGDPVTLTCTTNPEVYRFSDGDEALSWYQQRPGEAPKLLIIYAKTLLDGIPARFSGSGSESDFTLTISGVQVEDAAVYYCQSYHELND
Salmo salar Vs579 ighv AGKD01001402.1 12806 VHCQVVLTQAEQSVQGTSGGSLKLTCACSGFTLSSYRMHWIRQAPGQGLQWILHYYTSSDNGYALVLQGRFTASKDSANFYLHMTQLKPEDSAVYYCA
Salmo salar Vs103 igkv AGKD01017724.1 19516 SRGQVTVSQTPAVKSVSVGHSVSLSCKTSSAVYSNSNGHYLHWYQQKPGGAPELLIYWAKTLQSGTPSRFSGSGSGSDFTLTISGVQAEDAGDYYCQS
Salmo salar Vs450 trav AGKD01186767.1 1345 DTYEQTIEPNQHEVYAEVGSNVLLSCNYSSADSLLWYKQSPGSAPQYLLLVQHYTGIGQRADSLDSRFSGKLNKEKTRLDLEISSVEETDSALYYCALR
Salmo salar Vs745 igkv AGKD01032856.1 7226 SSAGVVTQSPTVKSVSLGETVYLRCTASKGVGNDLSWYLQKPGQSPQLLFYKISQRQSETPGHFSSSGSKPDFTLTISVVQAEDIGDYYCMGS
Salmo salar Vs684 trav AGKD01016395.1 17124 GSYEQTIEPNQHEVYAEVGSNILLSCNYSSAYNLLWYKQSPGSAPQYLLLIPHSTGTEYRDDSLDSRFSGKLNKEKTRVDLEISSAEVTDSALYYCALR
Salmo salar Vs746 igkv AGKD01033760.1 13051 SRGQVTVTQTPAVKAVLTGQTVPLNCKTSSDVYQAGTSSPRLAWYQQKPGEAPKLLIYYATTLQSGTPSRFSGSGTHSDFTLTISGVQAEDAGDYYCQS
Salmo salar Vs459 trbv AGKD01199426.1 1253 LCLCVEVHQTPSAVFSRPGENIQLFCHHQKTDYTQMLWYQKSQGETALKLIGYLNYNSKTIESSYEKNFNMSGDLSGDGPKNASLNMFNLRQPQHSAVYLCAARY
Salmo salar Vs740 igkv AGKD01031600.1 2915 HNHPTLVQQPVSDPVHPGDSVILQCTVLFETCTGEHSVYWFRAGSGESHPGVIYTPGNRSDECKKNPETPSPTQSCVYRLSKNNLSLSDAGTYYCAV
Salmo salar Vs512 trbv AGKD01367652.1 329 FCGGVTVKQSPVLSVCREGDVSVTLQCYHDDSSYYYMFWYRQRDNNMKMLTYSLGQGVWEIEPPFEKDVHYTMSRPELTRSTLEIKNLAVGDGAVYYCASST
Salmo salar Vs108 trav AGKD01019325.1 4225 DSNDQIIEPIREEVYAPAGSNITLSCTYSSAVSLQWYLQDPGSPPQYILLILHGVGSPSRAPGLDPPLSVKLNDEKNRVDLEISSAKEKDSTMYYCALT
Salmo salar Vs208 trav AGKD01049466.1 7151 CRGEDSVIQPPGDVITTEGEQVTLDCQFDAVNMKGLYLFWYKHEVNGFPEFMLGRFPFGSKNATEFKDRFDAHLDADSKSVPLTIQRLQLSDSAVYYCALR
Salmo salar Vs209 trav AGKD01049466.1 7843 CRGDRVLQPKGVETATEGGQITLVCLYETDDSSPYLFWYKQGTNDYPKSILMRFKFGTVDNATDFKERFHADLDANSKSVPLTIQRVQLSDSAVYYCALK
Salmo salar Vs578 ighv AGKD01001402.1 20712 IQGQTLTESGPVVKKTEESHKLTCTGAGFTFSSYWMAWIRQAPGKGLEWIGIIHGTTTYYSQSVQGRFTLSRDDSSSKLYLQMNSLKSEDTAVYYCAR
Salmo salar Vs206 ighv AGKD01048570.1 3083 VQSYELTQPASMTVQPGQPLTISCKVSYSVTSLHTAWIRQPAGKTLEWIGYIHSGGSMYYKDSLKNKFSITRETSSNTLFLKGQSLQTEDTAVYYCAR
Salmo salar Vs168 trbv AGKD01036514.1 8646 HVKCVAFRQSPSLTVKDGREAEIHCSHDDSNLSVMLWYQQRQASPGMTLIGYSYSTTEPNYESLFEERFRLKIQGDLKGTLVISKLTLADSAVYFCAAS
Salmo salar Vs202 igkv AGKD01045427.1 4007 SSAEIILTQSPKSQSVRSGNTVSISCTASSSTSNVLSWYLQKPGEAPKLLVHSAAARQSGIPGRFSGSGSGSSFTHYTLTISGILAEDAGDYYCQQGASYP
Salmo salar Vs34 trav AGKD01005106.1 6439 CRGEDSVIQPSGDVIATEGEQVTLGCQFDAVNMKGLYLFWYKHEVNGFPEFMLGRFPFGSKNATEFKDRFDAHLDADSKSVPLKIQRLQPSDSAVYYCALR
Salmo salar Vs35 trav AGKD01005106.1 7132 CRGDRVLQTKGVETATEGGQITLACHYETDDPSPYLFWYKQGTNDFPKYILMRPKFGTGDNAADFKERFHADLDANSKSVPLTIQKLQLSDSAVYYCALR
Salmo salar Vs36 trav AGKD01005106.1 19066 DTYEQTIEPNQHEVYAEVGSNVLLSCNYSSAYSLLWYKQSPGSAPQYLLLILHSAGTGQRADSLDPRFSGKLNKEKTRVDLEISSAEVTDSALYYCALR
Salmo salar Vs899 ighv AGKD01081947.1 1808 VCCDIRLDQSPPQVKRPGDTVKLSCTISGFSMSGYWIHWMRQNQGKALEWIGRMNSNSPYYSDSLKDQFTLTEDVSTSTQFLEAKSLRSEDSAVYYCARE
Salmo salar Vs152 ighv AGKD01030067.1 7455 VQSQTLTESESVVKTFEESHKLTCTYSGFGCYYWNAWIRQASGKGLEWVATISDSSRYIYYSQSIQGRFTISRDNSKQQVYLQMNSLKTEDSAVYYCAR
Salmo salar Vs573 ighv AGKD01001158.1 20539 IHSISLTSSPAQLKPPGDSVKLSCQVSGYALTDYGTAWIRHQPGKTLEWIGIIWSDASINSGASFKSRFTISRDSSNVLHLDITSLQAEDTAVYYCAH
Salmo salar Vs1059 trav AGKD01219840.1 528 CRAEDNVRQPKEDVMVVEGQPTTLTCQFDTTSQSPYIFWYKQLVNGKPIFMLRRDTFSPGEITTEFKDRFHAHLNVTAKSVPLTIQRLQLSDSAVYYCALR
Salmo salar Vs896 igkv AGKD01081127.1 5128 QSLSSKVHQTPIAILKGSKDNVQLTCNHTFQNYNMILWYQQSTGDNAMNLIGYAYYKSITMEKLFEKHFSVSGDGLKEAYLHLLSLRATEDSAVYYCAAS
Salmo salar Vs38 trav AGKD01005401.1 2738 CRGEDSVIQPSGDVIATEGEQVTLGCQFDAVNMKGLYLFWYKHEVNGFPEFMLGRFPFGSKNATEFKDRFDAHLDADSKSVPLKIQRLQPSDSAVYYCALR
Salmo salar Vs893 igkv AGKD01079986.1 1147 KNHQMSDYKTVVERPMSDPFHPGDSVTLQCTVLSETCTGEHSVYWFRAGSGESHPGLIYTPGNRSDECEKSFECPSSTKSCVYSLSKNNLSLSDAGTYYCAV
Salmo salar Vs199 igkv AGKD01044969.1 7482 SRGQVTVTQTPAVKSVSVGNSVSLSCKTSSAVYSNSNGHYLHWYQQKPGGAPELLIYLAKTLQSGTPSRFSGSGSGSDFTLTISGVQAEDAGDYYCQS
Salmo salar Vs817 trav AGKD01057998.1 11996 VSSEQVLTPYTDVEVASEMDRVTLSCNYTSSGVTLQWQQQHPKSAPQLLVMEHMTAKTPEFTLNHNKKAKLVDLEIFSAEVTDSTLYYCALT
Salmo salar Vs571 trav AGKD01000910.1 2451 DTYEQNIEPNQHEVYAEVGSNVLLSCNYSSADSLLWYKQSPGSAPQYLLLIPHYSGIEQRADSLDSRFSGKLNKEKTRVDLEISSAEVIDSALYYCALR
Salmo salar Vs576 ighv AGKD01001399.1 12991 LNGQSMESIPSSPVLKKPGDTLSLSCKGSGFTFSSHGMHWIRQPAGKALDWMGLIYYDASKTIYSKNIEGSIEVTRDNSNSMVYLKLFGLRAEDSAVYYCARQ
Salmo salar Vs592 ighv AGKD01002588.1 5673 VQSYELSQPTSMTVQPGQPLTISCKVSYSVTNTWTSWIRQPAGKALEWIGNVYSGDTKYKDSLKNKFSLSVDSSSNTVFLKGQNLQTEDTAVYYCAY
Salmo salar Vs966 trav AGKD01121153.1 2228 DSMEQETITPVKPEVNALQGTDITLSCNYKGNINNLQWYRQYPGSRPECLLLILQTSKYVQNTSITTPRHNGRLNEEKTRVDLMISSVELEDSALYHCALQ
Salmo salar Vs819 trav AGKD01057998.1 4695 CKGEEGVDQQSGHVTALEGGLVTLSCNYTTSSPSLNLFWYIQLTRDSPQYVLRRDRYSEGSNSDEFKKRFDSRLNFTSSSVPLTIQRLQLSDSAVYYCALS
Salmo salar Vs818 trav AGKD01057998.1 11252 GSYEQTIEPNQQEVYAEVGSNVLLSCNYSSADNLLWYKQSPGSARQYLLLIPHYTGTGQRADSLDSRFSGKLNKEKTRVDLEISSAEVTDSALYYCALM
Salmo salar Vs577 ighv AGKD01001399.1 9628 VHCQVVLTQAEQSVQGTSGGSLKLTCACSGFTLSSYRMHWIRQAPGQGLQWILHYYSSSDNGYTLVLQGRFTASKDSTNFYLHMTQLKPEDSAVYYCARD
Salmo salar Vs110 trav AGKD01019325.1 5508 VSYQEEIQPIAKIMHGDEGGFVTLSCNYSGSPYSLQWYRQYPRSAPKFLLLTTVSSNPSVVNATPPYPHLSIKLNKERTRVDLEISTADVPDSALYYCALQ
Salmo salar Vs447 trbv AGKD01186102.1 1256 LSLSLEVYQTPSEVLLKHGENVQIFCHHERTNYRLMQWFQQSLVEKQLKLIAYLYFKSQTTYIEEHLNVSGDLSQNDPKNVSLNMFNLKGPDHSAVYFCAASE
Salmo salar Vs693 ighv AGKD01017194.1 2428 VQSYELTQPASMTVQPGQPLTISCKVSYSVTSLYTAWIRQPAGKTLEWIGYISSGGSTAYKDSLKNKFSITRDTSSNTVFLKGQSLQTEDTAVYYCARW
Salmo salar Vs443 ighv AGKD01181375.1 2149 VHCQVVLTQAEQSVQGTPAGSLKLTCACSGFTLSSTNMYWIRQATGKGLEWIIYYYSEGSKSNAQVVQGRFTASKDSSNFYLHMNLLKSEDSAVYYCARD
Salmo salar Vs691 ighv AGKD01017194.1 18385 LNGQSMESIPSSPLRKKPGETLSLSCKGSWYTQCEKYGMSWIRQPAGKSLEWIGYTGTYTKSVEGRIEITRDNTICIVYLKLSVLRAEDFAVYHCARE
Salmo salar Vs759 igkv AGKD01036732.1 6997 SRGQYTLTQTPAVKAVGTGETVNIGCKLSSSIYSNYLAWYLQRSGEAPKLLIYYATTLQSGTPSRFSGSGSGSDFTLTISGVQAEDAGDYYCQR
Salmo salar Vs561 trav AGKD01000865.1 26121 CRGEEAVDQQSGHVTALEGGLVTLSCNYTTSSPSPDLFWYIQLTRNSPWYVLRRDRYSEGSNSDEFKKRFDSRLNFTSSSVPLMIQRLQLSDSAVYYCALR
Salmo salar Vs290 trbv AGKD01086223.1 3365 LSQTDKVQQTPTAILNGPEDNVQLNCSHTIPTYNRILWYQQSAQNTALKLIGYVQFTSPTVEDSFKERFTVSGDAATGKMAYLHIPKLRGTEDSAVYFCAATY
Salmo salar Vs565 trav AGKD01000865.1 8020 CTGDNVKQQPGAVIVTEGGLVTLSCQYNTSANNAYLYWYKQEANDFPKHMLSRYSFGSGDNAAGFKERFDARLDADSKSVPLTIQRVQLSDSAVYYCALQ
Salmo salar Vs296 trbv AGKD01088338.1 5820 LSQTDKVQQPPTAILKGPEDNVQLNCSHTIPSYNTILWYQQSAQNTALKLIGYVFLTSPTVEDSFKERFTVSGDAATGKMAYLHIPKLRGTEDSAVYFCAATY
Salmo salar Vs295 trbv AGKD01088338.1 4616 SSLGSKVLQVPSALLESPNVTVILKCSHTISSYYTILWYQQSIADSNLKLIGFVFYKNPTVADQYKEHFEIRGDGEIEASLQLLSGPENSAVYYCAASK
Salmo salar Vs566 trav AGKD01000865.1 3470 CRGDRVLQTKGVETATEGGQITLACHYETDYPSPYLFWYKQGTNDYPKYILMRPKFGTGDNAADFKERFHADLDANSKSVPLTIQRVQLSDSAVYYCALK
Salmo salar Vs278 trdv AGKD01078252.1 2085 MVSGDSVTPDKEEYTPTEGSSVSLSCTYETSSNDIYLYWYRHYSNQAPQFLLYKGARSKSDREYIPDERYTSTTSWTSTELVITSLTLADTALYYCAL
Salmo salar Vs173 trav AGKD01037806.1 8657 LTPVILVSPPPSVVVHPGDNVTLQCTDVLKGPGHVAWFKQVNVSEPLCIASMYSSQLYVKHHNGFQPSHMEMFINNTIIFLKITEVDVADSGLYFCGMYDQYFI
Salmo salar Vs271 trav AGKD01076123.1 257 EDSVTQPPGDVIATEGEQVTLDCQFDSLDTSPYLFWYKQGANDFPKYMLRRATFGSDNAIEFQRRFDAHLNLTTFKSASKSVPLTIQRLQLSDSAVYYCALK
Salmo salar Vs1013 trav AGKD01153422.1 1292 VSFQDDINPTRPMVGGVEGDSITLSCSYTGSVNNLQWYRQYPRSKPEFLILITKSGYVKKPVPPRMSAQVQTDRMDLEISSAEVTDSALYYCALA
Salmo salar Vs272 trav AGKD01076123.1 5501 CRGEDTVIQPSGDVIATEGEQVTLDCQFDADDTRNLNLFWYKHELNGFPKFMLGRFPFGSKNATEFKDRFDAHLDADSKSVPLKIQRVQLSDSAVYYCALR
Salmo salar Vs24 igkv AGKD01002883.1 1232 VSQKRSDYQTVEQQPVSDPVHPGHSVTLQCTVLSETCTGEHSVYWFRAGSGESHPGVIYSPGNRSDECEKSPETPSPTQSCVYSLSKNNLSLSDAGTYYCAV
Salmo salar Vs568 trav AGKD01000910.1 15430 CRGEDSVIQPPGDVIATEGGQVTLDCQFDAVNTNDLYLFWYKHEVNDFPKFMLGRFSFGSTNATGYEERFDAHLDKDSKSVPLTIQRLQLSDSAVYYCALR
Salmo salar Vs886 trav AGKD01078428.1 1611 CRGEDSVTQPPGDVIATEGEQVTLGCQFDTLDTSPYLFWYKQGANDFPKYMLRRVTFGSDNVIEFQRRFDAHLNLTTFKSVPLTIQRLQLSDSAVYYCALR
Salmo salar Vs1061 ighv AGKD01221532.1 3728 VHCQVVLTQAEQSVQGTPAGSLKLTCACSGFTLSSTRMHWIRQAPGKGLEWIIYYYSDTYKSNAPVVQGRFTASKDSTNFYLHMSQLKPEDSAVYYCARD
Salmo salar Vs885 trav AGKD01078428.1 2331 CKGEEAVDQQSGHVTALEGGLVTLSCNYTTSSPSLDLFWYIQLTSNSPQYVLRRDRYSEGSNSDEFKKRFDSRLNFTSSSVPLTIQRLQLSDSAVYYCALR
Salmo salar Vs881 trav AGKD01077646.1 3380 DTYEQTIEPNQHEVYAEVGSNVLLSCNYSSAYSLLWYKQFPGSAPQYLLLILDSTRSEYRVDSLDSHFSGKLNKEKTRVDLEISSVDVIDSALYYCALN
Salmo salar Vs284 trgv AGKD01081998.1 2709 AASGQRLQQDQISETKREKESVTFSCKVTGSCSGNKVYWYQKKEGEAFTWINFDANSGSSDTPHPQRQDFYIWRESASHPSELKIQFVKVSHSATYYCACRVLG
Salmo salar Vs287 trbv AGKD01085717.1 204 LSQTDKVHQTPTAILKRPEDKVQLTCSHTDSRYDMILWYQLSAQNTALKLIGYVWNTSPTVEDSFKGRFNVSGEGAANKMAYLHFPKVTEAEDSAVYFCAASK
Salmo salar Vs803 trdv AGKD01050727.1 6783 MVSGDSVTPDKEEYTPTEGSSVSLRCTYETSSEYIYLNWFRHYSNQAPQFLLYKGARSWSSEEHIPDKRYTSTTSSTSTELVITSLTLADTALYYCAL
Salmo salar Vs978 trbv AGKD01129939.1 8124 LSQTDKVQQPPTAILKGPEDNVQLNCSHTIPSYNTILWYQQSAQNTALKLIGYVFLTSPAVEDSFKERFTVSGDAATGKMAYLHIPKLRGTEDSAVYFCAATY
Salmo salar Vs111 trav AGKD01019325.1 10510 SSNEEEIISATTEECVFEGDGVTLSCNYTGSYSSDTLLWYQQYTRSEPEILLLLTEGGLKTHNESTHPRLSVKQNEDKTHVDLEITSTEVTDSALYYCALR
Salmo salar Vs976 igkv AGKD01128913.1 1511 SGGQISVTQTPAVRAVLPGQSVSLNCKTSSNVYDNNFLAWYQQKPGGTPKLLIYYAKTLQSATPSRFSGSGTHSDFTLTISGVQAEDAGDYYCQS
Salmo salar Vs914 trbv AGKD01086757.1 6243 SSLGSKVLKVPSALLESPNVTVILKCSHTISSYYTILWYQQSIADSNLKLIGFVFYKNPTVEDQFKEHFEIRGDGEIEASLQLLSGPENSAVYYCAASK
Salmo salar Vs288 trbv AGKD01085717.1 3512 SYLSSQVYQSPASLYKNQGELAKMECSHSISSYNQILWYKQSNYRELVFLGYMTATSGFPEAGFDIEGDANTGGTSTLTINQLTPNSSAVYYCAAS
Salmo salar Vs1028 igkv AGKD01171984.1 1706 RCDSDSCSESCSPRTVSLSNCKTSSNVYNNNHLYWYQHKPGGAPKLLIYYATTLQSATPSRFSGSGTHSDFTLTISGLQAEYAGDYYCQSYHNGPV
Salmo salar Vs367 trdv AGKD01120641.1 1740 MVSGDSVTPDKEEYTPTEGSSVSLRCTYETSSEYIYLNWFRHYSNQAPQFLLYKGARSWSSEEHIPDKRYTSTTSSTSTELVITSLTLADTALYYCAL
