WGS Statistics
Organism WGS Record. Vs Total IGHV IGLV IGKV TRAV TRBV TRGV TRDV
Dasypus novemcinctus AAGV00000000.3 (AAGV03) 404 105 66 114 52 45 17 5
Vgene Table
Organism Vgene Locus contig Contig Pos. AA sequence
Dasypus novemcinctus V9 igkv AAGV03006342.1 389 ASGDIMMTQSPGSVAASAGETITLKCKASQSVSSYVAWYHQKPGQAPKLLIYRASNRPSGVPDRFSGSGSGTDFTLTISRFQPEDLGNYYCQQHSSYP
Dasypus novemcinctus V13 iglv AAGV03007791.1 327 CADSAILPLLISWNNGQTSCTLSSDVSVGSIHMYWYQQKPGSPPRYLLRYKSDSDKHQGSGVPSRFSGAKDTSANAGLLLISGLQPEDEADYYCSI
Dasypus novemcinctus V32 trbv AAGV03018537.1 5721 PLPKGAVNSEVIQIPRYLIKAKGQHVTLRCSPKSGHNTVYWYQQALGQGFQFLLRYDVGKETEKGNIPDRFSGLQFGDYRSELNVSSLQLEDSALYLCASSL
Dasypus novemcinctus V35 trbv AAGV03020978.1 1999 AVGSGVLQTPRHLIRTKGQEMTLKCSPKSGHNTVYWYQQVLGKGPQFLVQYYKGEEIDRGNIPNRFSGQQFSDSRSELNINSSQLEDSALYLCASSL
Dasypus novemcinctus V36 trbv AAGV03020979.1 12395 AVNSEVIQIPRHLIKAKGQHVTLRCSPKSGHNTVYWYQQALGQGLLFLVQYINGKENGKGNILDRFSGLQFSDYRSELNMSSLQLEDSALYLCASSL
Dasypus novemcinctus V37 trbv AAGV03020979.1 15590 AVDSEVIQKLSHLIKAKGQQVTLKCSPMPGHKNVYWYQQANGQGPQFLVRYYNGEERDKGNILDRFSGLKFGDSRSELSVSSLQLEDSALYLCASSL
Dasypus novemcinctus V38 trbv AAGV03020982.1 5055 PVDSGVTQTPKHLVKARGQNVTLSCSPISGHFSVSWYQQALGQGPQFLVQYYNTNERDKGNIPDRFSGVQFGDFRSEFTVSSLQLEDSALYLCASSL
Dasypus novemcinctus V39 trbv AAGV03020984.1 2684 HTGAGVSQSPRHRIAASGQPVALRCDPIPGHAALIWYQQTLGQDPEFLIYFQNKDITDESGMPKDRFSAQRPNGSYSILKINSAKRGDSAVYLCASSS
Dasypus novemcinctus V40 trbv AAGV03020984.1 7085 PLDTAVSQTPRHLVTKKGNKESLKCEQNLGHDSMYWYKQDSSKLLKIMFIYNNKELILNETVSSRFLPKSPDKAHSTLHINSLELGDSATYFCASSK
Dasypus novemcinctus V41 trbv AAGV03020984.1 11243 SIDPGINQVPKYLVIGREYKKSLKCEQRLGHNAMYWYKQNPKKPLELMFAYNIKDLVENNTVPSRFSPQSPGNSSLYLYVDHLEPDDSATYFCASSK
Dasypus novemcinctus V42 trbv AAGV03020984.1 12950 HTETGVSQTPSHSITESGQRVALRCGIISGHLYLYWYHQNPEKGVEFLISFYNKIPSEKADFFKDRFSAEMLDGSSSILKIQPAQLGDSATYLCASSS
Dasypus novemcinctus V43 ighv AAGV03020995.1 1343 VLSQVQLQESGPGLMKPSQTLSLTCKVSGFSITTSGYCWDWIRQPPGKGLQFLSRICASGNSYYNPSLKSRLSTSSDTSKNQFSLQLSSVTAEDTAMYYCTR
Dasypus novemcinctus V52 ighv AAGV03023516.1 2207 PGLLTPSQTLSLTCSVSGFPITTSDYCWHWIRQPPGKGLQWLSRICYDGSTNYNPSLKSRLSTSRDTSKSQFSVRLTSMTAEDTVVYYCARDTQ
Dasypus novemcinctus V57 trbv AAGV03024647.1 49 HTETRVSQTPSHSITESGQRVALRCGIISGHLYLYWYRQNPGKGVEFLISFYNKIPSEKADFFKDRFSAEMLDGSSSILKIQPAQLGDSATYLCASSS
Dasypus novemcinctus V67 trav AAGV03032445.1 6027 TLSLAKVTQPISMYSYEGQEVNISCNHTNIATNEYIFWYQQYPKEGPRFIIQGYKTTVANEVATLFVPKDRKSSTLSLHRVALRETAVYYCVVS
Dasypus novemcinctus V68 trav AAGV03032446.1 3602 GAGAQAVTQPDVLVAAFEGTPLKLRCNYSSSVPPYLFWYVGYPNQGLQLLLKYTSGSSFVKGIKGFEAEFRKSETSFHLKKPSAYLGDSAEYFCAVS
Dasypus novemcinctus V69 trav AAGV03032447.1 21932 GTTGDSVTQTAGLIILPEGAPLPLNCTYQTTSSVFLFWYVQHQNKALQLLLKSSLENQEMDSRGFQATHVKSDSSFHLKKLSVQMSDLAVYYCVLS
Dasypus novemcinctus V70 trav AAGV03032447.1 43147 LSGEDRVEQHPQILRPQEGDRSSLNCSYSVSNFQGLQWYRQDPGKGPELLLLLYSVGDEKQKERLTATLSKKESFLHISDSTPEDSATYFCAVK
Dasypus novemcinctus V71 trav AAGV03032447.1 50355 VNSQVEQSPQALNIQEGENATMNCSYKTSIESLQWYRQDSGRGLSLLILIRTNEREKLSGRLRATLDTSTQFSSLFIMASQTADTTAYFCAVD
Dasypus novemcinctus V72 trav AAGV03032447.1 55826 KTTGDSVTQTADLIVLPEGAPLTLNCTYQTSYSAFLFWYVQHQNKALQLLLKSSLENQEMDSRGFQATHVKSDSSFHLKKSPAQMSDSAVYYCVLR
Dasypus novemcinctus V73 trav AAGV03032447.1 61154 VIGEDRVEQSPRFLRPQEGDLTSVSCTYTGSGFNSLQWYRQDVGMGPQHLFSMYSSGDEKQKGRLRATLLQKASSLHITALQPGDSATYFCAVA
Dasypus novemcinctus V74 trav AAGV03032447.1 74835 DARAQSVTQPQVHVSISEGASLELRCNHSFGGITYLYWYVQYPSRGLQLLLRYFSGDTLVKGINDFEAEFRKNESSFNLRKPSIHWRDSAEYFCAVS
Dasypus novemcinctus V75 trav AAGV03032448.1 3187 RSKGDSVTQTEGQLTLSEGTWLTVNCSYKTTQYPALFWYVQYPGEGPQLLLKAAKDKEKGRSKGFEATYNKEATSFHLEKASVQESDSAVYYCALS
Dasypus novemcinctus V76 trav AAGV03032451.1 1559 DARGQTVTQPQVHVSVFEGSSLKLRCNYSYGATPYLFWYVQYPSQGLQLLLKSLSGDNQVKGIKGFEAEFQKSESSFTLRKPYVHWSDSAVYFCALS
Dasypus novemcinctus V77 trav AAGV03032456.1 6525 VIRGEKVEQQPSNLNVQEGSNPVINCTYSDSASVYFLWYKQEPGKGPHLIIDIRSNLNEKQGERLALLLNKKDRHLSLHIVTAHPGDSATYFCAAS
Dasypus novemcinctus V78 trav AAGV03032456.1 12528 FIVAQKVTQVQPAMLVQEKETVILNCTFDSRDPNYSLFWYKQPSSGEMIFLIRQDSYNQQNAAEGRYSVDFHKATKSIDLVISASQLGDSAVYFCALNE