Salmo salar Vs472 trav AGKD01219059.1 3314 LTPVVSASPPPSVVVQPGKNVTLQCTNVTGAPGHVGWFKQVNGSEPLCIASMYSSDPAVQHHNGFPPSHMEMLVRNITIFLKIAEVDEADSGHYFCGMLDKYII
Salmo salar Vs682 trav AGKD01016257.1 4473 GSHGNDITPTTDKVFGLEGDVINLSCNYSSARTLQWYRQYPGSSPTFLLLITVSSTPSVVNATPPYPRLSVELNDERTRVELEISSADVTDSALYYCVLE
Salmo salar Vs768 trbv AGKD01039104.1 6282 VIQTVEISQWPSSICSHPNTSMDMHCSQDAGYDYMYWYRHLQGEGPKLMATLVAGSASYETEFKSGFRVWRTENSEGMSSVRQWSLTVQMVQRKDQAVYLCAAS
Salmo salar Vs477 trav AGKD01228700.1 886 CRAEENVIQPTEDVMVVEGQPTTLTCLFDTTDLSPYLFWYKQQANGNPMFMLREDKFGAGETATEFKERFHARLNVTAKSVPLTIQKVQLSDSAVYYCALR
Salmo salar Vs362 trbv AGKD01117209.1 7472 SSLSNQVYQSPASLYKNQGELAKMECSHSISGYDRILWYKQSNYRELVLLGYLYGKTGYPEAGFGIEGDANAGGTSTLTINQLTPNSSAVYYCAAS
Salmo salar Vs686 trav AGKD01016395.1 3814 GSHGNDITPTTDKVFGLESDVINLSCNYSSASTLQWYHQYPGSPPIFLLLTGVSSNPSVVKAKPEDPRLSVKLNDERTHVDLEISSAEVLDSTLYYCALE
Salmo salar Vs572 ighv AGKD01001158.1 22433 LNGQTMESIPSSPLQKKPGETLNLSCRGTGYTFTSYGMNWIRQPTGKPLEWMGWINTNTGAAGYAKTLEGRIELTKDSSVSMTHLKLSGLKAEDSAVYYCARW
Salmo salar Vs762 igkv AGKD01037935.1 1425 SWGQYVLTQSAAQSVQPGQTISIDCSASSTVTQYSGSQYYLAWYHQTSGEAPKLLIYLTSDRFTGVSTRLSGSGRGNGVDFTLTISKFQAEDTGVYYCQS
Salmo salar Vs570 trav AGKD01000910.1 12693 DSNGQNIEPIREEVYAPAGSNITLSCTYSSAVSLQWYLQDPGSPPQYILLILHGVGSPSRAPGLDPRLSVKLNDEKNCVDVEISSAKEKDSTMYYCALT
Salmo salar Vs760 igkv AGKD01036732.1 2747 SRGQYVVTQTPTVKAVVPGQTVSLNCKTSSNVYSNNCLAWYQQKLGGAPKLLIYCATLLQSGTPSRFSGSGSRSDFTLTISGVQAEDAGDYYCQS
Salmo salar Vs767 trbv AGKD01039104.1 7716 VLNSSRLSQTPAAVIVRPKGSSSLSCSDNTSNVFYMYWYRRPAQSRALTLVGYLYLDTANLETDFTDDRFSLQGDSDSRGDLQISNLTTEDSGEYFCAT
Salmo salar Vs627 trav AGKD01006775.1 1911 CKGEEAVDQQSGHVTALEGGLVTLSCNYTTTSSTSLDLFWYIQLTRDSPRYVLRRDRYSEGSNSDEFKKRFDSRLNFTSSSVPLTIQRLQLSDSAVYYCALR
Salmo salar Vs369 ighv AGKD01120772.1 1438 LKGQSLESSPSSSVMKKLGETISLSCKISGFTFNSHNTHWIRQPAGKSLEWMGYSGLGLGYHAKTFEGRMETTKDNSNSMMTLKLSGLRAEDSAVYYCARQ
Salmo salar Vs575 ighv AGKD01001158.1 1241 VQSYELTQPASMTVQPGQPLTISCKVSYSVTSLHTAWIRQPAGKTLEWIGYIHSGGSMYYKDSLKNKFSITRETSSNTLFLKGQSLQTEDTAVYYCAR
Salmo salar Vs143 igkv AGKD01028086.1 11010 SRGQYTVTQTPAVKAVVPGQTVTLNCKTSSDVLANVYVAWYQQKPGGAPKLLIYSATTLQSGTPSRFSGSGSGSDFTLTISGVQAEDAGDYYCQS
Salmo salar Vs788 trgv AGKD01044536.1 3810 QQLQQDQISKIRREKQSVSFGCKVTGSCLGNLVHWYQKREGEPFTWILYFDFDDNSISSATSHPQRSDFSIWRESESDYSELKIQSVKVSHSATYFCACWVSG
Salmo salar Vs141 igkv AGKD01027757.1 7836 CAGDILLTQTPAVVMVQSGESATISCKASSAIDDDLAWYHQKLGEAPKFIINFNSGFTSGRYQGSGYDIDFTLTISGVQAEDAGDYYCQQHEATP
Salmo salar Vs562 trav AGKD01000865.1 25394 CRGEDSVTQPPGDVIATEGEQVTLNCQFDAVNINNLYLFWYKHEVNGFPKFMLGRFPFGSKNATGYEERFDAHLDKDSKAVPLTIQRLQLSDSAVYYCALR
Salmo salar Vs145 igkv AGKD01028086.1 16150 SRGQYTVTQTPTVKAVLPGQTVSLNCKTSSNVYSNNLLAWYQQKPGGAPKLLIYYATTLQSGTPSRFSGSGSGSDFTLTISGVLAEDAGDYYCQS
Salmo salar Vs144 igkv AGKD01028086.1 13328 ARGQYVVTQTPTVKAVVPGQTVSLNCKTSSSVYNNDFLAWYHQKPGGAPKLLIYRATTLQSGTPSRFSGSGSGSDFTLTISGVQAEDAGDYYCQS
Salmo salar Vs92 igkv AGKD01014071.1 10752 QSLSSNVHQTPIAVLKGSKDNVQLTCNHTIQNYYVILWYQQSTGDTAVNLIGYAQYKSITMEKSFEKHFNVIGDGSKEAYLHLLSLRAPEDSAVYYCAAS
Salmo salar Vs780 igkv AGKD01042459.1 8405 SSADIIMTQSPESQSVSPGETVSISCTASSSTGNNLHWYLQKPGEAPKLLVYSGTTRQSGIPGRFSGSGSGSSYTHYTLTISGIQAEDAGDYYCQQGASFP
Salmo salar Vs90 igkv AGKD01013673.1 7508 SSADIILTQSPKSQSVRLGETLSISCTASSSTGNNLQWYLQTHGDTPKLLVYHGTNRQSGIPGRFSGSGSGSSYTHYTLTISGVQAEDAGDYYCQQGGYFP
Salmo salar Vs91 trbv AGKD01014071.1 8777 LSQTDKVQQTPTAILKGPEDNVQLNCSHTIPSYNIILWYQQSAQNTALKLIGYVQFTSPTVEDSFKERFTVSGDAATGKMAYLHIPNLRGTEDSAVYFCAASK
Salmo salar Vs266 trav AGKD01073971.1 5062 LTPVVSASPPPSVVVQPGKNVTLQCTNVTGAPGHVGWFKQVNGSEPLCIASMYSSDPAVQHHNGFPPSHMEMLVRNITIFLKIAEVDEADSGHYFCGMLDKYII
Salmo salar Vs552 ighv AGKD01000015.1 68834 LNGQSMESIPSSPVMKKPGDTLNVSCKGSGYTFGNHAVHWVRQPKGKGLEWIGRVTTDTGEATYANSISGRLEITKDNAQSMSFLKMSGLRAEDSAVYYCARQ
Salmo salar Vs787 trav AGKD01044521.1 4935 HRRPCPTATRRFDFYRRTDTLNCQYNTTSAKNAPLYWYKHGTNDFPKHMLSRFSFGSGDNAAGFKERFNASLNAKTQSVPLTIQRLHLSDSAVYYCALR
Salmo salar Vs786 trav AGKD01044521.1 6919 LIAGDEITSLSHEVIKSEGESVTLSCSYVTSQTHPFLYWYRHYPNQTPQFLLYKGARSSTSEYISDKRYTSTTSDTSTELIIQHLTLADTALYYCALDS
Salmo salar Vs13 igkv AGKD01001636.1 9718 SRGQITVTQTPTVKAVVSGQTVSLNCKTSSDVHANVYVAWYQQKPGGAPELLIYTATSLQSGTPSRFSGSGSGSDFTLTISGVQAEDAGDYYCQS
Salmo salar Vs554 ighv AGKD01000015.1 49418 VQCEELTQPAFMTVQSGQLLTISCKVSYSVTSVATFWIRQPAGKTLEWIGYINSGGSTAYKDSLKNKFSITRDTSSNTLFLKGQSLQTEDTAVYYCAH
Salmo salar Vs995 igkv AGKD01141038.1 782 SRGQVTVTQTPAVKTISVGDLVSLSCKTSSAVYSDRHGQRLAWYQQKPGGAPELLIYLAKTLQSGIPSRFSGSGSGSDFTLTISGVQAEDAGDYYCQS
Salmo salar Vs1035 ighv AGKD01181087.1 819 IQGQTLTESGPVVKKTEESHKLTCTGAGFTFSSYWMAWIRQAPGKGLEWIGIIHGTTTYYSQSVQGRFTLSRDDSSSKLYLQMNSLKSEDTAVYYCAR
Salmo salar Vs1034 trbv AGKD01180988.1 384 LVEGSEVTQIPTILWRLKESDAPMNCSHTKGSGYYQMYWYRQLPGEGMKQVAFTIPNSKPEYSGDFSKDKFSAKKTVAESGSFTVKKLEAGDSGMYFCAVS
Salmo salar Vs776 trbv AGKD01042294.1 9355 LSLSLEVYQTPSEVLLKRGENVQIFCHHERTNYRLMQWFQQSPGEKQLKLIAYLYFKSQTTYIEEHLNVSGDLSQNDPKNVSLNMFNLKGPDHSAVYFCAASD
Salmo salar Vs777 trbv AGKD01042294.1 7750 VSLSKSVYQSPSTLLVKPNASVTLNCSHKIPSYDTILWYQRSVEDTALNLIAYAYYKTPTVEPSYKGYFDVKGDGENEAFLHILKLRQAEDSGEYFCAASE
Salmo salar Vs624 ighv AGKD01006433.1 13236 VHCQVVLTQAEQSVQGTPAGSLKLTCACSGFTLSSTRMHWIRQAPGKGLEWIIYYYSDTYKSNAPVVQGRFTASKDSTNFYLHMSQLKPEDSAVYYCARD
Salmo salar Vs772 trbv AGKD01040668.1 15593 SSLSNQIYQSPASLYKNQGESAKIKCSHSISSYNVILWYKQSNYRELVFLGYMTAKTANPEVGFGIEGDASAGGTSTLTINQLTPNSSAVYYCAAS
Salmo salar Vs773 trbv AGKD01040668.1 1210 LVEGSEVTQIPTILWEMKDSDALMNCSHTKGATYFQMYWYRQLPGEGMKQVVYTTSSSKPEYSGDFSEDKFSAKKTVVESGSFTVKKLEAGDSGMYFCAVS
Salmo salar Vs839 trgv AGKD01063303.1 4201 AAEAVNLQQEQLTVTKPSGKSGVIECKATGLNTGNIYWYQQRDGEALKWILFMHKGGGKSTKDPAFEDYQAEKAESSDTFTLTIPTLKTDHVATYYCASFD
Salmo salar Vs940 trbv AGKD01105141.1 9756 SSLSSQVYQTPASLYKKQGKSAKMECSHSISSYNRILWYKQSNYRELLLLGYMVGKTGYPEAGFGIEGDANAGGTSTLTINQLTPNSSAVYYCAAS
Salmo salar Vs778 trbv AGKD01042294.1 6956 LSLSVEVHQTPSAVFSRPGENIQLFCHHQKTDYRVMLWYQKSQGETALKLIGYLNFNSQIIESSYEKHFNMSGDLGGDGPKNASLNMFNLRQTQNSAVYFCAASK
Salmo salar Vs779 trbv AGKD01042294.1 3920 VSLSKSVYQSPSTLLVKPNASVTLNCSHKIPSYDTILWYQRSVEDTALNLIAYAYYKTPTVEPSYKGYFDVKGDGENEAFLHILKLRQAEDSGEYFCAAS
Salmo salar Vs564 trav AGKD01000865.1 23036 DTLEDDIYPTSPEDYYLEGSRVKISCNYTVKADSLLWYRQYSGSAPQYLLLIPHYTGTGQRADSLDSRISGKLNKEKTRVDLDITSAEVTDSALYYCALR
Salmo salar Vs558 ighv AGKD01000015.1 13663 VYGQSLEAIPSSPVLKNPGEPVSLSCKGSGFTFGSYHMGWIRQPAGKALEWIGIIWNDASGTAYAKSVEGRIEVTRDNSNSMVYLKLSGLRAEDSAVYYCARE
Salmo salar Vs748 ighv AGKD01034514.1 11424 VQGQSLTSSEPVVKRPGESVTLSCTVSGFSMGSYYMHWIRQKPGKGLEWIGLIYSGTGTIFAQSLQGQFTITKYSSKNQLHLEVKSLKHEDSAVYYCAR
Salmo salar Vs448 trbv AGKD01186102.1 2056 LSLSVEVHQTPSAVFSRPGENIQLFCHHQKTDYRVMLWYQKSQGETALKLIGYLNFNSQTIVSSYEKHFNMSGDLGGDGPKNASLNMFNLRQTQNSAVYFCAASK
Salmo salar Vs559 ighv AGKD01000183.1 28615 FQGQRLIESGPVVKKPEEPHKLTCIASGLDMNNYRMAWIRQAPGKGLEWVAAITHDSRSTYYPQSVQGRFTISRDNSMKQVYLQMNSLKTEDSAVYYCAR
Salmo salar Vs378 trav AGKD01125695.1 3251 DSMEQETITPVKPEVNALQGTDITLSCNYKGNVNNLQWYRQYPGSRPECLLWIIQSSMSVQKQSIATPRHTGRLNEEKTRVDLMISSVELEDSALYHCALQ
Salmo salar Vs674 ighv AGKD01014562.1 6768 VHGQTLTESGPVVKKPGESHKLTCTASGFTFSSYEMSWIRQAPGKGLEWIAYSYSTNTYYSQSVQGRFTISRDDSSSKLYLQMNSLKSEDTAVYYCARE
Salmo salar Vs677 igkv AGKD01015142.1 25917 SLDKISQSDVLKTFLSGDRVHLECLTSEEDGNYYNWIKIIIGQAPVLMLSLYTHSNTATFFGEFNNNTRFTAMKSGTSFVLTISDARPSDMGMYYCA
Salmo salar Vs751 trav AGKD01034754.1 4618 NSFGFSINPATTEELVQEERNVNLSCKYDGNVYNLQWYRQYPRSKPEFLLYITPEGSIFKATPPPPRLTVSIDKVEKRVDLKISYAVVTDSALYYCALT
Salmo salar Vs671 igkv AGKD01014073.1 14974 SRGQYTVTQTPTVKAVLPRQTVSLNCKTSSDVYDDDSLAWYQQKPGGAPKLLIYYATTLQSGTPSRFSGSGSGSDFTLTISAVQAEDAGDYYCQS
Salmo salar Vs461 trav AGKD01203138.1 1387 GSHGNDITPTTDKVFGLEGDVINLSCNYSSARTLQWYRQYPGSSPTFLLLITVSSTPSVVNATPPYPRLSVELNDERTRVELEISSADVTDSALYYCVLE
Salmo salar Vs673 igkv AGKD01014550.1 2971 SREQITVTQIPAVKTVLPGQTVSMNCKASIDVQTNCWSSGKPCLAWYQQKPGGTPKLLVYYSSTLFSGTPSRFSGSGSGSDFTLTISRVQAEDAADYYCQS
Salmo salar Vs672 igkv AGKD01014073.1 2907 SRGQYTVTQTPTVKAVLPGQTVSLNCKTSSNVYSNNRLAWYQQKPGGAPKLLIYLATTLQSGTPSRFSGSGSRSDFTLTISGVQAEDAGDYYCQS
Salmo salar Vs799 igkv AGKD01049710.1 3508 HARAGTEPSAIQQESGLKSANVGDTVTLQCFYEGDVAMHFSWYKQPLGEKPQVISTVYRYDEAPTFYHEFKGNPRFSVQSGQGINHLSISDINSSDSALYYCGS
Salmo salar Vs177 trav AGKD01039783.1 301 ISGTSVVTQSPPSVTVTEGDNVHIQCCWNLNMTKEKLNWLKESTQMAEDSNYKGIIVNNSQCLIEKSKQTAACNCSNMIISNITRNHSGTYICKVMI
Salmo salar Vs154 trbv AGKD01031363.1 1028 LSPTDKVHQTPTAILKGPEDKVQLTCSHTVSRYDMILWYQQSAQNTALKLIGYVRFTSPTVEDSFKGRFNVSGDGAANKMAYLHFPKLTEPEDSAVYFCAASE
Salmo salar Vs155 trbv AGKD01031363.1 5644 SSFSSQVYQSPVALYKNQGKLAKMECSHSISSYDRILWYKQSNYRELVFLGYMTAKIGFPEAGFDIEGDANAGGTSTLTINQLTPNSSAVYYCAAG
Salmo salar Vs458 ighv AGKD01197572.1 296 VHSQTLTESGPVVKKPGESHQLTCTASGFTFSSYWMAWIRQAPGKGPEWIASSHSTTTYYSQSVQGRFTISRDDSSSKLYLQMSSLKSEDTAVYYCAR
Salmo salar Vs635 ighv AGKD01007865.1 3615 ACCDEMDQSPFQVKRSRDTFKLSCQIYGFDMTGYYINWIRQKPGRSPEWIGRINSCSTDAPDYSGQFILTEDVFTSTQYIELKNLRSEDSAVYYCARQ
Salmo salar Vs794 igkv AGKD01047322.1 9703 KNHQMSDYKTVVQRPMSDPFHPGENVTLQCTVLSETCTEEHSVYWFRARSGESHPGVIYTPGNRSDEGEKSPETPSPTQSCVYSFSTKNNLSPSDAGTYYCAV
Salmo salar Vs795 trav AGKD01048267.1 3272 SSYEEEIISATTEERVFEGEGVTLSCNYTGSYSSDTLLWYQQYPRSKPEFLLLLTEGGLKTHNESTHPRLSVKLNEDKTRVDLKISSTEVTDSALYYCALK
Salmo salar Vs1088 trav AGKD01334035.1 1330 GNSFGDSINHATTEELVPEGRNVHLFCKYDGTVNNLLWYRQYPRSKPEFLLYITPEGSIFKATPPPPRLTVSIDKVEKRVDLKISYAVVTDSALYYCALT
Salmo salar Vs194 ighv AGKD01043598.1 6330 VHGQTLTESGPVVKKPGESHKLTCTASGFTFSSYEMNWIRQAKGKELEWIAHSHSTTTYYSQSLQGRFTISREDSSSKLYLQMNSLKSEDTAVYYCAR
Salmo salar Vs957 trav AGKD01115145.1 2700 DSMEQETITPVKPEVNALQGTDITLSCNYKGNVNNLQWYRHYPGSSPECLLLILPTNKYVQNTSITTPRHTGRLNEEKTRVDLMISSVELEDSALYHCALQ
Salmo salar Vs495 ighv AGKD01258304.1 3612 VQCEELTQPASMTVQPGQPLTISCKVSYSVGSYYTAWIRQPAGKGLEWIGMKYTGGTHHKDSLKNKFSLTLDSSSNTVTLTGQNLQAEDTAVYYCARD
Salmo salar Vs918 trav AGKD01087630.1 6252 GSYEQTIEPNQHEVYAEVGSNVLLSCNYSSANILLWYKQSPGSAPQYLLLIPHYTGTGQRADSLDSRISGKLNKEKTRVDLDITSAEVTDSALYYCALR
Salmo salar Vs953 trav AGKD01111005.1 1077 IVSGDSVTPDKEEYTPTEGSSVSLKCTYETKLEYILLYWYRHYPNQAPQFLLYKGARSQSESEQISDQRYTSTTSRTSTELVITRLTLADTALYHCAL
Salmo salar Vs1080 trav AGKD01266140.1 654 DSCVDGIFSISLEEDVIHGGSVKLSCNYTLSGGGSVLWYHQYPTSAPQFLLLISVYSASAETIVTADQPYPQLSVNVDKVTECVDLEISSAEVTDSALYYCTLE
Salmo salar Vs1082 igkv AGKD01277943.1 603 SRGQITVTQTPAVKTVSVGHSVSLSCKTSSAVFSNSNGHFLAWYQQKPGGAPQLLIYYAKTLQSGIPSRFSGSGTRSDFTLTIRGVQAEDAGDYYCQS
Salmo salar Vs823 trav AGKD01059690.1 7794 SSNEEEIISATTEECVFEGDGVTLSCNYTGSYSSDTLLWYQQYTRSEPEILLLLTEGGLKTHNESTHPRLSVKQNEDKTHVDLEITSTEVTDSALYYCALR
Salmo salar Vs675 ighv AGKD01014562.1 1256 IHSISLTSSPAQLKAPGDSVKLSCQISGYALTDYGTVWIRHQPGKTLEWIGIIWGGGSINCGASFKSRFTFSRDSSNVLYLDITSLQAEDTAVYYCSNAG
Salmo salar Vs850 ighv AGKD01066326.1 1965 VCCAIKLDQSLSHLKRPEDTVKLSCKTSGFTMTSFYMYWIRQEPGKALEWIGRMNSNSPDYSDSLKGQFILTEDVSTSTQFLEAKSLRSEDSAVYYCSRE
Salmo salar Vs1000 igkv AGKD01143889.1 1475 DSGKRFTKITLEQQPESDPVHPGDSVTLQCTVLSETCTGEHSVYWFRAGSGESHPGVIYTPGKRSDECEKSPETPSPTQSCVYSLSKNNLSLSDAGTYYCAV
Salmo salar Vs551 ighv AGKD01000015.1 72236 VYGQTLTESGPVVKKPGESHKLTCTASGFTFSSYYMGWIRQAKGKEFEWIGHIHGGTTYYSQSFQGRFTISRDDSSSKLYLQMNSLKSEDTAVYYCAR
Salmo salar Vs1002 igkv AGKD01144371.1 653 QLFSSMVHQRPVALTEGPGGNFQLTCSHTIPNYYVILWYKQSAGDTAMKLIGYAYTKSITMEKSFEKHFNVSGDGEKEAYLHLVSLRGPEHSAVYYCAAS
Salmo salar Vs553 ighv AGKD01000015.1 61036 VHCQVVLTQAEQSVQGTPKGSIKLTCACSGFTLSSTNMYWIRQATGKGLEWIIYYYSDSDKSNAQVVQGRFTASKDSTNFYLHMSQLKPEDSAVYYCARD
Salmo salar Vs828 igkv AGKD01061037.1 3651 NGQRSFYQTVDQQPMSDPVHPGDSVTLQCTVLSETCTGEHSVYWFRAGSGESHPGVIYTPGNRSDECEKSPETPSPTQSCVYSLSKNNFSLCDAGTYYCAV
Salmo salar Vs555 ighv AGKD01000015.1 41429 LNGQSMESIPSSPLQKKPGETLSHSCKGSGYTQCEKYGMSWIRQPAGKSLEWIGYTGKYTKSVEGRIEITRDNTICMVYLKLSVLRAEDSAVYYCARE
Salmo salar Vs556 ighv AGKD01000015.1 19881 VYGQTLTESGPVVKKPGESHQLTCTASGFTFSSYYMAWIRQAPGKGLEWVAYIGTSSSPISYSQSVQGRFTISRDDSSSKLYLQINSLKSEDTAVYYCARE
Salmo salar Vs557 ighv AGKD01000015.1 15828 VCCDIRLDQSPSQVKIPGHSVKVSCIISGYSMTSHNIHWIRQKPGKGLEWIGRMNTGSGTDVIYADSLKGQFTLTEDVSTSTQFLEAKSLSSEDSAVYYCARQ
Salmo salar Vs824 trav AGKD01059690.1 2572 MVSGDSVTPDKEKYTPTEGSSVSLSCKYETSSDYVSLYWYRHYPNQAPQFLLYKSARSRKREYIPDERYTSTTSWTSTELVITRLTLADTALYYCAL
Salmo salar Vs825 igkv AGKD01060205.1 9221 SRGQVTVTQPPVVTFSPGDPVTLTCTTNPEVRKWDSGNEGAFWYQQRPGEAPKLLIKYAKKLLDGIPARFSGSGSERDFTLTISGVQAEDAAVYYCQS
Salmo salar Vs826 trav AGKD01060479.1 2630 CRAEENVRQPTEDVLVVEGQPTTLTCLFDTADLSPNLFWYKQQTNSNPIFMLRRDKFSPGETATEFKERFDARLNFTAKSVPLTIQRVHLSDSAVYYCALR
Salmo salar Vs827 igkv AGKD01060500.1 5751 SSADIILTQSPKSQSVRLGETVSISCTASSSTGNNLQWYLQTPGDAPKLLVYFGTNRQSGIPGRFSGSGSGSSYTHYTLTISGVQAEDAGDYYCQQGASYP
Salmo salar Vs820 igkv AGKD01058301.1 4254 SSADIILTQSPKSQSVSPGKTVSISCTASSYISIYIQWYLQKPGEAPNLLVYDATNRQSGIPGRFSGSGSGSQFTLTITGVQKEDAGDYYCQQRNSFP
Salmo salar Vs822 trav AGKD01059690.1 10844 DSMEQETITPVKPEVNALQGTDITLSCNYKGNVNYLQWYHQYPGSRPECLLWILQTNKYVQNTSITTPRHTGRLNEEKTRVDLMISSVELEDSALYHCALQ
Salmo salar Vs1016 igkv AGKD01159262.1 1860 VSQKRSHYQTVEQQPVSDPVPPGDSVILQCTVLSETCTGEHSVYWFRAGSGESHPGVIYTTGNRSDECEKSPETPSPTQSCVYSLSKNNLSPSDAGTYYCAV
Salmo salar Vs419 trav AGKD01159474.1 652 HVGDTLEDDITPTSPEEYYLEGSRVKISCNYKVIADILLWYRHYSGSGLQFLYLVTTINNPYELRVDPQDIRLSVTLNKERTCVDLEISQAEVTDSALYYCALR
Salmo salar Vs685 trav AGKD01016395.1 6288 CRAEENVTQPTEDVMVVEEQPTTLTCLFDTTSQSPYLFWYKQLANGKPMLMLRRDTFGVGETATEFKDRFNARLNVTAKSVPLTIQRVHLSDSAVYYCALR
Salmo salar Vs389 trbv AGKD01135611.1 326 SCVSLSVHQSPRYLTKRPGTTLKMTCSHHDKKYDKIYWYRQIHGQKLQLIGFLSFKEAVDVEENFNISGDAEDEGFLGSLAVRIEDTGLYYCAVSK
Salmo salar Vs666 trav AGKD01013205.1 3838 SSNEEEIISATTEECVFEGEGVTLSCNYTGSYSTDTLLWYQQYPRSKPEFLLLITEGGLKTHNESTHPRLSVKLNEDKTHVDLEISSAEVSDSALYYCALR
Salmo salar Vs451 trav AGKD01186767.1 2998 CTADHVQQQPGCVIATEGGLVTLSCQYNTTGANNIEYLYWYKQEANYFPKYMLRRYSIGSGGNAAGFKERFNASLKAKKQSVPLTIQRLHLSDSALYYCALE
Salmo salar Vs665 trav AGKD01013205.1 4979 DSMEQETITPVKPEVNALQGTDITLSCNYKGNVNNLQWYCQYPGSRPECLLLIQQSSMYVQNTSITTPRHTGRLNEEKTRVDLMISSVELEDSALYHCTLQ
Salmo salar Vs415 ighv AGKD01155840.1 1746 VQSQTLTESESVVKTFEESHKLTCTYSGFGCYYWNAWIRQASGKGLEWVATISDSSRYIYYSQSIQGRFTISRDNSKQQVYLQMNSLKTEDSAVYYCAR
Salmo salar Vs417 ighv AGKD01158275.1 1029 VFCQTELTQPGSMILQPGQPLTLSCKVSGYSLTSSSYCTGWVRQHAGKALEWVGYICSGGNIYYSDKLKNKFSISRDTSSNTVFLKGQSLQTEDTAVYYCARY
Salmo salar Vs522 ighv AGKD01454883.1 2416 ACCDEMDQSPFQVKRSRDTFKLSCQIYGFDMTGYYINWIRQKPGRSPEWIGRINSCSTDAPDYSGQFILTEDVFTSTQYIELKNLRSEDSAVYYCARQ
Salmo salar Vs129 ighv AGKD01024276.1 13685 WRSFPPVQSRKSLEKLSVCPVRYLDIPLPATTHWIRQPAGKSLEWMGFSGLGLGYHAKKFEGRMETTKDTSNSMLTLMLSGVRAEDSAVYYCAR
Salmo salar Vs987 ighv AGKD01135754.1 2221 VHCGLEFTQPSSLDVKPGESLSITCKVSGYSLTDSTNLHGIGWIRHPTGKALEWIWTIYYDGSSNSQSSLKDRFSFTRDTSSNTVFLKGQSLQTEDTAVYYCARW
Salmo salar Vs952 trav AGKD01111005.1 3013 SSNEEEIISATTEECVFEGDGITLSCNYTGYYTTDTLLWYKQYPRSKPEFLLLLTEGGLKTHNESTHPRLSVKLNEDKTHVDLEISSTEVTDSALYYCALR
Salmo salar Vs327 trav AGKD01100199.1 1322 DSMEQETITPVKPEVNALQGTDITLSCNYKGYVNNLQWYRHYPGSRPECLLWILQSSMSVQNTSITTPRHTGRLNEEKTRVDLMISSVELEDSALYHCALQ
Salmo salar Vs328 trav AGKD01100199.1 2022 ISFGDSINPVTTEELVQEGRNVHLSCKYDGTVYTLQWYSQYPRSKPEFLLYITPEGLIITATPPPPRLTVSLDKVDKRVNLKISSADVTDSARYFCAMK
Salmo salar Vs545 trav AGKD01511535.1 938 CRAEENVRQPTEDVLVVEGQPTTLTCLFDTADLSPNLFWYKQQTNSNPIFMLRRDKFSPGETATEFKERFDARLNFTAKSVPLTIQRVHLSDSAVYYCALR
Salmo salar Vs127 trav AGKD01024000.1 17968 CTGDHVQQQPGGVIATEGGLVTLSCQYNTSANNNNAYLFWYKQEENDFPKHMLTRFSFGSGDNAGGFKERFNASLNAKTQSVPLTIQRLQLSDSAVYYCALR
Salmo salar Vs921 igkv AGKD01088572.1 14039 SWGQYVLTQSAAQSVQPGQTVSIDCSASSTVTQYSGSRYYLAWYHQTFGEAPKLLIYFTSDRFTGVSTRFSGSGRGNGVDFTLTISKFQAEDTGVYYCQS
Salmo salar Vs411 ighv AGKD01153908.1 3419 VQSQTLTESESVVKTFEESHKLTCTYSGFGGNYWNAWIRQAPGKGLEWVATISDSSSNIYYSQSVQGWFTISRDNSKQQVYLQMNSLKTEDSAVYYCAR
Salmo salar Vs1036 trbv AGKD01182757.1 1294 SSLNSQVHQRPAALYKNQGESAKMECSHSISGYNYVLWYKQSNYRELVFLGYMQLKTGFPEAGFAIEGDANAGGTSTLTINQLTPNSSAVYYCAAS
Salmo salar Vs924 trav AGKD01090212.1 3849 DSNGQIIEPIREEVNAPAGSNITLSCTYSSAVSLQWYLQDPGSPPQYILHGVGSPSRAPGLDPRLSVKLNDEKNRVDLEISSAKEKDSAMYYCALT
Salmo salar Vs82 ighv AGKD01011361.1 15747 VHCQVVLTQAEQSVQGTPGGSLKLTCACSGITLSNTNMHWIRQAPGKGLEWIIYYYSDTNKSNAQVVQGRFTASKDSSNFYLHMSQLKSEDSAVYYCARD
Salmo salar Vs72 ighv AGKD01009425.1 9690 VHGQTLTESGPVVKKPGESHKLTCTASGFTFSIYYMAWIRQAPGKGLELVAYIGTSSSPISYSQSVQGRFTISRDDSSSKLYLQMNSLKSEDTAVYYCARE
Salmo salar Vs73 igkv AGKD01009436.1 5276 SRGQVTVTQTPAAKVVLQGQTVVINCKTSSNVVDACAGDYTCMAWYQQKPGGAPTLLMHSSNRLQSGIPSRFSGSGSHKDFTLTISGVQAEDAGDYYCQS
Salmo salar Vs733 ighv AGKD01030067.1 13369 VHCQVVLTQAEQSVQGTPAGSLKLTCACSGITLSSIYMNWIRQAPGKGLEWIMFYYSDSSKSNAPVVQGRFTASKDSTNFYLHMSQLNPEDSAVYYCARD
Salmo salar Vs1033 trav AGKD01180773.1 728 SSNEEEIISATTEECVFEGEGVTLSCNYTGSYTTDTLLWYQQYPRSKPEFLLLLTEGGLKTHNESTHPRLSVKLNEDKTHVDLEISSTEVTDSALYYCALR
Salmo salar Vs851 igkv AGKD01066327.1 6470 SRGQVTVTQTPAVKDVSVGHSVSLSCKTSSAVYSNSNGHLLAWYQQTPAGAPKLLIYSAKTLQSGTPSRFSGSGSGSDFTLIISGVQAEDAGDYYCQS
Salmo salar Vs741 trdv AGKD01031742.1 9933 MVSGDSVTPDKEEYTPTEGSSVSLSCTYETSSNDIYLYWYRHYSNQAPQFLLYKGARSKSDREYIPDERYTSTTSWTSTELVITSLTLADTALYYCAL
Salmo salar Vs855 trav AGKD01069473.1 6154 HVGDTLEDDITPTSPEEYYLEGSRVKISCNYKVIADILLWYRHYSGSGLQFLYLVTTINNPYELRVDPQDIRLSVTLNKERTCVDLEISQAEVTDSALYYCALR
Salmo salar Vs1012 trav AGKD01153422.1 4862 DTYEQNIEPNQHEVYAEVGSIVLLSCNYSSADNLLWYKQSPGSAPQYLLLILDSTGTEHRDDSLDSRFSGKLNNEKTRLDLEISSAKVTDSALYYCALT
Salmo salar Vs856 trdv AGKD01069473.1 2824 QIAGDHINPVNNEVISTEGELVTLSCSYDTSSENIWLNWYRHYPHQAPEFLLYKGARSQSGSEYIPDKRYKSTTSSTSTELVITSLTLADTALYYCAL
Salmo salar Vs583 igkv AGKD01001649.1 457 QSLSSKVHQTPTAILKGSKDNVQLTCNHTIQNYYVILWYQQSTGDTAMNLIGYAYTTSITMEKSFEKHFNVSGDGRKEAYLHLLSLRAPEDSAVYYCAAS
Salmo salar Vs109 trav AGKD01019325.1 4822 LVGDTLEDDITPTSPEEYYLVGSRVKISCNYTVKVNNLQWNRQYPGSAPKFLLLLTDTATPLVVEATPPYPRMTAKLNDERTRVDLEISSAVVTDSALYYCVLE
Salmo salar Vs582 trbv AGKD01001649.1 7671 LSQIDKVQQTPTAILKGPEDNVQLNCSHTIPNYDTILWYQQSAQNTALKLIGYVRFTSPTVEDSFKERFTVSGDAATGKMAYLHVPKLRGTEDSAVYFCAASK
Salmo salar Vs394 ighv AGKD01139739.1 4061 LNGQSMESIPSGPVLKKPGDTLSLSCKGSSFTFSNHGMHWIRQPAGKALDWMGIIYYASKTIYLQNIEGRIEVTRDNSKGMVNLKLSGLRAEDSAVYYCAR
Salmo salar Vs962 ighv AGKD01118349.1 846 VQSQTLTESGPVVKKPLEAHKLTCTASSLDINGYWMAWIKQAPGKGLEFVAAHYDSSSIAYSQSVQGRFTISRDNSKKQVYLQMNSLKTEDSAVYYCAR
Salmo salar Vs681 trav AGKD01016257.1 13233 CRAEENVRQPTEDVLVVEGQPTTLTCLFDTADLSPNLFWYKQQTNSNPIFMLRRDKFSPGETATEFKERFDARLNFTAKSVPLTIQRVHLSDSAVYYCALR
Salmo salar Vs234 igkv AGKD01058301.1 8814 SSADIILTQSPKSQSVRPGKTVSISCTASSSISNYLSWYLQKPGEAPKLLVYRATNRQSGIPGRFSGSGSGSQFTLTISGVQEEDAGDYYCQQGASFP
Salmo salar Vs838 igkv AGKD01062449.1 8936 SSADIILTQSPKSQSVHPGETVSISCTASSSTGNVLSWYLQKPGEAPNLLVYYAKNRQSGIPGRFNGGGSGTQFTLTITGVQAEDAGDYYCQQGYSYP
Salmo salar Vs338 trav AGKD01105928.1 6599 LTPVIAVSLPPSVVVHPGDNVTLQCTNVLKVPGHIAWFKQVNISEPLCIASMYSSQPYAQHHNGFQPSHVEMLFGNRILFLKITEVDVADSGLYFCGMYNHYFI
Salmo salar Vs339 trdv AGKD01106377.1 3967 MVSGDSVTPDKEKYTPTEGSSVSLKCKYETKREYISLYWYRHYPNQAPQFLLYKSARSKSESEQIPDQRYTSTTSRTSTELVITRLTLADTALYHCAL
Salmo salar Vs132 igkv AGKD01025202.1 16233 TRGQVTVTQTAAVKTVSVGHSVSLSCKTSSAVYSKSNGHILAWYQQKPGGAPKLLIYYATTLPSGSPSTFSGTGSGSDFTLTISGVQAEDAGDYYCQS
Salmo salar Vs133 iglv AGKD01025255.1 8843 VSGVTVVTQKTPVVTVRKGEMATMDCNLGTVENSAARWYKQVPGGVPQYMLRWYHTGWSSVEYGSGFSSPKFTSNHQSKSDYRLIINTVEETDSAVYYCQ
Salmo salar Vs336 trbv AGKD01105141.1 13088 LSQTDKVHQTPTAILKGPEDKVQLTCSHTDSRYDMILWYQQSAQNTALKLIGYVRFTSPTVEDSFKGRFNVSGDGAASKMAYLHCPKLTEAEDSAVYFCAASK
Salmo salar Vs131 igkv AGKD01025202.1 11857 SRGQVTVTQTPAVKSVSVGHSVSLSCKTSSAVYSNSNGHYLHWYQQKPGGAPELLIYWAKTLQSGTPSRFSGSGTGSDFTLTISGVQAEDAGDYYCQS
Salmo salar Vs567 trav AGKD01000910.1 16230 CRGEEAVDQQSGHVTALEGGLVTLSCNYTITSSPSPDLFWYIQLTRNSPQYVLRRDHYSEGSNSDEFKKRFDSRLNFTSSSVPLTIQRLQLSDSAVYYCALR
Salmo salar Vs1038 ighv AGKD01184115.1 1315 LNGQSMESIPSGPVLKKPGDTLSLSCKGSSFTFSSHGMHWIRQPAGKALEWIGAIWRDASGTACSKSVEGHIEVTKDNSNSMTHLKLSGLRAEDSAVYYCVY
Salmo salar Vs69 trav AGKD01008973.1 18238 CRGDRVLQAKGVETAPEGGQITLVCHYETDDPSPYLFWYKQRANDFPKYMIMWQKCGIGDNDTEFKERFHADLDANSKSVPLTIQRVQLSDSAVYYCALR
Salmo salar Vs68 igkv AGKD01008963.1 9532 SRGQITVTQTPAVKAVLPGQSVSLNCKTSSNVHRNDHLAWYQQKPGGASKLLIYYATKLQSGTPSRFSGSGSESDFTLTISEVQAEDAGDYYCQS