Dasypus novemcinctus V79 trav AAGV03032456.1 23288 GTRGDSVTQMEGQVILSEGAVLTINCTYTASRYPALFWYVQHPGEGPQLLLRAMKDSEKASSKGFEATYDKETRSFHLEKAAAQESDSAVYYCALS
Dasypus novemcinctus V80 trav AAGV03032457.1 2768 VRGKNQVEQSPQSLIILEGDICILQCNYTVSPFNNLRWYKKDTGSRPVSLTIMNYSDSKKSIGRYTVTLDANAKHSSLHITDVQPRDSASYICAVS
Dasypus novemcinctus V81 trav AAGV03032457.1 15592 DARAQSVTQPQVYVSVSEGKSLELRCSYSYSGTPYLFWYVQYPSRGLHLLLKYSLGDNLVKGLKGFEAEFQKSDSSFNLRKTSAHWSDSAVYFCALT
Dasypus novemcinctus V82 trav AAGV03032457.1 41827 SSVAQKVTQAQPAMLVQEKETVTLNCTYDTKDGTYGLFWYKQPSSGEMIFLIRQESYNQQNAAEGRYSVDFHKATKSIDLVISASQLGDSAVYFCALNE
Dasypus novemcinctus V83 trav AAGV03032457.1 57933 GTRGDSVTQMEGQVMLSEGAFLTMNCTYTATGYPALFWYVQRPGEGPQLLLRAMKASEKASSKGFEATYNKETSSFHLEKAVAQESDSAVYYCALS
Dasypus novemcinctus V84 trav AAGV03032461.1 1555 GAWAQAVAQPDVLVAVSEGAPLELRCNYSASVLPALFWYVQYPNQGLQLLLKYVTGDTMVKGIKGFEAEFRKSATSFPLRKASAQWGDSAVYFCLLK
Dasypus novemcinctus V85 trav AAGV03032461.1 19155 DARAQSVTQPQVYVSVSEGDSLELRCSYSYSGSLYLCWYVQYPSRGLQLLLKYVSGNNLVKGIKDFEAEFQKSDSSFKLRKLSAHWSDSAVYFCALS
Dasypus novemcinctus V86 trav AAGV03032462.1 11569 VSQGEKVEQQPSNLNIQEGSSFVINCTYSDSASDYFCWYKQKPGKGPHLIIDIRSNLNEKQSERLTVLLNKKDKHLSLHIAAAHPGDSATYFCAAS
Dasypus novemcinctus V87 trav AAGV03032462.1 16767 SSVAQKVTQVQPATLVQEKETVTLKCTYDTNYQTYGLFWYKQPSSGEMIFLIRQESYNQQNAAEGRYSVKFHKATKSIDLVISASQLGDSAVYFCALSE
Dasypus novemcinctus V88 trav AAGV03032462.1 23620 GTRGDSVTQMEGQVMLSEGAFLMMNCTYTTTGYPALFWYVQRPREGPQLLLRATKPSEKASSKGFGATYNKETSSFHLEKAAAQESDSAVYYCALS
Dasypus novemcinctus V89 trav AAGV03032464.1 2820 VRSQQRAVKQSPASLRVPEGTIASLNCTYEDRTSQYFAWYKQGSGKGPELLMVTYSNGDQKEGRFTAHLNKASQYLSLLITDSQPSDSATYLCAA
Dasypus novemcinctus V90 trav AAGV03032465.1 3661 DARAQSVTQPQVHVSVSEGDSLELRCSYSYSGTPYLFWYVQYPRQGLQILLKHVSGDNLVKDLKGFEAEFQKSESSFNLRKHSVLWSDSAVYFCALS
Dasypus novemcinctus V91 trav AAGV03032465.1 19637 SSVAQKVTQVQPAMLVQEKETATLNCTFDTGEARYGLFWYKQPSSGEMIFLIRQDSYNQQNAAEGRYSVNFHKATKSINLVISASQLGDSAVYFCALSE
Dasypus novemcinctus V92 trav AAGV03032469.1 4815 VNSQVEQSPQAMNIQEGENTNMSCSYKTSINNVQWYRQDSGRGLSLLILIRTNEREKLSGRLTATLDTSTKISLLFITTSQTADTAAYFCAVN
Dasypus novemcinctus V93 trav AAGV03032470.1 730 DARAQTVTQPQVHVSVSEGDSPELRCNYSYGATPSLFWYVQYPRRGLQLLLKYVSGNNLVKGIKEFEAEFRKSDSSFNLRKSSAHWSDSAVYFCALS
Dasypus novemcinctus V94 trav AAGV03032471.1 5935 VSGGEKVEQQPSNLNVQERSSPVINCTYSDSNSDYFPWYKQEPGKGPHLIIYIRSNDDKKQDERLTVSLNKKDKHLSLHIAAAHPGDSGTYFCAAS
Dasypus novemcinctus V95 trav AAGV03032472.1 9276 GTRGDSVTQMEGQEMLSEGAFLTINCTYTATGYPALFWYVRHPGEGPQLPLRATKPSEKASSKGFGAIYNKETSSFHLEKATAQESDSAVYYCALS
Dasypus novemcinctus V99 ighv AAGV03036234.1 24484 VLCEVQLVESGGDLRQPGGSLRLSCSGSGFNFGGNSMNWVRQAPGKGLEWVSYISYNGGSTNYADSVKGRFTISRDNNKNQLYLQMNNLKPEDTALYYCTS
Dasypus novemcinctus V100 ighv AAGV03036240.1 26358 VLCEVQLVESGGDLRPPGGSLRLSCLASGYTFDNYYMSWVRQAPGKGLEWVSYINYGGGSTYYADSVKGRFTISRDNNKNQLYLQMNNLKPEDTALYYCAR
Dasypus novemcinctus V101 ighv AAGV03036251.1 11559 VLCEVQLVESGGDVRPPGGSLRLSCSASGFTFANSGMSWVRQAPGKGLEWVSYITSSGGSTYYADSVKGRFTTSRDNNKNQLYLQMSNLETEDTARYYCAR
Dasypus novemcinctus V108 igkv AAGV03041298.1 6848 TSGDIVMTQSPSSVAASAGETITLKCKASQSVYSSLHWYHQKPGQAPKLLIYGASTRPSGVPDRFSGSGSGTDYTLTISRFQPEDLGDYYCQQGSSYP
Dasypus novemcinctus V109 ighv AAGV03041499.1 3968 VMSQVQLKESGPELVNPSQTMSITCKASGFSLTDYHIHWIRQAIGERLEWVSKISSGGSTNYNPTLQSRLSITRDTSKNEVYLKLSGMGTEDTARYYCAR
Dasypus novemcinctus V110 ighv AAGV03041506.1 30390 VLCEVQLVESGGDLRQPGGSLHLSCSASGFTFNDCYMSWVRQTPEMGLEWVASINSGSSYIYYADSVKGRFTTSRDNDKNQLFLQMNGLKPEDTAHYYCVK
Dasypus novemcinctus V111 ighv AAGV03041525.1 6696 ILCQVQLMESGGDLRKPGGSLHLSCSGSGFTFSNYDMKWVRQAPGKGLEGISYISSSSGRSIYYADSVKGRFTASRDNNNNKLYLQMNSLKPEDTATYYCAR
Dasypus novemcinctus V118 iglv AAGV03044607.1 5175 SWAQSVLTQPPSASGALGQRISISCSGSSTNIGKGNSVYWLQQLSGTSPRLLVYANSSRPSGVPDRFSNSKSGTSGTFTITELRPEDEANYYCSVWDSSISA
Dasypus novemcinctus V119 iglv AAGV03044609.1 4551 FWAQSGMTQEDSVLGSLKGSVTLTCRANTSRTTIPIVGAGWYQMHPGGALKTMMLGITQPSGISARFSGSKSGHMASLTVLSLQPEDETVYYCSAVDSRTRT
Dasypus novemcinctus V120 iglv AAGV03044612.1 38952 SWAQSVLTQEASVSGSLGGTVTINCQDSSGSTSIGVFGAGWYQKHPGGAPKTVMLGDTRPSGIPDRFSGSYSDDTASLTITGLLPEDEADYYCSGVD