Salmo salar Vs936 igkv AGKD01100755.1 1885 SAADIILTQSPKSQSVSPGKTVSISCTASSSTADYLHWYLQKPGEAPKLLVYYATNRQSGIPGRFSGSGSGSSYTHYTLTISGVQAEDAGDYYCQQSNSYP
Salmo salar Vs67 igkv AGKD01008963.1 7195 SRGQYTLTQTPAVLPGQMVSLGCKTSSDPYGNCGGSGKQCLAWYQQKSGAAPKLLIYSTSTLQSGTPSKFSGSGSGSDFTLTISGVQAEDAGDYYCQS
Salmo salar Vs692 ighv AGKD01017194.1 4338 VQCEELTQPASMTVQPGQPLTISCKVSYSVGSYYTAWIRQPAGKGLEWIGMKYTGGTHHKDSLKNKFSLTLDSSSNTVTLTGQNLQAEDTAVYYCARD
Salmo salar Vs436 trav AGKD01172558.1 1764 CGGEEAVEQQSGHVTALEGGLVTLSCNYTSSTTSPYLFWYIQLTRDTPQYVLRRDRYSEGINSDEFKKRFDARLNFTYSSVPLTIQRLQLSDSAVYYCALK
Salmo salar Vs728 trav AGKD01029050.1 5248 DTYEQTIEPNQHEVYAEVGSNILLSCNYSSANSLLWYKQSPGSAPQYLLLILHSAGIEQRADSLDSRISGILNKEKTRVDLDITSAEETDSALYYCALR
Salmo salar Vs727 igkv AGKD01028585.1 4898 QSLSSKVHQTPIAVLKGSKDNVQLTCNHTIQSYYVILWYQQSTGDTAVNLIGYAQYKSITMEKSFEKHFSVSGDGSKEAYLHLLSLRAPEDSAVYYCAAS
Salmo salar Vs840 igkv AGKD01063542.1 3885 SRGQYTVTQTPTVKAVLPGQTVSLNCKTSSNVYSNNRLAWYQQKPGGAPELLIYRATTLQSGTPSRFSGSGSGSDFTLTISGVQAEDAGDYYCQS
Salmo salar Vs841 trav AGKD01063932.1 1731 THTSIITQTPGSVMVKAGDTVTLKCYLVELITYCYLVIWMKVDPRTGTLIKIDNLKIDNDSEEGKGKQDKLCSATIAKATVSDSGMYYCSAVQSEM
Salmo salar Vs648 ighv AGKD01009425.1 2205 VHCQVVLTQAEQSVQGTPKGSIKLTCACSGFTLSSTNMYWIRQATGKGLEWIIYYYSDSDKSNAQVVQGRFTASKDSTNFYLHMSQLKPEDSAVYYCARD
Salmo salar Vs439 trgv AGKD01175678.1 1895 QQLQQDQILKTRKEKQSVSFSCKVTGWCLGNLVHWYQKGEGEPFSRILYNDLNANSFTRDNAHPQTADFSAVGKSDSSELKIQSVKVSHSATYYCACWDSS
Salmo salar Vs247 trgv AGKD01063862.1 8384 SVAGQKLDNKMTLIRKQGQTVIFSCQNIDQNCNYVYWYQKKEGESFILILRIQNGYCTVYSDYNHPQKDEFSAVRQSKTCNLKIQLVKVSHSATYYCACY
Salmo salar Vs213 trav AGKD01050984.1 1152 VTQCNNVPRHFQVQRVQIGDQVILYCVFSKQVYNEGNMFWFKQVTGEIPHVVAKMQKNQSRPELHKEFRNLHLSIEKAQADGIYCLTIQKMEPMDEAIYYCAY
Salmo salar Vs225 igkv AGKD01055134.1 917 SSGDIILTQSPKSQSVRPGETVSISCTASSSTYNNLQWYLQKPGEAPKLLVYSTTNRQSGIPGRFSGSGSGSSYTQFTLTISGVQAEDAGDYYCQQGY
Salmo salar Vs52 trav AGKD01007135.1 11940 CRAEENVIQPTEDVMVVEGQPTTLTCLFDTTDLSPYLFWYKQQANGNPMFMLREDKFGAGETATEFKERFHARLNVTAKSVPLTIQKVQLSDSAVYYCALR
Salmo salar Vs50 trav AGKD01007135.1 2740 CRGEEAVDQQSGHVTALEGGLVTISCNYTTSSASPDLFWYIQLTRNSPQYVLRRDRYSEGSNSDEFKKRFDSRLNFTSSSVPLTIQRLHLSDSAVYYCALK
Salmo salar Vs51 trav AGKD01007135.1 10015 CRGADGVTQSKREVTAYEGEDVSLNCEYNTSLSAPSLFWYIQSTNDYPEYVLRKDVIGPGDIDDRFKGRFDAHLNSITKSVPLTIQRVQLSDSAVYYCALK
Salmo salar Vs340 igkv AGKD01106537.1 2240 SQSNSKTMEQQAKSDPVHPGDSVTLQCTVLSETCTGEHSVYWSRAGSGESHPGVIYTHGNRSDECKKSPETPSPTQSCVYSLSKNNLSLSDAGTYYCAV
Salmo salar Vs344 ighv AGKD01107961.1 20 VCCDIRLDQSPSQVKIPGHSVKVSCIISGYSMTSHNIHWIRQKPGKALEWIGRMNTGSGTDVIYADSLKGQFTLTEDVSTSTQFLEAKSLSSEDSAIYYCARQ
Salmo salar Vs58 ighv AGKD01008093.1 1732 VQGQTLTESGPVVKKPQESHKLTCTASDLDMNSYWMAWIRQAPGKGLEWVATITHDSRSTLYSQSVQGQFTISRDNSKRQVYLQMNSLKTEDSAVYYCARDRV
Salmo salar Vs876 trbv AGKD01075361.1 1145 LSLSVEVHQTPSEVFSRPGENVQLFCHHNKSDYRVILWYQKLQGEIELKLIGYLYYQNPTIESSYGKHFNMSGDLGGDRPKNVSLNIFNFQHPEHSAMYFCAASD
Salmo salar Vs875 trbv AGKD01075361.1 2010 VSLSKVVYQSPSTLLVEPNASVSVPLSCSHKIPSYNTILWYQRPVGDTALKLIAYVYITSQTVEPSYKGYFDVKGDGRNEAFLHLLKLRQAEDSGEYFCAASY
Salmo salar Vs873 igkv AGKD01074592.1 4489 SGSKNMTLLQQSVSESVQPGDSVTLNCTIHTETCAGEHSIYWFRHGESRPGILYTHVDQRDQCEKSPETGSPTKRFVDNPPKRNLSLSDAESYYCAVASCGE
Salmo salar Vs872 igkv AGKD01074405.1 4824 SRGQITVTQTPAVKAVVPGHTVSLNCKTSSNVYSNCYNGQSWGHQCLSWYQQKPGEKPKLMMLPGNKLHSGTPSRFSGSGSGSDFTLTISGVQAEDAGDYYCQS
Salmo salar Vs906 trbv AGKD01084336.1 1925 VSLSKVVYQSPSTLLVKPNAPVSVPLSCSHKIPSYNTILWYQRPVGDTALKLIAYVYYTSQTVEPPYKGYFDVKGDGRNEAFLHLLKLRQAEDSGEYFCAASY
Salmo salar Vs905 igkv AGKD01083993.1 3775 STGQYIVTQTPAVKAVLPGQKVTIDCKTSSNVHGNIYLAWYQQKPGGTPKLLIYYAKTLQSGTPSRFSGSGTHSDFTLTISGVQAEDAGDYYCQS
Salmo salar Vs903 trav AGKD01083776.1 3930 EDSVIQQPGDVIATEGQQVALDCQFDTVDTNPYLFWYKQEANDFPKFMLKRATFGSDNAIEFQGRFDAHLNLTTFKSASKSVPLLIQRLQLSDSAVYYCALR
Salmo salar Vs420 trdv AGKD01159474.1 3241 QIAGDHINSVNNEVISTEGELVTLSCSYDTSSENIWLNWYRHYPHQAPEFLLYKGAKSQSGSEYIPDKRYKSTTSSTSTELVITSLTLADTALYYCAL
Salmo salar Vs739 igkv AGKD01031600.1 11080 NGQRSDYQTVEQQPESDLVHPGDSVILQCTVLSETCTGEHSVYWFIAGSGESHSGVIYTPGNRSDECEKSPETPSPTQSCVYSLSKNNLSLCDAGTYYCAV
Salmo salar Vs633 ighv AGKD01007865.1 15144 VCCDIRLDQSPSQVKIPGHSVKVSCIISGYSMTSNNIHWIRQKPGKGLEWIGRMYTGSGTDVIYADSLKGQFTLTEDVSTSTQFLEAKSLISEDSAVYYCAR
Salmo salar Vs632 ighv AGKD01007691.1 8759 CSGQILESIPSSPVQKNPGETLSLSCKISGYTVTSYHTHWIRQPAGKSLERMGYSGIGLGYHAKKFEGCMETTKDTSNRMMTLMLSGLRAEDSAVYYCARQ
Salmo salar Vs424 igkv AGKD01162599.1 3597 KNHQRSHYHTVVQRPVSDPVHPGDSVTLQCTVLSETCTGEHSVYWFRAGSGESHPGVIYTSGNRSDECQKNPETPSPTQSCVYSFSKNNLSLSDAGTYYCAV
Salmo salar Vs634 ighv AGKD01007865.1 8999 VCCNEMDQSPSQVKRPGDTFKLSCKISGFDMTSYYIHWIRQKPGKALEWIGGIDSGSTDAPDYSESLKGQFILTEDVSTSTQFLEAKSLSSEDSAVYYCARQ
Salmo salar Vs637 igkv AGKD01007975.1 12576 HNHPTLVQQPVSDPVHPGDSVILQCTVLFETCTGEHSVYWFRAGSGESHPGVIYTPGNRSDECKKNPETPSPTQSCVYRLSKNNLSLADAGTYYCAV
Salmo salar Vs636 igkv AGKD01007898.1 1253 QLFSSMVHQRPVALTEGPGGNVPLTCSHTIPNYYMILWYKQSAGDTAMKLIGYAYTKSITMEKSFEKHFNVSGDGEKEAYLHLVSLRGPEHSAVYYCVAS
Salmo salar Vs1071 trdv AGKD01240450.1 5014 MVSGDSVTPDKEEYTPTEGSSVSLICTYETSSVYILLYWYRHYSNQAPQFLLYKGARSQSDSEYIPDERYTSTTSWTSTELVITSLTLADTALYYCALRDY
Salmo salar Vs429 igkv AGKD01165474.1 3757 SRGQVTVTQPPVVTFSPGDPVTLTCTTNPKVYKWDSGYEGAFWYQQRPGEAPKLLIKYVKTRLDGIPARFSGSGSERDFTLTISGVQAEDAAVYYCQS
Salmo salar Vs581 igkv AGKD01001649.1 12686 QSLSSKVHQTPIAVLKGSKDNVQLTCNHTIQSYNVILWYQQSTGDTAMNLIGYAYYKSITMEKSFEKHFNVSGDGSKEAYLHLLSVRAPEDSAVYYCAAS
Salmo salar Vs580 igkv AGKD01001649.1 17132 QSLSSKVHQTPTAILKGSKDNVQLTCNHTIQGYTMILWYQQSTGDTAVNLIGYAYTTSITMEKSFEKHFSVSGDGSKEAYLHLLSLRAPEDSAVYYCAAS
Salmo salar Vs586 ighv AGKD01002001.1 18205 LNGQSLESIPSSPVLKKPGETLSLSCKISGYTFDSHHTHWIRQPAGKSLEWMGYSGLGLGYHAKRFEGRMETTKATSNSMLTLKLSGLRAEDSAVYYCARQ
Salmo salar Vs585 ighv AGKD01002001.1 26858 VQGQTLTESGPVVKKPGESHKLTCTASDLDVNSYWMAWIRQAPGKGLEWVSDIRKDGGSTYYSQSVQGQFTISRDNSKQQVYLQMNSLKTEDSAVYYCARDS
Salmo salar Vs988 ighv AGKD01135754.1 1304 VQGQSLTSSEPVVKRPGESVTLSCTVSGFSMGSYYMHWIRQKPGKGLEWIGLIYSGTGTIFAQSLQGQFTITKYSSKNQLHLEVKSLKHEDSAVYYCAR
Salmo salar Vs1062 ighv AGKD01223468.1 1982 VCCDIRLDQSPSQVKIPGHSVKVSCIISGYSMTSHNIHWIRQKPGKGLEWIGRMNTGSGTDVIYADSLKGQFTLTEDVSTSTQFLEAKSLSSEDSAIYYCARQ
Salmo salar Vs505 trav AGKD01319570.1 265 CRGEDSVIQPSGDVIATEGEQVTLGCQFDAVNMKGLYLFWYKHEVNGFPEFMLGRFPFGSKNATEFKDRFDAHLDADSKSVPLKIQRLQPSDSAVYYCALR
Salmo salar Vs1113 ighv AGKD01458409.1 1764 WRSFPPVQSRKSLEKLSVCPVRYLDIPLPATTHWIRQPAGKSLEWMGFSGLGLGYHAKKFEGRMETTKDTSNSMLTLMLSGVRAEDSAVYYCAR
Salmo salar Vs1060 trav AGKD01219841.1 808 QIAGEHITHVKHEVISTEGKPVTLSCSYDACSEYLRLYWYKHYPNQAPQFLLYKGARSWRSEHITDKRYKSTTSWTSTELVITSLTLADTALYYCALRDD
Salmo salar Vs898 ighv AGKD01081947.1 6597 VQSQTLTESGPGVKKPGESHKLICTASGLDINGYWMGWIRQAPGKGLEWIAAITGSDGGSTYYPQSVQGRFTISRDNSKQQVYLQMNSLKTEDSAVYYCAK
Salmo salar Vs55 ighv AGKD01007691.1 4515 VHCQVVLTQAEQSVQGTLKGFLKLTCACSGFTLSSSYMHWIRQAPGKGLEWIIYYYSDTDKSNAQVVQGRFTASKDSSNFYLHMSQLKSEDSAVYYCARD
Salmo salar Vs489 trbv AGKD01242961.1 907 LGLGTRVVQTPAALVTTPGDSADLRCSHTIKDYDVILWYRQSHSQDRQLQLLGYLYTDNKNPESSFKDKIKLRGNAEQYCDLSVSNLTQEDSAVYFCAAR
Salmo salar Vs801 ighv AGKD01050123.1 2105 VQGQTLTESGPVVKKPQESHKLTCTASGFTFSSYWMAWIRQAPGKGLEWVSYISSDGGSTYYPQSVQGRFTISRDNSKQQVYLQMNSLKTEDSAVYYCAR
Salmo salar Vs39 trav AGKD01005401.1 3431 CRGDRVLQTKGVETATEGGQITLACHYETDYPSPYLFWYKQGTNDYPKYILMRPKFGTGDNAADFKERFHADLDANSKSVPLTIQRVQLSDSAVYYCALK
Salmo salar Vs569 trav AGKD01000910.1 14449 CTGDHVQQQPGGVIATEGGLVTLSCQYNTTSANNVAYLYWYKQEANSFPKHMLNRYSIGSGDNAAGFKERFNASLNAKTQSVPLMIQRVHLSDSAVYYCALK
Salmo salar Vs599 trav AGKD01003923.1 28699 LTPVILVSPPPSVVVHPGDNVTLQCTDVLKGPGHVAWFKQVNVSEPLCIASMYSSQLYVKHHNGFQPSHMEMFINNTIIFLKITEVDVADSGLYFCGMYDQYFI
Salmo salar Vs14 igkv AGKD01001636.1 12556 SRGQYTVTQTPTVKAVLPGQTVSLNCKTSSNVYSNNRLAWYQQKPGGAPKLLIYYATTLQSGTPSRFSGSGSRSDFTLTISGVQAEDAGDYYCQS
Salmo salar Vs15 iglv AGKD01001652.1 2737 VSGVTVVTQKPPVVTVRKGETATMDCNLGTVNNIARWYKQVPGGVPQYMLRWYHTGWRSVEYGSGFSSPKFTSNHQSKSDYRLIINTVEETDSAVYYCQ
Salmo salar Vs1126 ighv AGKD01525573.1 716 VHFQVVLTQAEQSVQGTPAGSLKLTCACSGITLSSIYMNWIRQAPGKGLEWIMFYYSDSSKSNAPVVQGRFTASKDSTNFYLHMSQLNPEDSAVYYCARD
Salmo salar Vs126 trav AGKD01024000.1 16983 CRAEENVRQPTEDVMVVEGQPTKLSCTFDTTDLSPYLFWYKQPPNGNPLLMQRKDTFGVKETVNEFKGRFHARLNVTAKSFPMSIQRVRLSDSAVYYCALR
Salmo salar Vs726 trgv AGKD01028506.1 7040 SVSGQKLDQDISWTRKKGEVVSFSCKDYDRCKTFLLWFQKKEGETFTYILAIFKDDCTIFDNIEFPQKDDFSAMRKKNNCDLKIQSVKVSHSATYYCACWVSG
Salmo salar Vs438 ighv AGKD01174695.1 245 VQGQSLTSSEPLVKSPGESVTLYCTVSGLPLSWLHWIRQKPGKGLEWIGRIDSGTGTIFSQSLQGQFTITKDNSKKQLYLEVKSLKTEDSAVYYCAR
Salmo salar Vs508 trbv AGKD01342917.1 319 STSGVNFIQHPANLLSIEGESGTLECEHDDAEFYRMFWYKQNTNGNMELVAYSMGTRATDIEPIFDKANYNMIHDEQLKSSLQIKNVKSVDSAVYYCAASS
Salmo salar V24 trav AGKD04000199.1 649156 CTADHVQQQPGCVIATEGGLVTLSCQYNTTGANNIEYLYWYKQEANYFPKYMLRRYSIGSGGNAAGFKERFNASLKAKKQSVPLTIQRLHLSDSALYYCALE
Salmo salar V23 trav AGKD04000199.1 639562 SVIQQPGDVIATEGQQVALDCQFDTVDTNPYLFWYKQEANDFPKFMLKRATFGSDNAIEFQGRFDAHLNLTTFKSASKSVPLLIQRLQLSDSAVYYCALR
Salmo salar V22 trdv AGKD04000199.1 632577 MISGDSVTPDKEKYTPTEGSSVSLSCKYETSSDYVSLYWYRHYPNQAPQFLLYQSARSRRREYIPDERYTSTTSWTSTELVITRLTLADTALYYCAL
Salmo salar V21 trav AGKD04000199.1 608861 CTGDHVQQQPGGVIATEGGLVTLSCQYNTTSANNVAYLYWYKQEANSFPKHMLNRYSIGSGDNAAGFKERFNASLNAKTQSVPLMIQRVHLSDSAVYYCALK
Salmo salar V20 trav AGKD04000199.1 607892 DSVIQPPGDVIATEEGQVTLDCQFDAVNTNDLYLFWYKHEVNDFPKFMLGRFSFGSTNATGYEERFDAHLDKDSKSVPLTIQRLQLSDSAVYYCALR
Salmo salar V19 trav AGKD04000199.1 595258 LSCEQVLTPYTDVEVASERERVTLSCNYSSGVTLQWYRQYPQSAPQLLVMEHMLAKTPGFTLNLDKKAKRMDLEISSAEVTDSALYYCALE
Salmo salar V18 trav AGKD04000199.1 593716 GSHGNDITPTTDKVFGLEGDVINLSCNYSSARTLQWYRQYPGSSPTFLLLITVSSTPSVVNATPPYPRLSVELNDERTRVELEISSAVVTDSALYYCVLE
Salmo salar V17 trav AGKD04000199.1 584909 CRAEENVRQPTEDVLVVEGQPTTLTCLFDTADLSPNLFWYKQQTNSNPIFMLRRDKFSPGETATEFKERFDARLNFTAKSVPLTIQRVHLSDSAVYYCALR
Salmo salar V16 trav AGKD04000199.1 575133 CGGEEAVEQQSGHVTALEGGLVTLSCNYTSSTTSPYLFWYIQLTRDTPQYVLRRDRYSEGINSDEFKKRFDARLNFTYSSVPLTIQRLQLSDSAVYYCALK
Salmo salar V15 trdv AGKD04000199.1 544355 ISFGDSINPVTTEELVQEGRNVHLSCKYDGTVYTLQWYSQYPRSKPEFLLYITPEGLIITATPPPPRLTVSLDKVDKRVNLKISSADVTDSARYFCAMK
Salmo salar V14 trav AGKD04000199.1 543655 DSMEQETITPVKPEVNALQGTDITLSCNYKGYVNNLQWYRHYPGSRPECLLWILQSSMSVQNTSITTPRHTGRLNEEKTRVDLMISSVELEDSALYHCALQ
Salmo salar V13 trav AGKD04000199.1 433515 CRGDRVLQTKGVETATEGGQITLACHYETDDPSPYLFWYKQGTNDFPKYILMRPKFGTGDNAADFKERFHADLDANSKSVPLTIQKLQLSDSAVYYCALR
Salmo salar V12 trav AGKD04000199.1 432822 CRGEDSVIQPSGDVIATEGEQVTLGCQFDAVNMKGLYLFWYKHEVNGFPEFMLGRFPFGSKNATEFKDRFDAHLDADSKSVPLKIQRLQPSDSAVYYCALR
Salmo salar V11 trav AGKD04000199.1 396918 CRGDRVLQPKGVETATEGGQITLVCLYETDDSSPYLFWYKQGTNDYPKSILMRFKFGTVDNATDFKERFHADLDANSKSVPLTIQRVQLSDSAVYYCALK
Salmo salar V10 trav AGKD04000199.1 362648 EDTVIQPSGDVIATEGEQVTLDCQFDADDTRNLNLFWYKHELNGFPKFMLGRFPFGSKNATEFKDRFDAHLDADSKSVPLKIQRVQLSDSAVYYCALR
Salmo salar V9 trav AGKD04000199.1 357386 CRGEDSVTQPPGDVIATEGEQVTLDCQFDSLDTSPYLFWYKQGANDFPKYMLRRATFGSDNAIEFQRRFDAHLNLTTFKSASKSVPLTIQRLQLSDSAVYYCALK
Salmo salar V8 trav AGKD04000199.1 332824 CKGEEAVDQQSGHVTALEGGLVTLSCNYTTTSSTSLDLFWYIQLTRDSPRYVLRRDRYSEGSNSDEFKKRFDSRLNFTSSSVPLTIQRLQLSDSAVYYCALR
Salmo salar V7 trav AGKD04000199.1 314989 CRGEDSVTQPPGDVIATEGEQVTLGCQFDTLDTSPYLFWYKQGANDFPKYMLRRVTFGSDNVIEFQRRFDAHLNLTTFKSVPLTIQRLQLSDSAVYYCALR
Salmo salar V6 trav AGKD04000199.1 314269 CKGEEAVDQQSGHVTALEGGLVTLSCNYTTSSPSLDLFWYIQLTSNSPQYVLRRDRYSEGSNSDEFKKRFDSRLNFTSSSVPLTIQRLQLSDSAVYYCALR
Salmo salar V5 igkv AGKD04000097.1 4742026 DQQPMSDPVHPGDSVTLQCTVLSETCTGEHSVYWFRAGSGESHPGVIYTPGNRSDECEKSPETPSPTQSCVYSLSKNNFSPSDAGTYYCAV
Salmo salar V4 ighv AGKD04714290.1 220 VKTFEESHKLTCTYSGFGCYYWNAWIRQASGKGLEWVATISDSSRYIYYSQSIQGRFTISRDNSKQQVYLQMNSLKTEDSAVYYCARDTV
Salmo salar V3 trgv AGKD04678137.1 255 LEKSGETLNLPCRGTGYTFITYGMNCIHQPTGKPLEWMGWININTGAAGYAKSLERRIKLTKDRSVSMTHLKLSGLKSEDSAVYYCARW
Salmo salar V2 trav AGKD04655775.1 116 TVIQPPGDVIPTEGEQVTLGCQFDTVDRNPYLFWYKQRANDFPKFMLKRVTFGSDNAIEFQRRFDAHLNLTTFKSESKSVPLTIQRLQLSDSAVYYCALR
Salmo salar V1 trav AGKD04604378.1 325 CRGEDSVTQPPGDVIATEGEQVTLGCQFDTLDTSPYLFWYKQGANDFPKYMLRRVTFGSDNVIEFQRRFDAHLNLTTFKSVPLTIQRLQLSDSAVYYCALR
Salmo salar V62 trav AGKD04002795.1 27488 TRVVQTPAALVTTPGDSADLRCSHTIKDYDVILWYRQSHSQDRQLQLLGYLYTDNKNPESSFKDKIKLRGNAEQYCDLSVSNLTQEDSAVYFCAAR
Salmo salar V61 trbv AGKD04002795.1 19721 LCLCVEVHQTPSAVFSRPGENIQLFCHHQKTDYTQMLWYQKSQGETALKLIGYLNYNSKTIESSYENNFNMSGDLSGDGPKNASLNMFNLRQPQHSAVYLCAARY
Salmo salar V60 trbv AGKD04002795.1 5109 SSLNSQVHQRPAALYKNQGESAKMECSHSISGYNYVLWYKQSNYRELVFLGYMQLKTGFPEAGFAIEGDANAGGTSTLTINQLTPNSSAVYYCAAS
Salmo salar V59 trbv AGKD04002795.1 31 LSPTDKVHQTPTAILKRPENKVQLTCRHTVSSYDMILWYQQAAQNSALKLIGYVWNTSPTVEDSFKGRFNVSGDGAANKMAYLHFPKVTEAEDSAVYFCAASK
Salmo salar V58 igkv AGKD04002025.1 27909 QVTVTQPPVVTCSPGDPVTLTCTTNPEVYRFSDGDEALSWYQQRPGEAPKLLIIYAKTLLDGIPARFSGSGSERDFTLTISGVQVEDAAVYYCQSYHELNDKAL
Salmo salar V57 iglv AGKD04000821.1 323539 VSGVTVVTQKPPVVTVRKGETATMDCNLGTVNNIARWYKQVPGGVPQYMLRWYHTGWRSVEYGSGFSSPKFTSNHQSKSDYRLIINTVEETDSAVYYCQ
Salmo salar V56 ighv AGKD04000655.1 663777 VHSQTLTESGPVVKKPGESHQLTCTASGFTFSSYWMAWIRQAPGKGPEWIASSHSTTTYYSQSVQGRFTISRDDSSSKLYLQMSSLKSEDTAVYYCAR
Salmo salar V55 ighv AGKD04000655.1 568840 VQGQSLTSSEPLVKSPGESVTLYCTVSGLPLSWLHWIRQKPGKGLEWIGRIDSGTGTIFSQSLQGQFTITKDNSKKQLYLEVKSLKTEDSAVYYCARDTV
Salmo salar V54 ighv AGKD04000655.1 364338 VQSYELSQPTSMTVQPGQPLTISCKVSYSVTNTWTSWIRQPAGKALEWIGNVYSGDTKYKDSLKNKFSLSVDSSSNTVFLKGQNLQTEDTAVYYCAY
Salmo salar V53 ighv AGKD04000655.1 349052 VQSYELSQPTSMTVQPGQPLTISCKVSYSVTDTWTSWIRQPAGKALEWIGNVYSGDTKYKDSLKNKFSLSVDSSSNTVFLKGQNLQTEDTAVYYCAY
Salmo salar V52 ighv AGKD04000655.1 346800 VYGQTLTESGPVVKKPGESHQLTCTASGFTFSSSRMGWIRQAPGKGLEWIAYISTQSNPISYSQSVQGRFTISRDDSSSKLYLQLNSLKSEDTAVYYCARE
Salmo salar V51 ighv AGKD04000655.1 340034 VYGQTLTESGPVVKKPGESHQLTCTASGFTFSSYGMGWIRQAPGKGLEWIAYIDTASTPISYSKSVQGRFTISRDDSSSKLYLQMNSLKSEDTAVYYCARE
Salmo salar V50 igkv AGKD04000330.1 340726 QITVTQSPTVKTVLPGQTVSMNCKASSDVYPNCWGTGKPCLAWYQQKPGETHKLLVYYGSILFTGTPSRFSGSGSGSDFTLTISGVQAEDAADYYCQSYKHINSKHV
Salmo salar V49 igkv AGKD04000330.1 327027 SRGQITVTQTPAVKAVVPGHTVSLNCKTSSNVYSNCYNGQSWGHQCLSWYQQKPGEKPKLMMLPGNKLHSGTPSRFSGSGSGSDFTLTISGVQAEDAGDYYCQS
Salmo salar V48 igkv AGKD04000330.1 294970 SRGQVTVTQTPAVKDVSVGHSVSLSCKTSSAVYSNSNGHLLAWYQQTPAGAPKLLIYSAKTLQSGTPSRFSGSGSGSDFTLIISGVQAEDAGDYYCQS
Salmo salar V47 igkv AGKD04000330.1 257788 SRGQVTVTQTPAAKVVLQGQTVVINCKTSSNVVDACAGDYTCMAWYQQKPGGAPTLLMHSSNRLQSGIPSRFSGSGSHKDFTLTISGVQAEDAGDYYCQS
Salmo salar V46 igkv AGKD04000330.1 252183 QYVLTQTPAVKAVVPGQQVSLNCKTSSDVYNDNCLAWYQQKPGGAPKLLIYYATTLQSGTPSRFSGSGSRSDFTLTISRVQAEDAGDYYCQS
Salmo salar V45 igkv AGKD04000268.1 1141073 SRGQITVTQTPAVKTVSVGHSVSLSCKTSSAVFSNSNGHFLAWYQQKPGGAPQLLIYYAKTLQSGIPSRFSGSGTRSDFTLTISGVQAEDAGDYYCQS
Salmo salar V44 trbv AGKD04000217.1 2411433 LVEGSEVTQIPTILWEMKDSDAPMNCSHTKGATYFQMYWYRQLPGEGMKQVVYTTSNSKPEYSGDFSEDKFSAKKTVAESGSFTVKKLEAGDSGMYFCAVS
Salmo salar V43 trbv AGKD04000217.1 2406446 SSLSNQVYQSPASLYKNQGELAKMECSHSISGYDRILWYKQSNYRELVLLGYLYGKTGYPEAGFGIEGDANAGGTSTLTINQLTPNSSAVYYCAAS
Salmo salar V42 trbv AGKD04000217.1 2391858 LSQTDKVHQTPTAILKRPEDKVHLTCSHTVSSYNMILWYQQSPQNNALKLIGYVWNTSPTVEDSFKGRFNVSGDAAANKMAYLHFPKLTEAEDSAVYFCAASE
Salmo salar V41 trbv AGKD04000217.1 2386630 LVEGSEVTQIPTILWKLKESDAPMNCSHTKGSSYYQMYWYRQLPGEGMKQVVYTTSSSKPEYSWDFSEDKFSAKKTVAESGSFTVKKLGTGDSGMYFCAVS
Salmo salar V40 trav AGKD04000199.1 919536 DSMEQETITPVKPEVNALQGTDITLSCNYKGNINNLQWYRQYPGSRPECLLLILQTSKYVQNTSITTPRHNGRLNEEKTRVDLMISSVELEDSALYHCALQ
Salmo salar V39 trav AGKD04000199.1 893462 TVIQPPGDVIPTEGEQVTLGCQFDTVDRNPYLFWYKQRANDFPKFMLKRVTFGSDNAIEFQRRFDAHLNLTTFKSESKSVPLTIQRLQLSDSAVYYCALR
Salmo salar V38 trav AGKD04000199.1 888053 CRGDRVLQTKGVETATEGGQITLACHYETDDPSPYLFWYKQGANDYPKYILMRQKFVTGDNAADFKERFHADLDANSKSVPLMIQRVQLSDSAVYYCALK
Salmo salar V37 ighv AGKD04000199.1 881463 GVTQSKREVTAYEGEDVSLNCEYNTSLSAPSLFWYIQSINDYPEYVLRKDVIGPGGIDDRFKGRFDADLNSITKSVPLTIQRVQLSDSAVYYCALR
Salmo salar V36 trav AGKD04000199.1 874173 CRGEEAVDQQSGHVTALEGGLVTISCNYTTSSASPDLFWYIQLTRNSPQYVLRRDRYSEGSNSDEFKKRFDSRLNFTSSSVPLTIQRLHLSDSAVYYCALK
Salmo salar V35 trav AGKD04000199.1 868742 DSMEQETITPVKPEVNALQGTDITLSCNYKGYVNNLQWYRQYPGSRPECLLWIIQSSMSVQKQSIATPRHTGRLNEEKTRFDLMISSVELEDSALYHCALQ
Salmo salar V34 trav AGKD04000199.1 853933 CRGEDSVTQPPGDVIATEGEQVTLNCQFDAVNINNLYLFWYKHEVNGFPKFMLGRFPFGSKNATGYEERFDAHLDKDSKAVPLTIQRLQLSDSAVYYCALR
Salmo salar V33 trav AGKD04000199.1 835565 CTGDHVQQQPGGVIATEGGLVTLSCQYNTSANNNNAYLFWYKQEENDFPKHMLTRFSFGSGDNAGGFKERFNASLNAKTQSVPLTIQRLQLSDSAVYYCALR
Salmo salar V32 trdv AGKD04000199.1 794497 IVSGDSVTPDKEEYTPTEGSSVSLKCTYETKLEYILLYWYRHYPNQAPQFLLYKGARSQSESEQISDQRYTSTTSRTSTELVITRLTLADTALYHCAL
Salmo salar V31 trav AGKD04000199.1 778409 CTGDHVQQQPGGVIATEGGLVTLSCQYNTTSANNVAYLYWYKQEANSFPKHMLNRYSIGSGDNAAGFKERFNASLNAKTQSVPLMIQRVHLSDSAVYYCALK
Salmo salar V30 trav AGKD04000199.1 777427 CRGEDSVTQPPGDVIATEGEQVTLNCQFDAVNTNDLNLFWYKHEVNGFPKFMLGRFSFGSTNATGYEERFDAHLDKDSQSVPLMIQRVQLSDSAVYYCALR
Salmo salar V29 trav AGKD04000199.1 776401 CTADNVQQQPGGVIATEGGLVTLSCQYNTSANNIAYLYWYKQEANSFPKHMLNRYSIGSGDNAAGFKERFNASLNAKTQSVPLMIQRVQLSDSAVYYCALR
Salmo salar V28 trdv AGKD04000199.1 768949 NSFGDSINPVTTEELVQEGRNVHLSCKYDGTVYTLQWYSQYPRSKPEFLLYITPEGLIITATPPPPRLTVSLDKVDKRVNLKISSADVTDSALYFCAMK
Salmo salar V27 trav AGKD04000199.1 756037 LSCEQVLTPYTDVEVASERERVTLSCNYSSGVTLQWYRQYPQSAPQLLVMEHMLAKTPGFTLNLDKKAKRMDLEISFAEVTDSALYYCALV
Salmo salar V26 trav AGKD04000199.1 749729 CRAEENVRQPTEDVLVVEGQPTTLTCLFDTADLSPNLFWYKQQTNSNPIFMLRRDKFSPGETATEFKERFDARLNFTAKSVPLTIQRVHLSDSAVYYCALR
Salmo salar V25 trdv AGKD04000199.1 730330 MVSGDSVTPDKEEYTPTEGSSVSLRCTYETSSEYIYLYWFRHYSNQAPQFLLYKGARSWSSEEHIPDKRYTSTTSSTSTELVITSLTLADTALYYCAL
Salmo salar V101 trav AGKD04032787.1 4652 CRGDRVLQTKGVETATEGGQITLACHYETDDPSPYLFWYKQGTNDFPKYILMRPKFGTGDNAADFKERFHADLDANSKSVPLTIQKLQLSDSAVYYCALR
Salmo salar V100 trav AGKD04032787.1 3959 CRGEDSVIQPSGDVIATEGEQVTLGCQFDAVNMKGLYLFWYKHEVNGFPEFMLGRFPFGSKNATEFKDRFDAHLDADSKSVPLKIQRLQPSDSAVYYCALR
Salmo salar V99 ighv AGKD04032527.1 4545 VCCAIKLDQSLSHLKRPEDTVKLSCKTSGFTMTSFYMYWIRQEPGKALEWIGRMNSNSPDYSDSLKGQFILTEDVSTSTQFLEAKSLRSEDSAVYYCSRE
Salmo salar V98 trav AGKD04032391.1 2587 VSYQEEIQPIAKIMHGDEGGFVTLSCNYSGSPYSLQWYRQYPRSAPKFLLLTTVSSNPSVVNATPPYPHLSIKLNKERTRVDLEISSAVVTDSALYYCALQ
Salmo salar V97 trav AGKD04031946.1 2503 VSYQEEIQPIAKIMHGDEGGFVTLSCNYSGSPYSLQWYRQYPRSAPKFLLLTTVSSNPSVVNATPPYPHLSIKLNKERTRVDLEISSAVVTDSALYYCALQ
Salmo salar V96 trbv AGKD04031355.1 5291 SSLNSQVHQRPAALYKNQGESAKMECSHSISGYNYVLWYKQSNYRELVFLGYMQLKTGFPEAGFAIEGDANAGGTSTLTINQLTPNSSAVYYCAAS
Salmo salar V95 trbv AGKD04031355.1 214 LSPTDKVHQTPTAILKRPENKVQLTCRHTVSSYDMILWYQQAAQNSALKLIGYVWNTSPTVEDSFKGRFNVSGDGAANKMAYLHFPKVTEAEDSAVYFCAASK
Salmo salar V94 trav AGKD04031188.1 2441 VSYQEEIQPIAKIMHGDEGGFVTLSCNYSGSPYSLQWYRQYPRSAPKFLLLTTVSSNPSVVNATPPYPHLSIKLNKERTRVDLEISSAVVTDSALYYCALQ
Salmo salar V93 trav AGKD04031164.1 5088 CRGDRVLQTKGVETATEGGQITLACHYETDDPSPYLFWYKQGTNDFPKYILMRPKFGTGDNAADFKERFHADLDANSKSVPLTIQKLQLSDSAVYYCALR
Salmo salar V92 trav AGKD04031164.1 4395 CRGEDSVIQPSGDVIATEGEQVTLGCQFDAVNMKGLYLFWYKHEVNGFPEFMLGRFPFGSKNATEFKDRFDAHLDADSKSVPLKIQRLQPSDSAVYYCALR
Salmo salar V91 trav AGKD04031124.1 5101 CRGDRVLQTKGVETATEGGQITLACHYETDDPSPYLFWYKQGTNDFPKYILMRPKFGTGDNAADFKERFHADLDANSKSVPLTIQKLQLSDSAVYYCALR
Salmo salar V90 trav AGKD04031124.1 4408 CRGEDSVIQPSGDVIATEGEQVTLGCQFDAVNMKGLYLFWYKHEVNGFPEFMLGRFPFGSKNATEFKDRFDAHLDADSKSVPLKIQRLQPSDSAVYYCALR
Salmo salar V89 trbv AGKD04030863.1 5434 SSLNSQVHQRPAALYKNQGESAKMECSHSISGYNYVLWYKQSNYRELVFLGYMQLKTGFPEAGFAIEGDANAGGTSTLTINQLTPNSSAVYYCAAS
Salmo salar V88 trbv AGKD04030863.1 357 LSPTDKVHQTPTAILKRPENKVQLTCRHTVSSYDMILWYQQAAQNSALKLIGYVWNTSPTVEDSFKGRFNVSGDGAANKMAYLHFPKVTEAEDSAVYFCAASK
Salmo salar V87 trav AGKD04030398.1 2441 VSYQEEIQPIAKIMHGDEGGFVTLSCNYSGSPYSLQWYRQYPRSAPKFLLLTTVSSNPSVVNATPPYPHLSIKLNKERTRVDLEISTADVPDSALYYCALQ
Salmo salar V86 igkv AGKD04030139.1 200 QVTVTQPPVVTCSPGDPVTLTCTTNPEVYRFSDGDEALSWYQQRPGEAPKLLIIYAKTLLDGIPARFSGSGSERDFTLTISGVQVEDAAVYYCQSYHELNDKAL
Salmo salar V85 ighv AGKD04024443.1 1792 VQCEELTQPAFMTVQSGQLLTISCKVSYSVTSVATFWIRQPAGKTLEWIGYINSGGSTAYKDSLKNKFSITRDTSSNTLFLKGQSLQTEDTAVYYC