Dasypus novemcinctus V121 iglv AAGV03044618.1 7951 SLSQTVVTQPPSFSSSPGTTARLPCTLSSVVSVGDKNIYWYQQKPGSPPRYLLRYKSDSDKHQGSGVPIRFSGAKDTSANAGLLLISGLQPEDEADYYCSI
Dasypus novemcinctus V124 ighv AAGV03045694.1 9014 VLCEVQLVESGGDLRQPGGSLHLSCSASGFTFASYDSSWVRQAPEKGLEWVSYISKSGSIYYADSVKGRFTIFRDNKNQLHLQMNSLKAEDTARYYCV
Dasypus novemcinctus V128 ighv AAGV03047148.1 4581 VLCEVQLVESGGDLRPPGGSLRLSCSASGFTFSSYGMSWIRQAPGKGLEWVSTISYNGGSTYYADSVKGRFTISRDNNKNQLNLQMNSLKSEDTALYYCAK
Dasypus novemcinctus V139 igkv AAGV03051415.1 1029 ASGDIVMTQTPGSVAASAGETVTLKCKASQSVSNYLSWYHQKPGHVPKLLVYLAINRPSGVPDRFSGSGYGTDFTLTINGVQDEDLGMYYCQQGDTTP
Dasypus novemcinctus V149 ighv AAGV03055586.1 1393 VLSQVQLKESGQELLKPSQTLSLTCSVSGFSITTSGYCWDWIRQAPGKGLQWLSSICYEGSTYYNPSLKSRLSTSRDTSKNQFSVQLTSVTAEDTAVYYCAR
Dasypus novemcinctus V152 igkv AAGV03055860.1 38014 ASGDIVMTQSPDSLTVSPGETVSIFCKSSQSILYSTNQKNYLAWYQKKPGQAPKLLISWASTRASGVPDRFSGSGSAKDFTLTISRFQAEDVGEYFCQQHY
Dasypus novemcinctus V153 igkv AAGV03055873.1 6802 ASGDIVMTQSPDSLTVSPRETVTIFCKSSQSILYSTNQKNYLAWYQKKPGQVPKLLISWASTRASGVPDRFSGSGSAKDFTLTISRFQAEDVGEYFCQQHYSSP
Dasypus novemcinctus V154 igkv AAGV03055882.1 12876 ASGDIVMTQSPGSVAVSAGETVTLKCKASQSVSNYLSWYHQKLGQAPKQLIYRASNRPSGVPDRFSGSGSGTDFTLTINGVQDEDLGTYYCQQWSTSP
Dasypus novemcinctus V155 ighv AAGV03055909.1 3330 VLLQLQLQKSGPGLMKPSQSLSLTCTVSGYSLADNNVNWIHHAPGKGMECAAIIWSDGSTDYKSNLQSHVNINRDTNRKKVNLKFNNMIAEDMTTYYCG
Dasypus novemcinctus V157 ighv AAGV03057796.1 626 VLSQVQLQESGPGLVKPLQTLLLNCKVTGFSLTEYYVLWFRQSPGKGLEWIGRIRPDGSTDRNPTLQSRLSITRDTSKNEVYLKLSNLQAQETAKYYCAE
Dasypus novemcinctus V164 iglv AAGV03059994.1 316 SADSAVLPLSICRNSARLNCSLSSGFNMGDFRICWYQQKLGSNTLYPLSYHIDSDKHQGSGVLSCFSGAKNASASAGFLSISGLQHEDKSEYYCNIRL
Dasypus novemcinctus V165 iglv AAGV03060001.1 1683 CWTQSVLTQEASVSGSLGETVTLTCKGSSSTTSISILGAGWYQQHPGGAPKTIMGGTIRPSGIPDRFSGSKSGNTASLTITGLQAEDEAAYFCSAFDT
Dasypus novemcinctus V166 iglv AAGV03060011.1 1258 SWAQSVLTQEASVSGSLGETVTLTCKGSSSTTSISIVGAGWYQQHPRGAPKTVMLGTTRPSGIPNRFSGSKSGNTASLTIAGLQAEDEAAYFCSEIDF
Dasypus novemcinctus V168 iglv AAGV03060013.1 7145 SWAQSVLIQEASVSGSLGGTVTLTCKGSSSTTSISIVGAGWYQQHPGGAPKTVMLGTTRPSGIPNRFSGSKSGNTASLTIAGLQAEDEADYFCSTFGR
Dasypus novemcinctus V169 igkv AAGV03060087.1 790 ASGDIVMTQSPDSLAVSPGETVSIFCKSNQSILYSNDKKNYLAWHQKKPGQVHKLLISWASTRASGVPDRFRGSGSATDFTLTISRFQAEDVGEYYCQQCYSYP
Dasypus novemcinctus V185 ighv AAGV03068938.1 1996 VLSQVQLQESGPGLVKPSQTLSLTCSVSGFSITTSGYCWDWIRQPPGKGLQWLSSICASGNSYYSPSLKSRLSTSSDTSKNQFSLQLSSVTAEDTATYYCAR
Dasypus novemcinctus V190 trbv AAGV03074182.1 88716 VRAQTIQQWPAAKVQLVGSPVSLECTVKGVSIPTLYWYRQDTGNVLQLLFYSISLGQVNFERPQNLSASRPQDSQFILSSKKLLLSNTGYYLCAWS
Dasypus novemcinctus V203 iglv AAGV03083462.1 1541 ADSQTVVVQEPSLSVSVGGTVTLTCGISSGSVSTSQYPSWYQQTPGQAPHMLIYSTSSRPSGVPNRFSGSISGNKAALTITGAQLEDEAEYHCALYAGSYR
Dasypus novemcinctus V210 trbv AAGV03091470.1 1158 PADAGITQTPKYKVMRTGQDMTLRCTQNMNHDSMYWYRQDPGLGLRLIHYSVDVGVTDKGEVPDKYNVSRTNKMHFPLLLESASASQTSVYFCASSD
Dasypus novemcinctus V217 ighv AAGV03095860.1 1089 VLSEVQLVESGGDLRPPGGSLHLSCSASGFTFKDYAMHWVRQAPGKGLEWVSAISSSGGTTNYADSVKGRFTISRDNNRNQVYLQMNGLKTEDTALYYCAK
Dasypus novemcinctus V221 ighv AAGV03096948.1 5719 VLCDVQLVESGGDVRKPGDSLTLSCRASGFTFTDYAIHWVRQAPGQGLERVAQVSKPSGSSQWYSPSVQGRFTISRDNPTSTASLKMTNLKEEDTAVYYCV
Dasypus novemcinctus V222 ighv AAGV03096954.1 4682 VLSELTLKESDPGLVKPSQTLSLTCSVSGGSVTNSDYCHWIRQSPGKGLECLVHWSGGPNYNPAFQGRISITADTSKNVYYLQLSSMRTEDTAKYYCA
Dasypus novemcinctus V235 iglv AAGV03102901.1 838 CMVQMSLTQPPSVSQDPGQMVKITCSGNSNNVGNQGAAWLQQHPGQVPRLLTHRNNNRPPGISERFSGSRSDNVATLSISGVQPADEAEYYCSAWDSSLGA
Dasypus novemcinctus V236 iglv AAGV03102904.1 223 SLSQTVLTQPPSLSSSPGTTARLPCTLSSDVSVRGYYIYWYQQKPGSPPRYLLWYKSDSDKHQGSGVPSRFSGAKDTSANAGLLLISGLQPEDEADYYCSI
Dasypus novemcinctus V237 iglv AAGV03102906.1 9155 SLSQPLVTQPPSLSSSLGTTARLTCTLRSDVSVGGYRIYWYQQKPGSPPRFLLRYKSDSDKDQGSGVPSRFSGAKDTSANAGLLLISGLQPEDEADYYCSI
Dasypus novemcinctus V239 iglv AAGV03102919.1 1242 SWAQSGLTQETSMSGSAGQKVTLTCTKNSQNIETYSIGWYQQLPGGTPKTVMLGTTRPSGIPARFSGSVSGLTSSMSISDLQPGDEGFYYCSTWDNSGK
Dasypus novemcinctus V240 iglv AAGV03102927.1 1346 TASLAVVTQEASLSVSPGGTVTLTCGSSAGPVTTSNYACWVQQKPYQTPRSLIYNTNNRNTGVPARFSGSLLGNKASLTITGAQPEDEAEYYCAL