Salmo salar V84 trav AGKD04023717.1 7563 QSLSSKVHQTPIAILKGSKDNVQLTCNHTFQNYNMILWYQQSTGDNAMNLIGYAYYKSITMEKLFEKHFSVSGDGLKEAYLHLLSLRATEDSAVYYCAAS
Salmo salar V83 igkv AGKD04023407.1 3804 SSADIILTQSPKSQSVRLGETLSISCTASSSTGNNLQWYLQTHGDTPKLLVYHGTNRQSGIPGRFSGSGSGSSYTHYTLTISGVQAEDAGDYYCQQGGYFP
Salmo salar V82 iglv AGKD04022882.1 8706 VSGVTVVTQKTPVVTVRKGEMATMDCNLGTVENSAARWYKQVPGGVPQYMLRWYHTGWSSVEYGSGFSSPKFTSNHQSKSDYRLIINTVEETESAVYYCNTWDNSVN
Salmo salar V81 igkv AGKD04022079.1 7980 QSLSSKVHQTPTAILKGSKDNVQLTCNHTIQGYTMILWYQQSTGDTAVNLIGYAYTTSITMEKSFEKHFSVSGDGSKEAYLHLLSLRAPEDSAVYYCAAS
Salmo salar V80 trav AGKD04022079.1 868 QSLSTKVHQTPTAILKGSKDNVQLTCNHTIQNYNMILWYQQSTGDTAMNLIGYAYTTSITMEKSFEKHFNVSGDGRKEAYLHLLSLRAPEDSAVYYCAAS
Salmo salar V79 trbv AGKD04021982.1 4815 SSLSNQVQQRPAALYNNQGESDKMECSHSISGYNVILWYKQSNYRELVLLGYMIGTSGYPEAGFDIEGDANAGGTSTLTINQLTPNSSAVYYCAAS
Salmo salar V78 trav AGKD04017552.1 1526 LSQTDKVQQTPTAILKGPEDNVQLNCSHTIPNYNTILWYQQSAQNTALKLIGYVLLTSPTMEDSFKERFTVSGDAATGKMAYLHIPKLRGTEDSAVYFCAATY
Salmo salar V77 trbv AGKD04017191.1 6774 SSLSSQVYQTPASLYKKQGKSAKMECSHSISSYNRILWYKQSNYRELLLLGYMVGKTGYPEAGFGIEGDANAGGTSTLTINQLTPNSSAVYYCAAS
Salmo salar V76 ighv AGKD04016790.1 1304 VQCEELTQPAFMTVQSGQLLTISCKVSYSVTSVATFWIRQPAGKTLEWIGYINSGGSTAYKDSLKNKFSITRDTSSNTLFLKGQSLQTEDTAVYYC
Salmo salar V75 ighv AGKD04016083.1 11207 VQSQTLTESGPVVKKPLEAHKLTCTASSLDINGYWMAWIKQAPGKGLEFVAAHYDSSSIAYSQSVQGRFTISRDNSKKQVYLQMNSLKTEDSAVYYCAR
Salmo salar V74 trbv AGKD04011174.1 41151 SYLSSQVYQSPASLYKNQGELAKMECSHSISGYNQILWYKQFNYRELVFLGYMTGTSGFPEAGFDIEGDANTGGTSTLTINQLTPNSSAVYYCAAS
Salmo salar V73 igkv AGKD04011174.1 35495 QLFSSMVHQRPVALTEGPGGNVPLTCSHTIPNYYMILWYKQSAGDTAMKLIGYAYTKSITMEKSFEKHFNVSGDGEKEAYLHLVSLRGPEHSAVYYCVAS
Salmo salar V72 trbv AGKD04008688.1 8231 SSLSNQIYQSPASLYKNQGESAKIKCSHSISSYNVILWYKQSNYRELVFLGYMTAKTANPEVGFGIEGDASAGGTSTLTINQLTPNSSAVYYCAAS
Salmo salar V71 igkv AGKD04008688.1 4356 QLFSSMVHQRPVALTEGPGGNFQLTCSHTIPNYYVILWYKQSAGDTAMKLIGYAYTKSITMEKSFEKHFNVSGDGEKEAYLHLVSLRGPEHSAVYYCAAS
Salmo salar V70 trbv AGKD04006537.1 38498 VSLSKVVYQSPSTLLVKPNAPVSVPLSCSHKIPSYNTILWYQRPVGDTALKLIAYVYYTSQTVEPPYKGYFDVKGDGRNEAFLHLLKLRQAEDSGEYFCAASY
Salmo salar V69 ighv AGKD04006470.1 14112 VYGQSLEAIPSSPVLKNPGEPVSLSCKGSGFTFGSYHMGWIRQPAGKALEWIGIIWNDASGTAYAKSVEGRIEVTRDNSNSMVYLKLSGLRAEDSAVYYCARE
Salmo salar V68 ighv AGKD04006470.1 11947 VCCDIRLDQSPSQVKIPGHSVKVSCIISGYSMTSHNIHWIRQKPGKGLEWIGRMNTGSGTDVIYADSLKGQFTLTEDVSTSTQFLEAKSLSSEDSAVYYCARQ
Salmo salar V67 ighv AGKD04006470.1 7895 VYGQTLTESGPVVKKPGESHQLTCTASGFTFSSYYMAWIRQAPGKGLEWVAYIGTSSSPISYSQSVQGRFTISRDDSSSKLYLQINSLKSEDTAVYYCARE
Salmo salar V66 ighv AGKD04006470.1 1830 VYCDIELIQSDPVVIKPGKSFSISCKFSGFSISSYCLGWIRQAEGTALEHVGYTCSSSTSTVDSLKSKITSRYDSSSSIVFLQRNNFQTEDTAVYY
Salmo salar V65 trbv AGKD04003904.1 19171 VIQTVEISQWPSSICSHPNTSMDMHCSQDAGYDYMYWYRHLQGEGPKLMATLVAGSASYETEFKSGFRVWRTENSEGMSSVRQWSLTVQMVQRKDQAVYLCAAS
Salmo salar V64 trbv AGKD04003904.1 2654 LSLSVEVHQTPSEVFSRPGENVQLFCHHNKSDYRVILWYQKLQGEIELKLIGYLYYQNPTIESSYGKHFNMSGDLGGDRPKNVSLNIFNFQHPEHSAMYFCAASD
Salmo salar V113 igkv AGKD04615909.1 88 QSLSSKVHQTPTAILKGSKDNVQLTCNHTIQNYIMILWYQQSTGDTAVNLIGYAQYKSITMEKSFEKHFSVSGDGSKEAYLHLLSLRAPEDSAVYYCAAS
Salmo salar V112 trav AGKD04561296.1 174 CRGEDSVTQPPGDVIATEGEQVTLDCQFDSLDTSPYLFWYKQGANDFPKYMLRRATFGSDNAIEFQRRFDAHLNLTTFKSASKSVPLTIQRLQLSDSAVYYCALK
Salmo salar V111 trav AGKD04465682.1 17 CRGEDSVTQPPGDVIATEGEQVTLNCQFDAVNINNLYLFWYKHEVNGFPKFMLGRFPFGSKNATGYEERFDAHLDKDSKAVPLTIQRLQLSDSAVYYCALR
Salmo salar V110 trbv AGKD04048050.1 2704 LSQIDKVQQTPTAILKGPEDNVQLNCSHTIPNYDTILWYQQSAQNTALKLIGYVRFTSPTVEDSFKERFTVSGDAATGKMAYLHIPKLRGTEDSAVYFCAASK
Salmo salar V109 ighv AGKD04043368.1 2524 VYGQTLTESGPVVKKPGESHQLTCTASGFTFSSSRMGWIRQAPGKGLEWIAYISTQSNPISYSQSVQGRFTISRDDSSSKLYLQLNSLKSEDTAVYYCARE
Salmo salar V108 ighv AGKD04039363.1 3368 VCCAIKLDQSLSHLKRPEDTVKLSCKTSGFTMTSFYMYWIRQEPGKALEWIGRMNSNSPDYSDSLKGQFILTEDVSTSTQFLEAKSLRSEDSAVYYCSRE
Salmo salar V107 trdv AGKD04037082.1 740 MVSGDSVTPDKEEYTPTEGSSVSLRCTYETSSEYIYLYWFRHYSNQAPQFLLYKGARSWSSEEHIPDKRYTSTTSSTSTELVITSLTLADTALYYCAL
Salmo salar V106 igkv AGKD04035636.1 3641 SWGQYVLTQSAAQSVQPGQTISIDCSASSTVTQYSGSQYYLAWYHQTSGEAPKLLIYLTSDRFTGVSTRLSGSGRGNGVDFTLTISKFQAEDTGVYYCQS
Salmo salar V105 igkv AGKD04035487.1 743 QSLSSKVHQTPTAILKGSKDNVQLTCNHTIQGYTMILWYQQSTGDTAVNLIGYAYTTSITMEKSFEKHFSVSGDGSKEAYLHLLSLRAPEDSAVYYCAAS
Salmo salar V104 ighv AGKD04034757.1 3367 VCCAIKLDQSLSHLKRPEDTVKLSCKTSGFTMTSFYMYWIRQEPGKALEWIGRMNSNSPDYSDSLKGQFILTEDVSTSTQFLEAKSLRSEDSAVYYCSRE
Salmo salar V103 trav AGKD04033366.1 3213 CTADHVQQQPGCVIATEGGLVTLSCQYNTTGANNIEYLYWYKQEANYFPKYMLRRYSIGSGGNAAGFKERFNASLKAKKQSVPLTIQRLHLSDSALYYCALE
Salmo salar V141 igkv AGKD04000087.1 809693 SSADIIMTQSPESQSVSPGETVSISCTASSSTGNNLHWYLQKPGEAPKLLVYSGTTRQSGIPGRFSGSGSGSSYTHYTLTISGIQAEDAGDYYCQQGASFP
Salmo salar V140 igkv AGKD04000087.1 889522 SSADIILTQSPKSQSVHPGETVSISCTASSSTGNVLSWYLQKPGEAPNLLVYYAKNRQSGIPGRFNGGGSGTQFTLTITGVQAEDAGDYYCQQGYSYP
Salmo salar V139 igkv AGKD04000087.1 889522 SSADIILTQSPKSQSVHPGETVSISCTASSSTGNVLSWYLQKPGEAPNLLVYYAKNRQSGIPGRFNGGGSGTQFTLTITGVQAEDAGDYYCQQGYSYP
Salmo salar V138 igkv AGKD04000087.1 897050 SSADIILTQSPKSQSVRPGKTVSISCTASSSISNYLSWYLQKPGEAPKLLVYRATNRQSGIPGRFSGSGSGSQFTLTISGVQEEDAGDYYCQQGASFP
Salmo salar V137 igkv AGKD04000087.1 909773 SSADIILTQSPKSQSVSPGKTVSISCTASSSTGNNLHWYLQKPGEAPKLLVYFATNRQSGIPGRFSGSGSGSSYTHYTLTISGVQAEDAGDYYCQQGASYP
Salmo salar V136 igkv AGKD04000087.1 919841 SSADIILTQSPKSQSVRLGETLSISCTASSSTGNNLQWYLQTHGDTPKLLVYHGTNRHSGIPGRFSGSGSVSPYTHYTLTISGVQAEDAGDYYCQQGGSFP
Salmo salar V135 igkv AGKD04000087.1 929073 SAADIILTQSPKSQSVSPGKTVSISCTASSSTADYLHWYLQKPGEAPKLLVYYATNRQSGIPGRFSGSGSGSSYTHYTLTISGVQAEDAGDYYCQQSNSYP
Salmo salar V134 igkv AGKD04000087.1 955087 SSADIILTQSPKSQSVRLGETVSISCTASSSTGNNLHWYLQKPGEAPKLLVYSTTSRQSGIPGRFSGSGSGSSYTHYTLTISGVQAEDAGDYYCQQGNSSP
Salmo salar V133 igkv AGKD04000087.1 977011 IILTQSPKSQSVRSGDTVSISCTASSSTSNVLSWYLQKPGEAPKLLVHSAAARQSGIPGRFSGSGSGSSFTHYTLTISGILAEDAGDYYCQQGASYP
Salmo salar V132 trav AGKD04000015.1 12663438 CALNNNVIQPDPLIVTQLGQSVSLNCFFQSHLIKVSWFKQTVGQKPLLMASSYYPSKNSFHFTKDFNETKRLSVKRGIDSCNLTISKTESGDSATYYCGAMEEGE
Salmo salar V131 trav AGKD04000015.1 12663438 CALNNNVIQPDPLIVTQLGQSVSLNCFFQSHLIKVSWFKQTVGQKPLLMASSYYPSKNSFHFTKDFNETKRLSVKRGIDSCNLTISKTESGDSATYYCGAMEEGE
Salmo salar V130 trav AGKD04000015.1 12663438 CALNNNVIQPDPLIVTQLGQSVSLNCFFQSHLIKVSWFKQTVGQKPLLMASSYYPSKNSFHFTKDFNETKRLSVKRGIDSCNLTISKTESGDSATYYCGAMEEGE
Salmo salar V129 trgv AGKD04000015.1 12721523 LSIGIITQSDLLKTFIDGDTVDLKCFISGTGGDYYNWFKLTVGQAPAMIVSLYLDSKDPTLYGEFDNNPRFSAEKNGDSFVLTISNAKPSDVGMYYCA
Salmo salar V128 trgv AGKD04000015.1 12721523 LSIGIITQSDLLKTFIDGDTVDLKCFISGTGGDYYNWFKLTVGQAPAMIVSLYLDSKDPTLYGEFDNNPRFSAEKNGDSFVLTISNAKPSDVGMYYCA
Salmo salar V127 trgv AGKD04000015.1 12721523 LSIGIITQSDLLKTFIDGDTVDLKCFISGTGGDYYNWFKLTVGQAPAMIVSLYLDSKDPTLYGEFDNNPRFSAEKNGDSFVLTISNAKPSDVGMYYCA
Salmo salar V126 trgv AGKD04000014.1 12856872 QQLQQDQILKTRKEKQSVSFSCKVTGWCLGNLVHWYQKGEGEPFSRILYNDLNANSFTRDNAHPQTADFSAVGKSDSSELKIQSVKVSHSATYYCACWDSS
Salmo salar V125 trgv AGKD04000014.1 12889657 AASGQRLQQDQISETKREKESVTFSCKVTGSCSGNKVYWYQKKEGEAFTWINFDANSGSSDTPHPQRQDFYIWRESASHPSELKIQFVKVSHSATYYCACRVLG
Salmo salar V124 trgv AGKD04000014.1 12889657 AASGQRLQQDQISETKREKESVTFSCKVTGSCSGNKVYWYQKKEGEAFTWINFDANSGSSDTPHPQRQDFYIWRESASHPSELKIQFVKVSHSATYYCACRVLG
Salmo salar V123 trgv AGKD04000014.1 12950589 SVSGQKLDQDISWTRKKGEVVSFSCKDYDRCKTFLLWFQKKEGETFTYILAIFKDDCTIFDNIEFPQKDDFSAMRKKNNCDLKIQSVKVSHSATYYCACWVSG
Salmo salar V122 trgv AGKD04000014.1 13009775 QRLQQDQISKTRREKQSVSFGCKVTGSCFGNLVHWYQKREGEPFSWILYFDFDDNSDSRATTHPQRADFSVRGESDSSNLMIKSVKVSHSATYYCACWVSG
Salmo salar V121 trgv AGKD04000014.1 13039887 AGQKLDQEISWTRTQGQAVSFSCKDNDQCATYVFWYQKKDGEPFTLILDIRKGNCAVDARYNHPQKDDFSAMRNNNCDLKIQLVKVSHSATYYCACYRSGNPQ
Salmo salar V120 trav AGKD04000014.1 13064489 AASGQQLQQDQISKIRREKQSVSFGCKVTGSCLGNLVHWYQKREGEPFTWILYFDFDDNSISSATSHPQRSDFSIWRESESDYSELKIQSVKVSHSATYFCACWVSG
Salmo salar V119 ighv AGKD04727503.1 257 LKGQSLESSPSSSVMKKLGETISLSCKISGFTFNSHNTHWIRQPAGKSLEWMGYSGLGLGYHAKTFEGRMETTKDNSNSMMTLKLSGLRAEDSAVYYCARQ
Salmo salar V118 igkv AGKD04685760.1 266 SRGQITVTQTPAVKAVVPGHTVSLNCKTSSNVYSNCYNGQSWGHQCLSWYQQKPGEKPKLMMLPGNKLHSGTPSRFSGSGSGSDFTLTISGVQAEDAGDYYCQS
Salmo salar V117 trav AGKD04675928.1 169 DSNGQIIEPIREEVYAPAGSNITLSCTYSSAVSLQWYLQDPGSPPQYILLILHGVGSPSRAPGLDPPLSVKLNDEKNRVDLEISSAKEKDSTMYYCALT
Salmo salar V116 ighv AGKD04666555.1 248 WRSFPPVQSRKSLEKLSVCPVRYLDIPLPATTHWIRQPAGKSLEWMGFSGLGLGYHAKKFEGRMETTKDTSNSMLTLMLSGVRAEDSAVYYCAR
Salmo salar V115 ighv AGKD04643973.1 178 VYGQTLTESGPVVKKPGESHQLTCTASGFTFTSDYMGWIRQAKGKEFEWIGHIHGGTTYYSQSFQGRFTISRDDSSSKLYLQMNSLKSEDTAVYYCAR
Salmo salar V179 ighv AGKD04000476.1 726487 VQSQTLTESESVVKTFEESHKLTCTYSGFGCYYWNAWIRQASGKGLEWVATISDSSRYIYYSQSIQGRFTISRDNSKQQVYLQMNSLKTEDSAVYYCAR
Salmo salar V178 ighv AGKD04000476.1 726487 VQSQTLTESESVVKTFEESHKLTCTYSGFGCYYWNAWIRQASGKGLEWVATISDSSRYIYYSQSIQGRFTISRDNSKQQVYLQMNSLKTEDSAVYYCAR
Salmo salar V177 ighv AGKD04000476.1 734750 VHCQVVLTQAEQTVQGTPGGSLKLTCACSGITLSSSYMHWIRQAPGKGLEWIIYYYSDTYKSNAPVVQGRFTASKDSTNFYRHMSQLKSEDSAVYYCARD
Salmo salar V176 ighv AGKD04000476.1 734750 VHCQVVLTQAEQTVQGTPGGSLKLTCACSGITLSSSYMHWIRQAPGKGLEWIIYYYSDTYKSNAPVVQGRFTASKDSTNFYRHMSQLKSEDSAVYYCARD
Salmo salar V175 ighv AGKD04000476.1 773994 VHCQVVLTQAEQSVQGTLKGFLKLTCACSGFTLSSSYMHWIRQAPGKGLEWIIYYYSDTDKSNAQVVQGRFTASKDSSNFYLHMSQLKSEDSAVYYCARD
Salmo salar V174 ighv AGKD04000476.1 773994 VHCQVVLTQAEQSVQGTLKGFLKLTCACSGFTLSSSYMHWIRQAPGKGLEWIIYYYSDTDKSNAQVVQGRFTASKDSSNFYLHMSQLKSEDSAVYYCARD
Salmo salar V173 ighv AGKD04000476.1 773994 VHCQVVLTQAEQSVQGTLKGFLKLTCACSGFTLSSSYMHWIRQAPGKGLEWIIYYYSDTDKSNAQVVQGRFTASKDSSNFYLHMSQLKSEDSAVYYCARD
Salmo salar V172 ighv AGKD04000476.1 831263 VQGQTLTESGPVVKKPGESHKLTCTASGFTFSSYYMGWIRQAKGKEFEWIGHIHGGTTYYSQSLQGRFTLSREDSSSKLYLQMNSLKSEDTAVYYCAR
Salmo salar V171 ighv AGKD04000476.1 831263 VQGQTLTESGPVVKKPGESHKLTCTASGFTFSSYYMGWIRQAKGKEFEWIGHIHGGTTYYSQSLQGRFTLSREDSSSKLYLQMNSLKSEDTAVYYCAR