Dasypus novemcinctus V255 ighv AAGV03108245.1 5769 VLSELTLKESGPGLVKPSQTLSLTCSVSGGSITSSNYIWNWIRQSPEKGLEWMGYWYQSGSTYYNPAFQGRISITADTSKNEYYLQLSSLITEDTAKYYCAR
Dasypus novemcinctus V256 ighv AAGV03108261.1 8632 VLCEVQLVESGGDLRQPGGSLQLSCSVSGVTFSNYDMHWVRRAPGKGPEWVSCIGTGVTTYYADSVKGRFIISRDNNKNQLYLQMNSLKPEDTATYYCVS
Dasypus novemcinctus V257 iglv AAGV03108597.1 840 SWAQSVLTQEASMSGSLGGTITLTCKDSTSSTIIRVRGAGWYQQHPEGAPKTVMLGTTRPSGIPDRFSGSKSGNTASLTITGLQAEDEADYFCSAFDS
Dasypus novemcinctus V258 iglv AAGV03108623.1 56240 SMASYERTQPHSVSVALGQTARLNCGGDSIEDKIVQWFQQKEGEAPVLLIYGDSSRPSGIPDRFSGANSGNMATLTITGAEAGDEADYYCQVLDSDSSA
Dasypus novemcinctus V259 iglv AAGV03108626.1 8295 SVASYVLTQPQSVSVALGQTAKINCGGDNIGNEVVHWYQQKAGQAPALVIYSDSERPSGIPDRFSGTNSGNTATLTISGTQAMDEADYYCQVWDSNND
Dasypus novemcinctus V260 iglv AAGV03108631.1 55779 SVASYELTQPRSVSVALGQTARLDCGGDNIGGKSVQWYQQKESQVPVLLIYSDDSRPSGIPDRFSGANSGNTATLTIAGAEAGDEADYYCQVWDGSSSA
Dasypus novemcinctus V261 iglv AAGV03108633.1 14897 FVASYELAQPRSVSVALGQTARLNCGGDSIEDKNVQWYQQKESQAPVLLIYVDSNRPSGIPDRFSGTNSGNTATLTISSAEAGDEADYYCQVWDSDSS
Dasypus novemcinctus V262 igkv AAGV03108974.1 7626 ASGDIVMTQSPGSVVASAGETVTLKCKASQSVSNYLAWYHQKPGQAPKVLIYRASNRPSGVPDRFSGSGSGTDFTLTISRFQPEDLGDYYCQQGSSHP
Dasypus novemcinctus V264 ighv AAGV03109630.1 2292 VLSELTMKESGPGLVKPSQTLSLTCSVSGGSISSSSYTWDWIRQSPEKGLEWMGYWYQSGSTYYNPAIQGRISITADTSKNAYYLQLSSLTTEDTAKYYCAR
Dasypus novemcinctus V279 trbv AAGV03115175.1 3663 SIDPGNNQVPKYLVIGREYKKSLKCEQSLGHNAMYWYKQNPKKPLELMFAYNIKDLIENNTVPSRFSPQSPGNSSLYLHLDHLEPDDSAMYFCASSK
Dasypus novemcinctus V280 ighv AAGV03115304.1 13699 VLCEVQLVESGGDLRQPGGSLRLSCSASGFNFPSYYMYWVRQAPGKGLEWVSYISGDGSSTSYADSVKGRFTISRDNNKNQLYLQMNGLKTEDTALYYCTS
Dasypus novemcinctus V281 ighv AAGV03115306.1 15158 ILCEVQLVEAGGDLRQPGGSLRLSCSASGFNFANYYMYWVRQVPEKGLEWLSYISGNGGSTKYADSVKGRFTTSRDNNKNQLYLQMNGLKTEDTALYYCAL
Dasypus novemcinctus V282 ighv AAGV03115314.1 1573 VLCEVQLVESGGDLRQPGGSLRLSCSASGFNFGSTYMSWVRQAPGKGLEWLSEISGNGGSTYYADSVKGRFTTSRDNNKNQLYLQMSGLKTEDTALYYCTT
Dasypus novemcinctus V283 ighv AAGV03115316.1 27432 VLCEVQLVESGGDLRQPGGSLRLSCSASGFNFGSTYMSWVRQAPGKWLEWVSYISSNGGSTYYADSVKGRFTTSRDNNKNQLYLQMNGLKTEDTALYYCAR
Dasypus novemcinctus V285 trav AAGV03116048.1 298 GLQVMQNPPVLRVQEGGISILKCDYSNSIYDYFHWYKKYPAKSLAILASISSLVDKNEDGRFAVFLNKSAKHLSLHIAASQLGDSALYLCAAS
Dasypus novemcinctus V286 trav AAGV03116048.1 4089 VRSQEPEQSPQSVIIQEGEDVTINCNSSKTLYSLQWYRQKHGERPIFLMMLLKSGEEKNNDKIVAKFNEKKQQSSLYITVSQPSHSGTYFCGAA
Dasypus novemcinctus V303 trgv AAGV03121492.1 34713 SQTASNLEWSGSSVTEQVGKFAIFTCDIVKQNTNYVHWYRHQEGEAPKRILYYSLLSSKFLVDSGISQRKYHAYEGTVRSCKFLVRNLEKSDSGMYYCAAWD
Dasypus novemcinctus V304 trgv AAGV03121497.1 7075 SQTAFNLEWSGKSFTKQTGKFATIPCDIVKENIDYVHWYQHQEGEVPKRILYYSFLSSKFSVDSGISQGKYHASESTGRSCKFVVRNLEKSDSGVYYCAAWD
Dasypus novemcinctus V305 trgv AAGV03121501.1 14961 SQTASNLEWSGRSVTKQAGKLAIFSCDIVKQNTNYIHWYQHQEGKAPKRILYYSFLSSKFSVDSETNQAKYHAYESTRRSCLLTVQNLEKSDSGVYYCAAWD
Dasypus novemcinctus V306 trgv AAGV03121505.1 406 FLEQPRLSTTKQLLKTARLECVVSGVTISAISMHWYRERPGQALKHLLYITSGNIVKLGSGIPKDKFEVDKIPETSTSTLTIHNVEKQDSATYYCATWD
Dasypus novemcinctus V307 trgv AAGV03121507.1 14398 RYTASNLEWRERSVTKQAGASAVITCDIVKQDINYIHWYGHQDGEAPKHILYYHFASSQFWVESGIHQGKYHAYEGSERSCKFAVLNLEKSDSGVYYCAAWD
Dasypus novemcinctus V308 trgv AAGV03121510.1 4892 GLELLKLEQSHMSVSTALKKSANIYCHVSGTNFDGEVIHWYRQKPNQPVEHLMYIGSTKTRTVERFVARKESTSSTATLTVKFIKEDDVAIYYCAVW
Dasypus novemcinctus V309 trgv AAGV03121512.1 2296 CQTASNLEWRGRAVTKQTGATVLITCDIVKEKIDYVHWYRHQEGEAPKRILYYSFSTSKFSVDLGINQGKYEAYEILGRSNKLVVLNLEEDDSAVYYCAIWD
Dasypus novemcinctus V310 trgv AAGV03121515.1 9867 GLGLLKVEQSQISVSIALKKSAIIYCQISGTDFDGEVIHWYRQKLNQPIEHLLSIGSTNTQTVQRFVGKKESTSSTATLTIKFTEKDDMAIYYCAVW
Dasypus novemcinctus V311 trgv AAGV03121515.1 22439 SQTASNLEWSGRTVTNQAGKFAVFTCDILKEHINYVHWYQHQEGEAPKRILYYSFSSLMFSVASGISQWKYQAHQHLGRSCNFVVHNLEESDSAVYYCAVWD
Dasypus novemcinctus V312 trgv AAGV03121516.1 12257 GLGLLKVEQSQISVSIALKKRAIIYCHISGTTFDTKAIYWYRQKLNQPVEYLIYIDTTKIQTVQKFVAKKDSTSSTATLTVTFTEKDDVAVYYCAVW
Dasypus novemcinctus V313 trgv AAGV03121518.1 11109 SQTASNVEWRERPVTKLAGATAIIPCDIVKEHINYIHWYRHQDGKAPKRILYYSFSSSMVSVDSGISQRKYQAYTGSKRSCKFLVLNLEESDSGVYYCAVWE