Salmo salar V170 ighv AGKD04000476.1 855414 VHCQVVLTQAEQSVQGTSGGSLKLTCACSGFTLSSYRMHWIRQAPGQGLQWILHYYTSSDNGYALVLQGRFTASKDSANFYLHMTQLKPEDSAVYYCA
Salmo salar V169 ighv AGKD04000476.1 855414 VHCQVVLTQAEQSVQGTSGGSLKLTCACSGFTLSSYRMHWIRQAPGQGLQWILHYYTSSDNGYALVLQGRFTASKDSANFYLHMTQLKPEDSAVYYCA
Salmo salar V168 ighv AGKD04000476.1 855414 VHCQVVLTQAEQSVQGTSGGSLKLTCACSGFTLSSYRMHWIRQAPGQGLQWILHYYTSSDNGYALVLQGRFTASKDSANFYLHMTQLKPEDSAVYYCA
Salmo salar V167 ighv AGKD04000476.1 863208 IQGQTLTESGPVVKKTEESHKLTCTGAGFTFSSYWMAWIRQAPGKGLEWIGIIHGTTTYYSQSVQGRFTLSRDDSSSKLYLQMNSLKSEDTAVYYCAR
Salmo salar V166 ighv AGKD04000476.1 863208 IQGQTLTESGPVVKKTEESHKLTCTGAGFTFSSYWMAWIRQAPGKGLEWIGIIHGTTTYYSQSVQGRFTLSRDDSSSKLYLQMNSLKSEDTAVYYCAR
Salmo salar V165 trav AGKD04000476.1 901761 VHCQVVLTQAEQSVHGTSGGSLKLTCACSGFTLSSYRMHWIRQAPGQGLQWILHYYSSSDNGYTLVLQGRFTASKDSTNFYLHMTQLKPEDSAVYYCARD
Salmo salar V164 trav AGKD04000476.1 901761 VHCQVVLTQAEQSVHGTSGGSLKLTCACSGFTLSSYRMHWIRQAPGQGLQWILHYYSSSDNGYTLVLQGRFTASKDSTNFYLHMTQLKPEDSAVYYCARD
Salmo salar V163 ighv AGKD04000476.1 911378 VHGQTLTESGPVVKKPGESHKLTCTASGFTFSSYGMNWIRQAPGKGLEWIAYSHSTTVYYSQSVQGRFTISRDDSSSKLYLQMNSLKSEDTAVYYCGR
Salmo salar V162 ighv AGKD04000476.1 911378 VHGQTLTESGPVVKKPGESHKLTCTASGFTFSSYGMNWIRQAPGKGLEWIAYSHSTTVYYSQSVQGRFTISRDDSSSKLYLQMNSLKSEDTAVYYCGR
Salmo salar V161 ighv AGKD04000476.1 1024346 ACCDEMDQSPFQVKRSRDTFKLSCQIYGFDMTGYYINWIRQKPGRSPEWIGRINSCSTDAPDYSGQFILTEDVFTSTQYIELKNLRSEDSAVYYCARQ
Salmo salar V160 ighv AGKD04000476.1 1024346 ACCDEMDQSPFQVKRSRDTFKLSCQIYGFDMTGYYINWIRQKPGRSPEWIGRINSCSTDAPDYSGQFILTEDVFTSTQYIELKNLRSEDSAVYYCARQ
Salmo salar V159 ighv AGKD04000476.1 1025300 EYCGGLELSQPSVMVIKPGESPSITCKVSGYSVSDSSISFATGWVRKPAGKAMEWISHIWYDGDILKNYALKNKFTISRDASSNSVSLQGQSLQPEDTAVYYCVRNP
Salmo salar V158 ighv AGKD04000476.1 1025300 EYCGGLELSQPSVMVIKPGESPSITCKVSGYSVSDSSISFATGWVRKPAGKAMEWISHIWYDGDILKNYALKNKFTISRDASSNSVSLQGQSLQPEDTAVYYCVRNP
Salmo salar V157 ighv AGKD04000476.1 1029604 VCCNEMDQSPSQVKRPGDTFKLSCKISGFDMTSYYIHWIRQKPGKALEWIGRMNTGSGTDVTYADSLKGQFILTEDVSTSTQFLEAKSLRSEDSAVYYCARE
Salmo salar V156 ighv AGKD04000476.1 1029604 VCCNEMDQSPSQVKRPGDTFKLSCKISGFDMTSYYIHWIRQKPGKALEWIGRMNTGSGTDVTYADSLKGQFILTEDVSTSTQFLEAKSLRSEDSAVYYCARE
Salmo salar V155 igkv AGKD04000238.1 301360 SRGQVTVTQPPVVTFSPGDPVTLTCTTNPKVYKWDSGYEGAFWYQQRPGEAPKLLIKYVKTRLDGIPARFSGSGSERDFTLTISGVQAEDAAVYYCQS
Salmo salar V154 igkv AGKD04000238.1 318962 SRGQVTVTQPPVVTFSPGDPVTLTCTTNPEVRKWDSGNEGAFWYQQRPGEAPKLLIKYAKKLLDGIPARFSGSGSERDFTLTISGVQAEDAAVYYCQS
Salmo salar V153 igkv AGKD04000184.1 1624011 DILLTQTPAVVMVQSGESATISCKASSAIDDDLAWYHQKLGEAPKFIINFNSGFTSGRYQGSGYDIDFTLTISGVQAEDAGDYYCQQHEATP
Salmo salar V152 igkv AGKD04000184.1 1638266 SRGQITVTQTPAVKAVLPGQAVYLTCKTSSSVFGDCHNGQSWGHQCLSWYQQKPGENPKLMMLPGNTLYSGTPSRFSGSGSGSDFTLTISGVQAEDAGDYYCQS
Salmo salar V151 igkv AGKD04000184.1 1654593 SRGQVTVTQTPAVKSVSVGHSVSLSCKTSSAVYSNSNGHYLHWYQQKPGGAPELLIYWAKTLQSGTPSRFSGSGTGSDFTLTISGVQAEDAGDYYCQS
Salmo salar V150 igkv AGKD04000184.1 1678412 SRGQVTVTQTPAVKAVLTGQTVPLNCKTSSDVYQAGTSSPRLAWYQQKPGEAPKLLIYYATTLQSGTPSRFSGSGTHSDFTLTISGVQAEDAGDYYCQS
Salmo salar V149 igkv AGKD04000184.1 1723013 QVTVTQTPAVKAVLPGQAVSLNCKTSSNVYGVGTSSPRLAWYQQKPGGAPKLLIYYATTLQSGTPSRFSGSGTHSDFTLTISGVLAEDAGDYYCQSYHYINSKNV
Salmo salar V148 igkv AGKD04000184.1 1757743 SRGQVTVTQTPAVKSVSVGNSVSLSCKTSSAVYSNSNGHYLHWYQQKPGGAPELLIYLAKTLQSGTPSRFSGSGSGSDFTLTISGVQAEDAGDYYCQS
Salmo salar V147 igkv AGKD04000184.1 1764221 SRGQVTVTQTPAVKTISVGDLVSLSCKTSSAVYSDRHGQRLAWYQQKPGGAPELLIYLAKTLQSGIPSRFSGSGSGSDFTLTISGVQAEDAGDYYCQS
Salmo salar V146 igkv AGKD04000184.1 1797703 QVTVSQTPAVKSVSVGHSVSLSCKTSSAVYSNSNGHYLHWYQQKPGGAPELLIYWAKTLQSGTPSRFSGSGSGSDFTLTISGVQAEDAGDYYCQS
Salmo salar V145 trav AGKD04000097.1 4608996 KNHQRSDYKTVVERPMSDPFHPGDSVTLQCTVLSETCTGEHSVYWFRAGSGESHPGVIYTSGNRSDECEKSPETPSPTQSCVYSLSKNNLGPSDAGTYYCAV
Salmo salar V144 trav AGKD04000097.1 4608996 KNHQRSDYKTVVERPMSDPFHPGDSVTLQCTVLSETCTGEHSVYWFRAGSGESHPGVIYTSGNRSDECEKSPETPSPTQSCVYSLSKNNLGPSDAGTYYCAV
Salmo salar V143 trgv AGKD04000097.1 4876413 VTQCNNVPRHFQVQRVQIGDQVILYCVFSKQVYNEGNMFWFKQVTGEIPHVVAKMQKNQSRPELHKEFRNLHLSIEKAQADGIYCLTIQKMEPMDEAIYYCAY
Salmo salar V142 igkv AGKD04000087.1 809693 SSADIIMTQSPESQSVSPGETVSISCTASSSTGNNLHWYLQKPGEAPKLLVYSGTTRQSGIPGRFSGSGSGSSYTHYTLTISGIQAEDAGDYYCQQGASFP
Salmo salar V220 igkv AGKD04005233.1 11184 SRGQYTVTQTPTVKAVLPGQTVSLNCKTSSNVYSNNRLAWYQQKPGGAPELLIYRATTLQSGTPSRFSGSGSGSDFTLTISGVQAEDAGDYYCQS
Salmo salar V219 trav AGKD04004233.1 5588 CRGDRVLQTKGVETATEGGQITLACHYETDYPSPYLFWYKQGTNDYPKYILMRPKFGTGDNAADFKERFHADLDANSKSVPLTIQRVQLSDSAVYYCALK
Salmo salar V218 trav AGKD04004233.1 10126 DNVKQQPGVVIVTEGGLVTLSCQYNTSANNAYLYWYKQEANDFPKHMLSRYSFGSGDNAAGFKERFDARLDADSKSVPMTIQRVQLSDSAVYYCALQ
Salmo salar V217 trav AGKD04004233.1 16634 DSNGQTIEPIREEVYAPVGRNITLSCTYSSAVSLQWYLQDPGSPPQYILLILHGVGSPSRAPGLDPPLSVKLNDEKNRVDLEISSAKEKDSAMYYCALK
Salmo salar V216 trav AGKD04004233.1 18448 CRAEENVIQPTEDVMVVEGQPTTLTCLFDTTDLSPYLFWYKQQANGNPMFMLREDKFGAGETATEFKERFHARLNVTAKSVPLTIQKVQLSDSAVYYCALR
Salmo salar V215 ighv AGKD04004233.1 20386 GVTRSKREVTAYEGEDVSLNCEYNTSLSAPSLFWYIQSTNDYPEYVLRKDVIGPGDIDDRFKGRFDAHLNSITKSVPLTIQRVQLSDSAVYYCALK
Salmo salar V214 ighv AGKD04003539.1 23578 VQSQTLTESESVVKTFEESHKLTCTYSGFGGNYWNAWIRQAPGKGLEWVATISDSSSNIYYSQSVQGWFTISRDNSKQQVYLQMNSLKTEDSAVYYCAR
Salmo salar V213 ighv AGKD04003539.1 23578 VQSQTLTESESVVKTFEESHKLTCTYSGFGGNYWNAWIRQAPGKGLEWVATISDSSSNIYYSQSVQGWFTISRDNSKQQVYLQMNSLKTEDSAVYYCAR
Salmo salar V212 trav AGKD04003539.1 28729 VFCQTALTQPGSMTLQPGQPLTLSCKVSGYSLTSTSYCTGWVRQPAGKALEWVGEICGSGNIYYSDKLKNKFSISRDTSSSTVTLTGQSLQTEDTAVHYCARQ
Salmo salar V211 trav AGKD04001371.1 703 FCGGVTVKQSPVLSVCREGDVSVTLQCYHDDSSYYYMFWYRQRDNNMKMLTYSLGQGVWEIEPPFEKDVHYTMSRPELTRSTLEIKNLAVGDGAVYYCASST
Salmo salar V210 trav AGKD04001371.1 703 FCGGVTVKQSPVLSVCREGDVSVTLQCYHDDSSYYYMFWYRQRDNNMKMLTYSLGQGVWEIEPPFEKDVHYTMSRPELTRSTLEIKNLAVGDGAVYYCASST
Salmo salar V209 trav AGKD04001371.1 703 FCGGVTVKQSPVLSVCREGDVSVTLQCYHDDSSYYYMFWYRQRDNNMKMLTYSLGQGVWEIEPPFEKDVHYTMSRPELTRSTLEIKNLAVGDGAVYYCASST
Salmo salar V208 trbv AGKD04001371.1 5434 STSGVNFIQHPANLLSIEGESGTLECEHDDAEFYRMFWYKQNTNGNMELVAYSMGTRATDIEPIFDKANYNMIHDEQLKSSLQIKNVKSVDSAVYYCAASS
Salmo salar V207 trbv AGKD04001371.1 10472 HVKCVAFRQSPSLTVKDGREAEIHCSHDDSNLSVMLWYQQRQASPGMTLIGYSYSTTEPNYESLFEERFRLKIQGDLKGTLVISKLTLADSAVYFCAAS
Salmo salar V206 trbv AGKD04001371.1 10472 HVKCVAFRQSPSLTVKDGREAEIHCSHDDSNLSVMLWYQQRQASPGMTLIGYSYSTTEPNYESLFEERFRLKIQGDLKGTLVISKLTLADSAVYFCAAS
Salmo salar V205 trbv AGKD04001371.1 42790 LCLCVEVHQTPSAVFSRPGENIQLFCHHQKTDYRMMLWYQKSQGETALKLIGYLNYNSPTIESSYEKHFKMSGDLGGNGPKNASLNMFNLRQPQHSAVYFCAASK
Salmo salar V204 trbv AGKD04001371.1 42790 LCLCVEVHQTPSAVFSRPGENIQLFCHHQKTDYRMMLWYQKSQGETALKLIGYLNYNSPTIESSYEKHFKMSGDLGGNGPKNASLNMFNLRQPQHSAVYFCAASK
Salmo salar V203 trbv AGKD04001371.1 45016 LSLSVEVHQTPSAVFSRPGENIQLFCHHQKTDYRVMLWYQKSQGETALKLIGYLNFNSQTIVSSYEKHFNMSGDLGGDGPKNASLNMFNLRQTQNSAVYFCAASK
Salmo salar V202 ighv AGKD04000655.1 782802 VHCQVVLTQAEQSVQGTPAGSLKLTCACSGFTLSSTNMYWIRQATGKGLEWIIYYYSEGSKSNAQVVQGRFTASKDSSNFYLHMNLLKSEDSAVYYCARD
Salmo salar V201 ighv AGKD04000655.1 782802 VHCQVVLTQAEQSVQGTPAGSLKLTCACSGFTLSSTNMYWIRQATGKGLEWIIYYYSEGSKSNAQVVQGRFTASKDSSNFYLHMNLLKSEDSAVYYCARD
Salmo salar V200 ighv AGKD04000655.1 792124 VCCDIRLDQSPPQVKRPGDTVKLSCTISGFSMSGYWIHWMRQNQGKALEWIGRMNSNSPYYSDSLKDQFTLTEDVSTSTQFLEAKSLRSEDSAVYYCARE
Salmo salar V199 ighv AGKD04000655.1 792124 VCCDIRLDQSPPQVKRPGDTVKLSCTISGFSMSGYWIHWMRQNQGKALEWIGRMNSNSPYYSDSLKDQFTLTEDVSTSTQFLEAKSLRSEDSAVYYCARE
Salmo salar V198 ighv AGKD04000655.1 792124 VCCDIRLDQSPPQVKRPGDTVKLSCTISGFSMSGYWIHWMRQNQGKALEWIGRMNSNSPYYSDSLKDQFTLTEDVSTSTQFLEAKSLRSEDSAVYYCARE
Salmo salar V197 ighv AGKD04000655.1 796910 VQSQTLTESGPGVKKPGESHKLICTASGLDINGYWMGWIRQAPGKGLEWIAAITGSDGGSTYYPQSVQGRFTISRDNSKQQVYLQMNSLKTEDSAVYYCAK
Salmo salar V195 igkv AGKD04000546.1 120532 SRGQYTVTQTPTVKAVLPGQTVSLNCKTSSNVYSNNRLAWYQQKPGGAPKLLIYYATLLQSGTPSRFSGSGSRSDFTLTISGVQAEDAGDYYCQS
Salmo salar V194 igkv AGKD04000546.1 123349 RGQYVVTQTPTVKAVVPGQTVSLNCKTSSSVYNNDFLAWYHQKPGGAPKLLIYRATTLQSGTPSRFSGSGSGSDFTLTISGVQAEDAGDYYCQS
Salmo salar V193 igkv AGKD04000546.1 125667 SRGQYTVTQTPAVKAVVPGQTVTLNCKTSSDVLANVYVAWYQQKPGGAPKLLIYSATTLQSGTPSRFSGSGSGSDFTLTISGVQAEDAGDYYCQS
Salmo salar V192 igkv AGKD04000546.1 163715 QITVTQTPTVKAVVSGQTVSLNCKTSSDVHANVYVAWYQQKPGGAPELLIYTATSLQSGTPSRFSGSGSGSDFTLTISGVQAEDAGDYYCQS
Salmo salar V191 igkv AGKD04000546.1 166818 SRGQYTVTQIPTVKAVLPGQTVSLNCKTSSNVYYNNRLAWYQQKPGGAPKLLIYLATTLQSGTPSRFSGSGSGSDFTLTISGVLAEDAGDYYCQS
Salmo salar V190 igkv AGKD04000546.1 171833 SRGQYVVTQTPTVKAVVPGQTVSLNCKTSSSVYNNDFLAWYHQKPGGAPKLLIYRATTLQSGTPSRFSGSGSRSDFTLTISGVQAEDAGDYYCQS
Salmo salar V189 igkv AGKD04000546.1 174488 SRGQYVVTQTPTVKAVVPGQTVSLNCKTSSNVYNNNYLAWYHQKLGGAPKLLIYRATTLQSGTPSRFSGSRSRSDFTLTISGVQAEDAGDYYCQS
Salmo salar V188 igkv AGKD04000546.1 178741 QYTLTQTPAVKAVGTGETVNIGCKLSSSIYSNYLAWYLQRSGEAPKLLIYYATTLQSGTPSRFSGSGSGSDFTLTISGVQAEDAGDYYCQR
Salmo salar V187 igkv AGKD04000546.1 195375 SRGQYTVTQTPTVKAVLPGQTVSLNCKTSSNVYSNNLLAWYQQKPGGAPKLLIYYATTLQSGTPSRFSGSGSGSDFTLTISGVLAEDAGDYYCQS
Salmo salar V186 igkv AGKD04000546.1 197874 QITVTQTPTVKAVVSGQTVSLNCKTSSDVHANVYVAWYQQKPGGAPELLIYTATSLQSGTPSRFSGSGSGSDFTLTISGVQAEDAGDYYCQS
Salmo salar V185 igkv AGKD04000546.1 217261 SRGQYTVTQTPTVKAVLPRQTVSLNCKTSSDVYDDDSLAWYQQKPGGAPKLLIYYATTLQSGTPSRFSGSGSGSDFTLTISAVQAEDAGDYYCQS
Salmo salar V184 igkv AGKD04000546.1 226191 SRGQYTVTQTPTVKAVLPGQTVSLNCKTSSNVYSNNRLAWYQQKPGGAPKLLIYLATTLQSGTPSRFSGSGSRSDFTLTISGVLAEDAGDYYCQS
Salmo salar V183 igkv AGKD04000546.1 227930 SRGQYTVTQTPTVKAVLPGQTVSLNCKTSSNVYYNNLLAWYQQKPGGAPKLLIYRATTLQSGTPSRFSGSGSGSDFTLTISGVQAEDAGDYYCQS
Salmo salar V182 igkv AGKD04000546.1 236194 SRGQVTVTQTPTMKTVLPEQTIIINCKTSVTVSFGCTGYYYCMAWYQQKPGGAPKLLMYSSNRLQSGTPSRFSGSGSGSNFTLTISGDQAEDAGDYYCQS
Salmo salar V260 trav AGKD04030344.1 2544 VSSEQVLTPYTDEEVASERDRVTLSCNYTSTGSILWYRQYPKSAPQLLVMEYADITTGFTLNHDKNVKLTDLKISSAEVTDSAMYYCALK
Salmo salar V259 trdv AGKD04030344.1 5173 MVSGDSVTPDKEEYTPTEGSSVSLSCTYETSSNDIYLYWYRHYSNQAPQFLLYKGARSKSDREYIPDERYTSTTSWTSTELVITSLTLADTALYYCAL