Dasypus novemcinctus V314 trgv AAGV03121521.1 8344 IQTASNLEWRERSVTKLAGATVVITCDIVKENINFVHWYRHQEGEAPKRILYYSFSTSTFTVDSGIEQGKYHASRGVGRSCKILIRNLEESDSVVYYCAVWD
Dasypus novemcinctus V315 trgv AAGV03121522.1 5858 GLGLLKVEQRQVSVSIALRKSAIIYCHVSGTNFDSEVIHWYRQKPNQPVEHLMYIGSTNIQTVRRFMAKKYATSSTVTLTVNFIEEDDVAVYYCAVW
Dasypus novemcinctus V316 trgv AAGV03121527.1 5486 RLGLFKVEQREMSVSTALKKSAIIYCHTSGTTFGNVGIHWYQKKPNQPVEHLMYIGSTITRTVQRFVGKKESTSFTATLTIKFIDIDDVAIYYCAVW
Dasypus novemcinctus V317 trgv AAGV03121528.1 5673 SQTASNLEWRKRSVTKLAGATASITCDIVKENTNYIHWYRHQEGKAPKRILYYFFSSSTFSVDSGINQGKYHASKGFGRSCKFVVRNLEESDSGVYYCAVWD
Dasypus novemcinctus V318 trgv AAGV03121528.1 26890 GFGLLKVEQSQMSVSASLRKSAIIFCHISGTNFDNAVIHWYRQKLNQSMEHLTYIGPTKPQNVRKFVARKESSSSTASLTVSSTERDDVAVYYCAVW
Dasypus novemcinctus V319 trgv AAGV03121542.1 2169 SSGNSLITQLAASITKRKGNTAFFECQVETSVLKKNRFIHWYQQKPGRPLERILYISSNENIFYEKGISEERFEARKRQDGSAASLRVHRVAEADAGTYYCACWD
Dasypus novemcinctus V342 igkv AAGV03132638.1 5391 ASGDIVMTQSPGSVAASAGETVTLKCKASQSVSSYLAWYHQKPGQAPKLLIYYASKRPSGVPERFSGSGSGTDYTLTISRFQPEDLGDYYCQQYYDDP
Dasypus novemcinctus V343 igkv AAGV03132641.1 15838 ASGDILMTQSPGSVAASAGETVTLKCKASQSVSSYLAWYHQKPGQAPKLLIYRASNRPSGVPDRFSGSGSGTDFTLTISRFQPEDLGDYYCQQYDNFP
Dasypus novemcinctus V344 igkv AAGV03132643.1 5491 ASGDIVLTQSPGSVAASAGETITLKCKASQSVSSYLAWYQQKPGQAPKLLIYAASTRPSGVPDRFSGSGSGTDFTLTISRFQPEDSGDYYCQHYKGYT
Dasypus novemcinctus V354 iglv AAGV03138538.1 1734 FWAQSVLTQVPSVSGALGQKVTISCSGSSTNIGEGYVVNWYQQLPGSAPKLLIYGNSNRPSGVPDRFAGSKSGTSGSLTITALQPEDEDVYYCQSYDNSLRA
Dasypus novemcinctus V357 igkv AAGV03139379.1 5505 ASGAIVMTQSPGSVAASAGETITLKCKASQSVGNELSWYQLKPGQAPKLLIYDASKRPSGVPDRFSGSGSGTDFTLTISRFQPEDLGDYYCQHDYGYP
Dasypus novemcinctus V358 igkv AAGV03139379.1 21630 ASGDIVMTQSPGSVAASAGETVTLKCKASQSVSSYLNWYQQKPGQTPKLLIYYASNRPSGVPDRFSGSGSGTDFTLTISRFQPEDVGNYYCQRYKSYI
Dasypus novemcinctus V359 igkv AAGV03139383.1 13607 ASGDIVMTQSPGSVAASAGETVTLKCKASQSVSNELSWYHQKPGQAPKLLMYRASTRPSGVPDRFSGSGSGTDFTLTISRFQPEDLGDYYCQHDYGIP
Dasypus novemcinctus V360 igkv AAGV03139384.1 28928 ASGDNVMTQSPGSVAASAGETITLKCKASQSVGSYLHWYHKKPGQAPKLLIYNASNRASGVPDRFSGSGSGTDFTLTISRFQPEDLGDYYCQHRYGYP
Dasypus novemcinctus V361 igkv AAGV03139397.1 4726 ASGDIVMTQSPGSVAASAGETVTLKCKASQSVSSYLHWYHQKPGQAPKLLIYVASNRPSGVPDRFSGSGSGTDFTLTISRFQPEDLGDYYCQQDYSRP
Dasypus novemcinctus V379 trav AAGV03146346.1 3555 KTNGDSVTQTADLIVLPEGAPLTLNCTYQTSYSALLFWYVQHQNKALQLLLKSSLENQEMDSRGFQATHVKSDSSFHLKKLSVQMSDSAVYYCVLS
Dasypus novemcinctus V386 igkv AAGV03148962.1 21810 ASGDIVMTQSPGSVAASAGETVTLKCKASQSIGNTIHWYQQKPGQAPKLLIYDASNTASGVPDRFRGSWSGTDFTLTIRGFQDEDSGNYYCKQSSNFP
Dasypus novemcinctus V387 igkv AAGV03148965.1 36464 ACRDIVMTQSPGSVAASAGDTVTLKCKASQSVSSYLAWYHQKPGQAPKLLIYDASTRPSGVPDRFSGSGSGTDFTLTISRFQPEDLENYYCQQRQSSP
Dasypus novemcinctus V388 igkv AAGV03148969.1 3735 ASGDIVMTQSAGSVAASAGETVTLRCKASQSVNKKLHWYQQKPGQAPKLLIYYASNTASGVPDRFSGSWSGTDFTLTIRGFQDEDSGNYYCQQSNNFP
Dasypus novemcinctus V389 igkv AAGV03148971.1 1237 ASGDIVMSQTPGSVAASAGETVTLRCKASQSVNKKLHWYQQKPGQAPKLLIYYASNTASGVPDRFSDSWSGTDFILTIRGFQDEDSGNYYCQQSNNFP
Dasypus novemcinctus V390 igkv AAGV03148974.1 5819 ACGDIVMTQSPGSVVASPGETIILKCKSSQGVTNYLAWYQQKPGQVPKLLIYDASTRPSGVPDRFSGSGSGTDFTLTISRFQPEDLGEYYCQQRQSSP
Dasypus novemcinctus V391 igkv AAGV03148975.1 13467 ACGDIVMTQTPGSVAASAGETITLKCKASQSVGSYLNWYHQKPGQAPKLLIYKASTRPSGVPDRFSGSGSGTDFTLTINSVQDEDLGMYYCQKGNATP
Dasypus novemcinctus V392 igkv AAGV03148978.1 24807 ACEDIVMTQSPGSVAASAGDTVTLKCKASQSVGSYLSWYHQKPGQAPKLLIYDASTRPSGVPDRFSGSGSGTDFTLTISRFQPEDLGNYYCQQRQSSP
Dasypus novemcinctus V393 igkv AAGV03148984.1 28498 SSGDIVMTQSPGSVAASAGETITLKCKASQSVSSYLAWYQQKPGQAPKLLIYGASTRASGVPDRFSGSGSGTDFTLTISRFQPEDLGDYYCQHDNSFP
Dasypus novemcinctus V394 igkv AAGV03148992.1 5620 ACGDIVMTQSPGSVAASAGETITLKCKASENVGSYLNWFHHKPGQAPKRLIYGASTRPSGVPDRFSGSGSGTDFTLTINGVQDEDLGTYYCMQWDTNP
Dasypus novemcinctus V395 igkv AAGV03148998.1 19373 ASGDIVMTQSPGSVAASPGETVSLKCKASQSVSNYLNWYQQKRGEAPKLLIYRASSQPSGVTDRLRGNGSVTDVTLIVSRFQPKDWGDYYCLQSNSFP
Dasypus novemcinctus V396 igkv AAGV03148999.1 2905 ARGDIVMTQSPGSMTASPGETITLKCTSSQSVRSHLAWYQQKPGQAHTLLVYAASNWAPGVPDRFSGSGYGTDFTLTISRVQPEDSGDYYCQQGNSNP
Dasypus novemcinctus V399 igkv AAGV03150823.1 13436 ASGDIVMTQSPGSVAASSGETVTLKCKSSQSVGSYLNWYHQKPGQAPKLLIYYASNRAAGVPDRFSGSGSGTDFTLTISRFQPEDLGEYYCQQDNSRP
Dasypus novemcinctus V403 igkv AAGV03151754.1 4994 ASGDIVMTQSPGSVAASAGETVTLKCKSSQSVSSYLHWFQKKPGQGPKLLIYYGSNRASGVPDRFSGSGSGTDFTLTISRFQVEDSGNYYCQQSNNLP
Dasypus novemcinctus V404 igkv AAGV03151758.1 9557 ASGDIVLTQSPGSVAASSGETVTLRCKASQSVSSYLNWYQQKPGQAPKLLIYAASTQPSGVPDRFSGSGSGTDYTLTISRFQPEDSGDYYCQHGYGSP
Dasypus novemcinctus V413 igkv AAGV03153785.1 311 ASGDIVVTQSPGSVAASAGETVTLKCKASQSIGNTIHWYQQTPGQAPKLLIHYASNTASGVPDRFSGSWSGTDFTLTIRGFQDEDSGNYYCQQSSNFP
Dasypus novemcinctus V425 ighv AAGV03159328.1 10999 VLCEVQLVESGGDLRPPGGSLRLSCSTSGFTFSDYHMSWVRQAPGKGLEWVSWINYNGGSTYYADSVKGRFTISKDNSKNQLNLQMNNLKPEDTALYYCAR
Dasypus novemcinctus V426 ighv AAGV03159334.1 21351 VLSEVQLVESGGDLRQSGGSLRLSCSASGFTFKDYAMHWVHQAPGKGLEWVSSIGSGGGIYYADSVKGRFTISRDNNKNQLYLQMNGLKTEDTALYYCAK
Dasypus novemcinctus V427 trbv AAGV03160246.1 4770 AVNSEVIQIPRHLIKAKGQHVTLRCSPKSGHNTVYWYQQALGQGLLFLVQYINGKETEKGNMPDRFSGLQFGDSRSELNVSSLQLEDSALYLCASSL
Dasypus novemcinctus V428 trbv AAGV03160246.1 11026 PGDSGVTQTPKHLVKARRQNVTLSCSPISGHLSVSWYQQALGQGPQFLVQYYNMKERDKGNIPDRFSGVQFGDFRSEFTVSSLQLEDSALYLCASSL
Dasypus novemcinctus V435 igkv AAGV03162902.1 13833 SSGDIVMTQSPGSVAASAGETVTLKCKASQSVSSYLNWYHQKPGQAPKLLIYGASNRPSGVPDRFSGSGSGTDFTLTISRFQPEDLGDYYCLQLQSYP
Dasypus novemcinctus V438 igkv AAGV03163550.1 8432 ASGDIVMTQSPGSVAASAGETVTLKCKASQSVSSYLNWYQQKPGQAPKLLIYDASKRPSGVPDRFSGSGSGTDFTLTISRFQPEDLGDYYCQHYKGYT
Dasypus novemcinctus V439 igkv AAGV03163834.1 859 VSGDIVMTQSPGSVAASVGETITLKCKASQSVSSYLHWYHQKPGQAPKLLIYKISNRPSGVPDRFSGSGSGTDFTLTISRFQPEDLGDYYCQQSNSYP
Dasypus novemcinctus V440 igkv AAGV03163840.1 11992 ASGDIVMTQSPSSVAASAGETVTLKCKASQSVSSNIAWHHQKPGQAPKLLIYDASTQPSGVSDRFSGSGSGTDYTLTISRFQPEDLGDYYCQQGNSYP
Dasypus novemcinctus V441 igkv AAGV03163846.1 4991 ASGDIVMTQSPGSVAASAGETVTLKCKTSQSVSSNLAWYQQKPGQAPKLLIYDASTRPSGVPDRFSGGGSGTDFTLTISRFQPEDLGDYYCQ
Dasypus novemcinctus V442 igkv AAGV03163847.1 4767 ASGDIVMTQSPGSVAASAGETITLKCKASQSVSSSYLHWYHQKPGQAPKLLIYGASNRPSGVPDRFSGSRSGTDFTLTISRFQPEDLGDYYCQRGYNYP
Dasypus novemcinctus V443 igkv AAGV03163850.1 43453 ASGDIVMTQSPSSVAASAGETVTLKCKASQSVSSYLAWHHKKPGQAPKLLIYDASTRPSGVPDRFSGSGSGTDYTLTISRFQPEDLGDYYCQQGSSYP
Dasypus novemcinctus V481 igkv AAGV03179701.1 17394 ASGDIVMTQSPSSVAASAGETVTLKCKASQSVSSSYLHWYHQKPGQAPKLLIYRASTRPSGVPDRFSGSGSGTDFTLTISRFQPEDLGDYYCQHGYGYP
Dasypus novemcinctus V496 ighv AAGV03188280.1 460 VLSELTLKESGPGMVKPSQTLSLICSVSGGSVTSSNFWNWIRQSPGKGLEWLGYWKGSTSYNPAFQGRISITADTSKNEYSLQLSSIRTEDTAKYYCAR
Dasypus novemcinctus V498 igkv AAGV03188380.1 1716 ASGDIVMTQSPGSVAASAGETVTLKCKASQSVSSYLQWYHQKPGQAPKLLIYRASNRPSGVPDRFSGSGSGTDFTLTINGVQDEDLGTYYCLQWDTAP
Dasypus novemcinctus V504 ighv AAGV03191662.1 4471 VLCEVQLVESGGDLRPPGGSLRLSCSASESTFEYYYMHWILQAPGKGLEWISDISDDGGSTSYADSVKGRFTISRDNNKNELYLQMNSLKPEDMALYYCAT
Dasypus novemcinctus V506 ighv AAGV03192084.1 8485 VLSEVQLVESGGDLRQPGGSLRLSCSASGFTFKDYRMYWVRQAPGKGLEWVSEISGNGGNTYYADSVKGRFTISRDNNKNQVYLQMNSLKTEDTALYYCAR
Dasypus novemcinctus V521 igkv AAGV03205569.1 1601 AGVIGDIVMTHFPVSIAVSPGDTVTINCKSSQSISSNVDWFQQKKGQSPKLLIYRGSTKLSGVPDRFSGSGSGTDFTLTISRFQPEDVADYYCQQLNSYP
Dasypus novemcinctus V525 igkv AAGV03209618.1 914 ASGDIVMTQSPVSLSVSPGEMATIKCKSSQNILSSSNQKNYLAWYQQKPGQAPKLLIYYASTRASGVSNRFSGSGSGTDFTLTISRFQTEDTADYYCYQYFSYP
Dasypus novemcinctus V527 igkv AAGV03210236.1 7926 ASGDIVMTQSPVSLSVSPGEMATIKCKSSQNILSSSNQKNYLAWYQQKPGQAPKLLIYFAFTRASGVSNRFSGSGSGTDFTLTISRFQTEDTTDYYCYQYFSYP
Dasypus novemcinctus V535 ighv AAGV03214513.1 14543 VITEEQLVQSGAEVKRPGEPLRISCKASGDSFNYYWINWVCQKPGKGLEWVGGIYPSDSDTQYGQSFQGQVTISTDNSASTAYLQWTSLKTSDTAVYYCAR
Dasypus novemcinctus V536 igkv AAGV03215660.1 468 ASGDIVMTQSPGSVAASAGETVTLKCKASQSVSSYYLHWYHQKPGQAPKLLIYGASNRPSGVPDRFSGSGSGTDFTLTINRFQPEDLGDYYCQQGSSYP
Dasypus novemcinctus V542 igkv AAGV03217056.1 29023 ASGAIVMTQSPGSVVASAGETVTLKCKASQSVSSYLNWYHQKPGQAPKLLIYNASNRPSGVPDRFSGSGSGTDFTLTISSFRPEDLGDYYCLQHNSSP