Salmo salar V258 ighv AGKD04029882.1 4054 VYCDIELIQSDPVVIKPGKSFSISCKFSGFSISSYCLGWIRQAEGTALEHVGYTCSSSTSTVDSLKSKITSRYDSSSSIVFLQRNNFQTEDTAVYY
Salmo salar V256 trav AGKD04028175.1 1891 CRAEDNVRQPKEDVMVVEGQPTTLTCQFDTTSQSPYIFWYKQLVNGKPIFMLRRDTFSPGEITTEFKDRFHAHLNVTAKSVPLTIQRLQLSDSAVYYCALR
Salmo salar V255 trdv AGKD04028175.1 2912 QIAGEHITHVKHEVISTEGKPVTLSCSYDACSEYLRLYWYKHYPNQAPQFLLYKGARSWRSEHITDKRYKSTTSWTSTELVITSLTLADTALYYCALRDD
Salmo salar V254 trav AGKD04026763.1 1879 CTGDNVKQQPGAVIVTEGGLVTLSCQYNTSANNAYLYWYKQEANDFPKHMLSRYSFGSGDNAAGFKERFDARLDADSKSVPLTIQRVQLSDSAVYYCALQ
Salmo salar V253 ighv AGKD04026474.1 752 VHCQVVLTQAEQSVQGTSGGSLKLTCACSGFTLSSYRMHWIRQAPGQGLQWILHYYSSSDNGYTLVLQGRFTASKDSTNFYLHMTQLKPEDSAVYYCARD
Salmo salar V252 ighv AGKD04026474.1 4106 LNGQSMESIPSSPVLKKPGDTLSLSCKGSGFTFSSHGMHWIRQPAGKALDWMGLIYYDASKTIYSKNIEGSIEVTRDNSNSMVYLKLFGLRAEDSAVYYCARQ
Salmo salar V251 trav AGKD04026252.1 2518 CTGDNVKQQPGAVIVTEGGLVTLSCQYNTSANNAYLYWYKQEANDFPKHMLSRYSFGSGDNAAGFKERFDARLDADSKSVPLTIQRVQLSDSAVYYCALQ
Salmo salar V250 igkv AGKD04025387.1 4075 SSADIILTQSPKSQSVRLGETLSISCTASSSTGNNLQWYLQTHGDTPKLLVYHGTNRQSGIPGRFSGSGSGSSYTHYTLTISGVQAEDAGDYYCQQGGYFP
Salmo salar V249 trav AGKD04025341.1 4845 LSQIDKVQQTPTAILKGPEDNVQLNCSHTIPNYDTILWYQQSAQNTALKLIGYVRFTSPTVEDSFKERFTVSGDAATGKMAYLHIPKLRGTEDSAVYFCAATK
Salmo salar V248 trav AGKD04022874.1 7623 LSQTDKVQQTPTAILKGPEDNVQLNCSHTIPTYNRILWYQQSAQNTALKLIGYVFLTSPTVEDSFKEHFTVSGDAATGKMAYLHIPKLRGTEDSAVYFCAATY
Salmo salar V247 trav AGKD04022854.1 4310 LSQTDKVQQTPTAILKGPEDNVQLNCSHTIPSYNIILWYQQSAQNTALKLIGYVLLTSPTVEDSFKERFTVSGDAATGKMAYLHIPKLRGTEDSAVYFCAATY
Salmo salar V246 trav AGKD04022191.1 3028 QSLSSNVHQTPIAVLKGSKDNVQLTCNHTIQNYYVILWYQQSTGDTAVNLIGYAQYKSITMEKSFEKHFNVIGDGSKEAYLHLLSLRAPEDSAVYYCAAS
Salmo salar V245 trbv AGKD04022191.1 5756 LSQTDKVQQTPTAILKGPEDNVQLNCSHTIPSYNIILWYQQSAQNTALKLIGYVQFTSPAVEDSFKERFTVSGDAATGKMAYLHIPNLRGTEDSAVYFCAASK
Salmo salar V244 ighv AGKD04021642.1 4893 VQGQTLTESGPVVKKPQESHKLTCTASGFTFSSYWMAWIRQAPGKGLEWVSYISSDGGSTYYPQSVQGRFTISRDNSKQQVYLQMNSLKTEDSAVYYCAR
Salmo salar V243 ighv AGKD04021020.1 6698 WRSFPPVQSRKSLEKLSVCPVRYLDIPLPATTHWIRQPAGKSLEWMGFSGLGLGYHAKKFEGRMETTKDTSNSMLTLMLSGVRAEDSAVYYCAR
Salmo salar V242 ighv AGKD04020098.1 3785 VHFQVVLTQAEQSVQGTPAGSLKLTCACSGITLSSIYMNWIRQAPGKGLEWIMFYYSDSSKSNAPVVQGRFTASKDSTNFYLHMSQLNPEDSAVYYCARD
Salmo salar V241 ighv AGKD04020098.1 3785 VHFQVVLTQAEQSVQGTPAGSLKLTCACSGITLSSIYMNWIRQAPGKGLEWIMFYYSDSSKSNAPVVQGRFTASKDSTNFYLHMSQLNPEDSAVYYCARD
Salmo salar V240 ighv AGKD04019515.1 6247 IQGQTLTESGPVVKKTEESHKLTCTGAGFTFSSYWMAWIRQAPGKGLEWIGIIHGTTTYYSQSVQGRFTLSRDDSSSKLYLQMNSLKSEDTAVYYCAR
Salmo salar V239 trbv AGKD04018599.1 4990 SYLSSQVYQNPASLYKNQGESAKMECSHSISSYNRILWYKQSNFRELVLLGYMIATAGYPEAGFGIEGDANAGGTSTLTINQLTPNSSAVYYCAAS
Salmo salar V238 trbv AGKD04018599.1 8269 LSQTDKVHQTPTAILKRPEDKVQLTCSHTDSRYDMILWYQLSAQNTALKLIGYVWNTSPTVEDSFKGRFNVSGEGAANKMAYLHFPKVTEAEDSAVYFCAASK
Salmo salar V237 trav AGKD04017990.1 1088 EEAVDQQSGHVTALEGGLVTISCNYTTSSASPNLFWYIQQTRNSPQYVLRRDRYSKGSNSDEFKKRFDSRLNFTSSSVPLTIQRLQLSDSAVYYCALR
Salmo salar V236 trav AGKD04017990.1 4112 NSFGDSINPATTEELVPEGRNVHLFCKYDGTVYNLLWYRQYPRSKPEFLLYITPEGSIFKATPPPPRLTVSIDKVDKRVDLKISSAEVTDTSLYYCAMK
Salmo salar V235 trav AGKD04017990.1 7922 DSMEQETITPVKPEVNALQGTDITLSCNYKGNVNNLQWYRQYPGSRPECLLWILQSSMSVQKQSIATPRHTGRLNEEKTRVDLMISSVELEDSALYHCALQ
Salmo salar V234 trav AGKD04017833.1 463 LSQTDKVQQTPTAILNGPEDNVQLNCSHTIPTYNRILWYQQSAQNTALKLIGYVQFTSPTVEDSFKERFTVSGDAATGKMAYLHIPKLRGTEDSAVYFCAATY
Salmo salar V233 trav AGKD04017833.1 6104 QSLSSKVHQTPIAVLKGSKDNVQLTCNHTIQSYYVILWYQQSTGDTAVNLIGYAQYKSITMEKSFEKHFSVSGDGSKEAYLHLLSLRAPEDSAVYYCAAS
Salmo salar V232 trbv AGKD04017191.1 3132 LSQTDKVHQTPTAILKGPEDKVQLTCSHTDPRYDMILWYQQSAQNTALKLIGYVRFTSPTVEDSFKGRFNVSGDGAASKMAYLHCPKLTEAEDSAVYFCAASK
Salmo salar V231 trav AGKD04016279.1 14174 CRGDRVLQAKGVETAPEGGQITLVCHYETDDPSPYLFWYKQRANDFPKYMIMWQKCGIGDNDTEFKERFHADLDANSKSVPLTIQRVQLSDSAVYYCALR
Salmo salar V230 ighv AGKD04015510.1 12666 LNGQSMESIPSSPLQKKPGETLSHSCKGSGYTQCEKYGMSWIRQPAGKSLEWIGYTGKYTKSVEGRIEITRDNTICMVYLKLSVLRAEDSAVYYCARE
Salmo salar V229 ighv AGKD04015510.1 20661 VQCEELTQPAFMTVQSGQLLTISCKVSYSVTSVATFWIRQPAGKTLEWIGYINSGGSTAYKDSLKNKFSITRDTSSNTLFLKGQSLQTEDTAVYYC
Salmo salar V228 ighv AGKD04015337.1 11978 VHCQVVLTQAEQSVQGTPGGSLKLTCACSGITLSNTNMHWIRQAPGKGLEWIIYYYSDTYKSNAPVVQGRFTASKDSSNFYLHMSQLKSEDSAVYYCARG
Salmo salar V227 trbv AGKD04012750.1 37767 SSLSNQIYQSPASLYKNQGESAKIKCSHSISSYNVILWYKQSNYRELVFLGYMTAKTANPEVGFGIEGDASAGGTSTLTINQLTPNSSAVYYCAAS
Salmo salar V226 igkv AGKD04012122.1 36436 QVTVTQPPVVTCSPGDPVTLTCTTNPEVYRFSDGDEALSWYQQRPGEAPKLLIIYAKTLLDGIPARFSGSGSESDFTLTISGVQVEDAAVYYCQSYHELND
Salmo salar V225 trav AGKD04006935.1 5805 DSMEQETITPVKPEVNALQGTDITLSCNYKGNVNYLQWYHQYPGSRPECLLWILQTNKYVQNTSITTPRHTGRLNEEKTRVDLMISSVELEDSALYHCALQ
Salmo salar V224 trav AGKD04006935.1 20126 GSYEQTIEPNQHEVYAEVGSNVLLSCNYSSANILLWYKQSPGSAPQYLLLIPHYTGTGQRADSLDSRISGKLNKEKTRVDLDITSAEVTDSALYYCALR
Salmo salar V223 ighv AGKD04006738.1 7762 VHCQVVLTQAEQSVQGTPKGSIKLTCACSGFTLSSTNMYWIRQATGKGLEWIIYYYSDSDKSNAQVVQGRFTASKDSTNFYLHMSQLKPEDSAVYYCARD
Salmo salar V222 ighv AGKD04006524.1 42219 VYGQTLTESGPVVKKPGESHQLTCTASGFTFTSDYMGWIRQAKGKEFEWIGHIHGGTTYYSQSFQGRFTISRDDSSSKLYLQMNSLKSEDTAVYYCAR
Salmo salar V283 trav AGKD04041996.1 2543 VSSEQVLTPYTDEEVASERDRVTLSCNYTSTGSILWYRQYPKSAPQLLVMEYADITTGFTLNHDKNVKLTDLKISSAEVTDSAMYYCALK
Salmo salar V282 trav AGKD04041544.1 2800 VSSEQVLTPYTDEEVASERDRVTLSCNYTSTGSILWYRQYPKSAPQLLVMEYADITTGFTLNHDKNVKLTDLKISSAEVTDSAMYYCALK
Salmo salar V281 trav AGKD04041134.1 2837 VSSEQVLTPYTDEEVASERDRVTLSCNYTSTGSILWYRQYPKSAPQLLVMEYADITTGFTLNHDKNVKLTDLKISSAEVTDSAMYYCALK
Salmo salar V280 trav AGKD04040158.1 2561 CRGDRVLQAKGVETAPEGGQITLVCHYETDDPSPYLFWYKQRANDFPKYMIMWQKCGIGDNDTEFKERFHADLDANSKSVPLTIQRVQLSDSAVYYCALR
Salmo salar V279 trav AGKD04039694.1 1730 SSNEEEIISATTEECVFEGEGVTLSCNYTGSYTTDTLLWYQQYPRSKPEFLLLLTEGGLKTHNESTHPRLSVKLNEDKTHVDLEISSTEVTDSALYYCALR
Salmo salar V278 ighv AGKD04037764.1 2510 VHCQVVLTQAEQSVQGTPAGSLKLTCACSGFTLSSTNMYWIRQATGKGLEWIIYYYSEGSKSNAQVVQGRFTASKDSSNFYLHMNLLKSEDSAVYYCARD
Salmo salar V277 ighv AGKD04037335.1 2762 VHCQVVLTQAEQSVQGTPKGSIKLTCACSGFTLSSTNMYWIRQATGKGLEWIIYYYSDSDKSNAQVVQGRFTASKDSTNFYLHMSQLKPEDSAVYYCARD
Salmo salar V276 ighv AGKD04037053.1 558 VCCAIKLDQSLSHLKRPEDTVKLSCKTSGFTMTSFYMYWIRQEPGKALEWIGRMNSNSPDYSDSLKGQFILTEDVSTSTQFLEAKSLRSEDSAVYYCSRE
Salmo salar V275 trav AGKD04036614.1 1730 SSNEEEIISATTEECVFEGEGVTLSCNYTGSYTTDTLLWYQQYPRSKPEFLLLLTEGGLKTHNESTHPRLSVKLNEDKTHVDLEISSTEVTDSALYYCALR
Salmo salar V274 ighv AGKD04036123.1 558 VCCAIKLDQSLSHLKRPEDTVKLSCKTSGFTMTSFYMYWIRQEPGKALEWIGRMNSNSPDYSDSLKGQFILTEDVSTSTQFLEAKSLRSEDSAVYYCSRE
Salmo salar V273 trbv AGKD04033618.1 76 LSQIDKVQQTPTAILKGPEDNVQLNCSHTIPNYDTILWYQQSAQNTALKLIGYVRFTSPTVEDSFKERFTVSGDAATGKMAYLHIPKLRGTEDSAVYFCAASK
Salmo salar V272 ighv AGKD04033514.1 3991 VYCDIELIQSDPVVIKPGKSFSISCKFSGFSISSYCLGWIRQAEGTALEHVGYTCSSSTSTVDSLKSKITSRYDSSSSIVFLQRNNFQTEDTAVYY
Salmo salar V271 ighv AGKD04032931.1 4126 VYCDIELIQSDPVVIKPGKSFSISCKFSGFSISSYCLGWIRQAEGTALEHVGYTCSSSTSTVDSLKSKITSRYDSSSSIVFLQRNNFQTEDTAVYY
Salmo salar V270 trav AGKD04032388.1 2390 EDSVIQQPGDVIATEGEQVALDCQFDTVDTNPYLFWYKQEANDFPKFMLKRATFGSDNAIEFQGRFDAHLNLTTFKSASKSVPLLIQRLQLSDSAVYYCALR
Salmo salar V269 ighv AGKD04032245.1 287 VHCQVVLTQAEQSVQGTPAGSLKLTCACSGFTLSSTRMHWIRQAPGKGLEWIIYYYSDTYKSNAPVVQGRFTASKDSTNFYLHMSQLKPEDSAVYYCARD
Salmo salar V268 trav AGKD04031843.1 973 VSSEQVLSPYTDVEVASERDRVTLSCNYSSIVNSLLWYRQYPKSAPQLLVMESMDITPGFTLNHDKNAKRTDLKISSAEVTDSALYYCALR
Salmo salar V267 trav AGKD04031843.1 2547 VSYQEEIQPIAKIMHGDEGGFVTLSCNYSGSPYSLQWYRQYPRSAPKFLLLTTVSSNPSVVNATPPYPHLSIKLNKERTRVDLEISSAVVTDSALYYCALQ
Salmo salar V266 trav AGKD04031843.1 3224 LVGDTLEDDITPTSPEEYYLVGSRVKISCNYTVKVNNLQWNRQYPGSAPKFLLLLTDTATPLVVEATPPYPRMTAKLNDERTRVDLEISSAVVTDSALYYCVLE
Salmo salar V265 trav AGKD04031843.1 3836 DSNDQIIEPIREEVYAPAGSNITLSCTYSSAVSLQWYLQDPGSPPQYILLILHGVGSPSRAPGLDPPLSVKLNDEKNRVDLEISSAKEKDSTMYYCALT
Salmo salar V264 ighv AGKD04031814.1 278 VHCQVVLTQAEQSVQGTPAGSLKLTCACSGFTLSSTRMHWIRQAPGKGLEWIIYYYSDTYKSNAPVVQGRFTASKDSTNFYLHMSQLKPEDSAVYYCARD
Salmo salar V263 igkv AGKD04031150.1 5263 QVTVTQPPVVTCSPGDPVTLTCTTNPEVYRFSDGDEALSWYQQRPGEAPKLLIIYAKTLLDGIPARFSGSGSERDFTLTISGVQVEDAAVYYCQSYHELNDKAL
Salmo salar V262 igkv AGKD04030652.1 5263 QVTVTQPPVVTCSPGDPVTLTCTTNPEVYRFSDGDEALSWYQQRPGEAPKLLIIYAKTLLDGIPARFSGSGSERDFTLTISGVQVEDAAVYYCQSYHELNDKAL
Salmo salar V284 igkv AGKD04052811.1 84 SRGQYTVTQTPTVKAVVPGQTVSLNCKTSSSVYNNDFLAWYHQKPGGAPKLLIYRATTLQSGTPSRFSGSGSGSDFTLTISGVQAEDAGDYYCQS
Salmo salar V114 ighv AGKD04632434.1 122 VQGQSLTSSEPVVKKPGESVTLSCTVSGFSMGSYNMHWIRQKPGKGLEWIGRIDTGTGTIFAQSLQGQFTITKDNSKNQLYLEVKSLKTEDSAVYYCAR
Salmo salar V102 ighv AGKD04032953.1 4431 VCCAIKLDQSLSHLKRPEDTVKLSCKTSGFTMTSFYMYWIRQEPGKALEWIGRMNSNSPDYSDSLKGQFILTEDVSTSTQFLEAKSLRSEDSAVYYCSRE
Salmo salar V63 trbv AGKD04003904.1 1790 VSLSKVVYQSPSTLLVEPNASVSVPLSCSHKIPSYNTILWYQRPVGDTALKLIAYVYITSQTVEPSYKGYFDVKGDGRNEAFLHLLKLRQAEDSGEYFCAASY
Salmo salar V261 trbv AGKD04030603.1 541 SSLNSQVHQRPAALYKNQGESAKMECSHSISGYNYVLWYKQSNYRELVFLGYMQLKTGFPEAGFAIEGDANAGGTSTLTINQLTPNSSAVYYCAAS
Salmo salar V257 igkv AGKD04029231.1 5894 QVTVTQPPVVTCSPGDPVTLTCTTNPEVYRFSDGDEALSWYQQRPGEAPKLLIIYAKTLLDGIPARFSGSGSERDFTLTISGVQVEDAAVYYCQSYHELNDKAL
Salmo salar V221 trav AGKD04005696.1 10619 CRAEENVIQPTKDVMVVEGQPIKLTCLFDTTSQSPYLFWYKQQTNSNPMFMLRRDTFGAGETATEFKERFHARLNVTAKSVPLTIQRVQLSDSAVYYCALR
Salmo salar V196 ighv AGKD04000655.1 796910 VQSQTLTESGPGVKKPGESHKLICTASGLDINGYWMGWIRQAPGKGLEWIAAITGSDGGSTYYPQSVQGRFTISRDNSKQQVYLQMNSLKTEDSAVYYCAK
Salmo salar V181 igkv AGKD04000546.1 241821 SRGQYTLTQTPAVKAVGTGETVNIGCKLSSSIYSNYLAWYLQRSGEAPKLLIYQINNKFTGTPSRFSGSGSGSDFTLTISGVQAEDAGDYYCQS
Salmo salar V180 igkv AGKD04000546.1 253729 SRGQYTVTQTPAVKAVVPGETVSLNCKTSSNVYSNNYLSWYQQKPGGAPELLIYYATTLQSGTPSRFSGSGSGSDFTLTISGVQAEDAGDYYCQSYHSSGHV
Salmo salar V0 igkv AGKD04486071.1 147 QSLSSKVHQTPTAILKGSKDNVQLTCNHTIQNYIMILWYQQSTGDTAVNLIGYAQYKSITMEKSFEKHFSVSGDGSKEAYLHLLSLRAPEDSAVYYCAAS