Dasypus novemcinctus V543 igkv AAGV03217056.1 59288 ASGAIVMTQSPGSVAASAGETVTLKCKASQSVSSYLDWYQQKPGQAPKLLIYYTSNRPSGVPDQFSGSGSGTDYTLTISRFQPEDSGDYYCQHGYGSP
Dasypus novemcinctus V544 igkv AAGV03217248.1 2009 ASGDIVMTQSPDSLAVSPGETVSIFCKSSQSILYSTSQMNYLAWYQKKPGQVHKLLISWASTRASGVPDRFSGSGSAKDFTLTISRFQAEDVGEYFCHQHYSSP
Dasypus novemcinctus V545 igkv AAGV03217251.1 302 ASGDIVLTQSPGSVAASAGETVTLKCKASQSVSNYLNWYHQKPGQAPKLLIYRISNRPSGVPDRFSGGGSGTDFTLTINGVQDEDLGTYYCQQWDTTP
Dasypus novemcinctus V546 trbv AAGV03217606.1 2487 PVDTGVTQVPKYLVIGRQYKKSLKCEQHLGHNAMYWYKQNPKKPLELMFAYNYMKLNENNSVPSRFSPECRDSSNLYLHMDRLEPDDSATYFCASSK
Dasypus novemcinctus V549 ighv AAGV03219766.1 5677 VLTQVQLQELGPDLLKPSQTLSLTCTVSGFSLTDYHMTWIRQVPGKELEWLGVIWASGSTKYIPTLQSRLIITKDNSKNEVYFKLNSLSFQDTATYYCAR
Dasypus novemcinctus V550 ighv AAGV03219771.1 8271 VLSQVQLQESGPGLVKPSQTLSLTCTVSGISLTTIHLSWIRQVPGKGLEWVGEIQYGGSIYSNPTFQSRFGITRDTNKNEVYLKLNSMRAEDTARYYCAR
Dasypus novemcinctus V556 ighv AAGV03224043.1 16140 VLSELTLNESGPGLVKPSQTLSVTCFVSGDTISSSSYVWNWIHQSPENGLELMGYWHVSEGTYYKPAFQGCISISADTSKNEYYLQLDSLRTEDTANYYCAR
Dasypus novemcinctus V557 ighv AAGV03224047.1 21740 VLSELTLKESGPGLVKPSQTLSLTCSVSGGTFSGYYWSWIRQSPEKGLEWMGYWYTSGSTYYNPAFQGRISITGDTSKNEYSLQLSSLRTEDTAKYYCAR
Dasypus novemcinctus V559 ighv AAGV03224095.1 5294 VLSELTLKESGPGLVKPSQTLSLTCSVSGGSFSSYAWSWIRQRPEKGLEWMGYWHTSLGTSYNPAFQGRISITADTSKNEYSLQLSSLRTEDTAKYYCAR
Dasypus novemcinctus V560 igkv AAGV03224171.1 5986 ASGDIVMTQSPGSVAASAGETVTLKCKASQSVSSNLAWYHQKPGQAPKRLIYAASTRPSEVPDRFSGSGSGTDFTLTISRFQPEDLGNYYCHQYYSSP
Dasypus novemcinctus V564 ighv AAGV03225299.1 7857 VMCEIQLVESGGDLRPPGGSLRLSCSASGFTFSNYGMSWIRQAPRKGLEWVSAISSTGGSTYYADSVKGRFTISRDNNKNQLNLQMNSLKPEDTALYYCAK
Dasypus novemcinctus V565 ighv AAGV03225326.1 2281 TYSQVTLKESGPDMVKPTQTLSLTCTFSGFSLSTSGMGVAWIRQPPGKALEWLANIWWDDDKVYAPSLKNRLTISKDTPNNQVFLKMTNMDPVDTATYYCAR
Dasypus novemcinctus V566 ighv AAGV03225328.1 9542 AITEKQLLQSGAEVKRPGEPLRISCKASGYSSTSYWIHWVCQKPGKALEWVGNIDLSDSETHYGSSFQGQVTISADKSASTAYLQWTSLKTSDTAVYYCAR
Dasypus novemcinctus V567 ighv AAGV03225336.1 8666 VLSVLTLKESGRGLVKPLQSLFLNYCVSGGSLTSSYAWSLICQSPGKRLEYTGYWYKTGGPNYKPAFQGHISIAFGTSKNEYYWQLSSMSADDMAMYYCA
Dasypus novemcinctus V568 ighv AAGV03225345.1 14362 VLCEVQLVESGGDLRPPGGSLHLSCSASGFTFSNYHMSWIRQAPGKGLEWVSSIINTGGSTYYADSVKGRFTISRDNNKNQLHLQMNNLKTEDTALYYCAI
Dasypus novemcinctus V569 ighv AAGV03225349.1 35360 VNSEEQLVQSGAEVKRPGEPLKISCKASGYTFTNYWISWVRQEPGKGLEWVGQIDPSDSETHYGSSFQGQVSLSTDNSASTAYLQWASLKASDTAVYYCAK
Dasypus novemcinctus V570 ighv AAGV03225356.1 778 VLGEVQLVESGGDLRPPGGSLRLSCSASGFTFSSYYMTWIRQAPGKGPEWVSGITNTGGSTYYADSVKGRFTISRDNNKNQLHLQMNNLKTEDTALYYCAI
Dasypus novemcinctus V572 ighv AAGV03226467.1 293 VLSQVQLQESGPGLVKPSQTLSLTCKVSGFSITTSGYCWYWIRQPPGKGLQWLSSICASGNSYYSPSLKSRLSTSSDTSKNQFSLQLSSVTAEDTAMYYCTR
Dasypus novemcinctus V581 igkv AAGV03227643.1 5329 ASGDIVMTQSPGSVAASAGETVTLKCKASQRVSDYLSWYHQKPGQAPKLLIYGASNRPSGVPDRFSGSGYGTDFTLTINGVQDEDLGMYYCQQGDTTP
Dasypus novemcinctus V582 ighv AAGV03228104.1 4444 VLSEVQLVESGGDLRQPGGSLRLSCSVSGVTIDNYAMSWVRQAPGKGLEWVSTIDILDSTYYADSVKGRFTISKDNDKNQLYLQMNGLKTEDTALYYCAK
Dasypus novemcinctus V583 igkv AAGV03230157.1 711 AGVTGDIVMTHFPVSIAVSPGDTVTTNCKSSQSISSNVDWFQQKKGQSPKLLIYRGSTKLSGVPDQFNGSGSGTDFTLTISRFQTEDVADYYCQQLNSYP
Dasypus novemcinctus V593 iglv AAGV03232629.1 2640 SLSQYVVTQPSSFSASLGTTARLPCTLSRDVSIGDRYIYWFQQKTGSPPSYLLRYSTDSDKHQGSGVPTRFSGSKDVSANAGHLLISGLQPEDEADYYCLI
Dasypus novemcinctus V606 trav AAGV03239671.1 6305 GAWAQAVAQPDVLVAVSEGAPLELRCNYSASVLPALFWYVQYPNQGLQLLLKYVTGDTMVKGIKGFEAEFRKSATSFPLRKASAQWGDSAVYFCVLR
Dasypus novemcinctus V607 trav AAGV03239671.1 13881 GTLTQTVTQPEDHISVIKGNPVQLRCNYSYSGSPILFWYVQYPKQNPQLLLRHISRESIKGFTADLDRDDASFHLKKPSVQEEDSAMYYCALS
Dasypus novemcinctus V608 trav AAGV03239671.1 20596 VNSQVEQSPQALNIQEGENATMNCSYKTSIDTLQWYRQDSGRGLSLLILIRTNERVKLSGRLRATLDTSTQFSSLFITASQTADTTAYFCAVD
Dasypus novemcinctus V610 igkv AAGV03240718.1 2348 ASGDIVMTQSPGSVAASAGETVTLKCKASQSVSNYYLNWYHQKPGQAPKLLIYAASKRPSGVPDRFSGSGSGTDYTLTISRFQPEDLGDYYCQQYDSSP
Dasypus novemcinctus V611 iglv AAGV03241449.1 4550 SWAQSGLTQETSVSGTAGQKVTLTCTKNSQSVGTYSTSWYQQLSGGTPKTVMLGTTRPSGIPARFSGSVSGLTSSLSISDLQSGDEGFYYCSTWDNSVNG
Dasypus novemcinctus V614 igkv AAGV03242234.1 857 ASGDIVMTQSPDSLTVSPGETVTIFCKSNQSILYSNDKKNYLAWHQKKPGQDPKLLIYDASTRASGVPDRFRGSGSATDFTLTISRFQAEDVGEYYCQQCYSYP
Dasypus novemcinctus V615 igkv AAGV03242240.1 5877 ASGDIVMTQSPGSVAASAGETVTLKCKASQSVSSYLEWYHQKPGQAPKLLIYDSSKRPSGVPDRFSGSGSGTDFTLTINGVQDEDLGTYYCLQWYTRP
Dasypus novemcinctus V618 ighv AAGV03244077.1 10730 VLCEVQLVESGGDLRRPGGTLRLSCSASGFNFANSDMSWVHQAPGKELEWVSGISYSGGSTYYADSVKGRFTISRDNNKNQLNLQMNSLKSEDTALYYCPR
Dasypus novemcinctus V619 ighv AAGV03244088.1 1936 FLCEAQLVESGGDLRPPGGSLRLSCSSSGYTFSAYGMSWIRQAPGKGLEWVSGISYDGSTYYADSVKGRFTISKDNNKNQINLQMNSLKPEDTALYYCAM
Dasypus novemcinctus V620 ighv AAGV03244096.1 3537 VLCEVQLVESGGDLRPPGGSLHLSCSASGFTFGNHGMSWIRQAPGKGLEWVSGISYGGSTYYADSVKGRFTISRDNNKNQINLQMNSLKSEDTTLYYCAK
Dasypus novemcinctus V622 ighv AAGV03245412.1 5685 VLSEVQLVESGGDLRQPGGSLRLSCSTSGFTFRDYGMDWLRQAPGKGLEWVSYIRYDSSTTYYADSVKGRFTISRDNNKNQVYLQMNGLKTEDTALYYCAT
Dasypus novemcinctus V623 igkv AAGV03245451.1 1601 ASGDIVMTQTPGSVAASAGETVTLKCKASQSVSNYLNWYHQKPGQAPKLVINYASNRPSGVPARFSGSGSGTDFTLTINGVQDEDLGMYYCQQWDTTP
Dasypus novemcinctus V624 igkv AAGV03245460.1 13669 SSGDIVMTQSPGSVAASPGETITLKCKASRSVYSNLAWYQQKPGQVPKLLIYDTSTQPSGVPDRFSGRGSGTDFTLTISRFQPEDLGDYYCQQRQSPP
Dasypus novemcinctus V625 igkv AAGV03245463.1 2728 ASGDIVVTQSPSSVAASAGETITLKCKASQSVSNFLSWYHQKPGQAPKLLIYYASTRPSGVPDRFSGSGYGTDFTLTINSVQAEDLGKYYCQQGDTRP
Dasypus novemcinctus V629 trbv AAGV03248510.1 616 PGLGGLVSQHPRTVICKSGSSVKIQCHLRDFQIPIVFWYHQYPKQGLTLITTVNQDFSVSYEKDFSKDKFPISHSNGTLSVLAVTSAQPEDSNFYFCSAS
Dasypus novemcinctus V632 trbv AAGV03250919.1 273 SMDTEVVQNPRHLVKGKGQTAKMNCTPIKGHSYVFWYRKTLEEELKFLIYFQNEDDIDKTGMPRERYSAKCFRNSSCSFEIQNTEHEDSALYFCASSE
Dasypus novemcinctus V634 igkv AAGV03252588.1 596 ASGDIVMTQSPGSLAASAGETVTLKCKASQSVYSNIAWYQQKPGQAPKLLIYAASYRPSGVPDRFSGSGSGTDYTLTISRFQPEDLEDYYCQQSSSYP
Dasypus novemcinctus V644 igkv AAGV03258332.1 597 ASGDIVMTQSPGSVAASAGETITLKCKASQSVYSNLHWYHQKPGQAPKLLIYNASNRPSGVPDRFSGSGSGTDFTLTISRFQPEDLGDYYCQHSYGYP
Dasypus novemcinctus V648 iglv AAGV03262699.1 837 SWTQSVLTQEASVSGSLGGTVTITCQDSSGSTSIPIVGAAWYQQHPGGAPKTVMLGDTRPSGIPDRFSGSKSGNTASLTIRGLLPEDEAAYYCSADII
Dasypus novemcinctus V652 igkv AAGV03266967.1 28805 ASGDIVMTQSPGSVAASAGETVTLKCKANQSVYNNLAWYHQKPGQAPKLLIYDASTRPSGAPDRFSGSGSRTDYTLTISRFQAEDLGNYYCQQYYSRP
Dasypus novemcinctus V653 ighv AAGV03267218.1 255 VLSELTLKESGPGLVKPSETLSLTCSVSGGSVTSSYYWNWIRQSPGKGLEWMGYWSGSTSYNPAFQGRISITADTSKNEYSLQLSSMRTEDTAKYYCAR
Dasypus novemcinctus V654 ighv AAGV03267219.1 813 VLSQVQLKESGPGLLKPSQTLSLTCSVSGFSITTSGNCWAWIRQLPGKGLLWLSRICSDGSTNYNPSLKNQLSTSRDISKNQFSVQLTSMTAEDTAVYYCAR
Dasypus novemcinctus V655 ighv AAGV03267230.1 16532 VLSELTLKESGPGLVKPSQTLSLTCSVSGGSVTSSYYWNWIRQKPGKGLEWMGHWSGSTSYNPAFQGRISITADTSKNEYSLQLSSMRTEDTAKYYCAR
Dasypus novemcinctus V656 ighv AAGV03267260.1 30096 ILSQVQLKESGPGLLKPSQTLSLTCSVSGFSITTSGYCWVWIRQPPGKGLQWLSRICYDGSTNYDPSLKSRLSTSRDTSKNQFSVQLTSVTAEDTAVYYCA
Dasypus novemcinctus V657 ighv AAGV03267265.1 29649 VLSELTLKESGPGLVKPSQTLSLTCSVSGGSISSYEWNWIRQSPGKGLEWMGWWSGSPNYNPAFQGRISITADTSKNEYSLQLSSMRTEDTAKYYCA
Dasypus novemcinctus V658 ighv AAGV03267276.1 1388 VLSELTLKESGPGLAKPSETLSLTCSVSGGSITSSYIWSWIRQSPGKGLEWMGYWSGSTSYNPAFQGRISITADTSKNEYSLQLSSMKTEDTAKYYCAR
Dasypus novemcinctus V659 ighv AAGV03267280.1 9772 VLSQLQLKESGPGLLKPSQTLSLTCSVSGFSITTGGYCWDWIRQPPGKGLQWLSRICYDGSTSYNPSLKSRLSTSRDTSKNQFSVQLTSVTTEDTAVYYCAR
Dasypus novemcinctus V660 ighv AAGV03267281.1 20945 VLSELTLKESGPGLVKPSQTLSLTCSVSGGSVTSSYYWSWIRQSPGKGLGWLGWWIGSTSYNPAFQGRISITADTSKNEYSLQLSSMRTEDTAKYYCAR
Dasypus novemcinctus V661 ighv AAGV03267290.1 10272 VLSELTLKESGPGLVKPSQTHSLTCSVSGGSVTSSYCWHWIRQSPGKGLEWMGWWRGSTGYNPAFQGRISITADTSKNEYSLQLTSLRTEDTAKYYCAR
Dasypus novemcinctus V662 ighv AAGV03267301.1 29992 VLSELTLKESDQGLVNPSQTLSLTCSVSGDSVTSSYNWCWIRQSPGKGLEWMGSWSGGTYYNPAFQGRISISADTSKNEYYLQLSSMRTEDTAKYYCTR
Dasypus novemcinctus V663 ighv AAGV03267308.1 12965 VLSELTMKESGPGLVKPSQTLSLTCSVSGGSVTGSYLWSWIRQSPGKGMEWMGYWSGGTYYNPAFQGRISISADTSKNEYYLQLSSMRTEDTAKYYCAR
Dasypus novemcinctus V664 ighv AAGV03267319.1 2138 VLSQVQLKESGPGLLKPSQTLSLTCSVSGFSITSGYCWDWIRQPPGKGLQWLSRICYEGSTYYNPSLKSRLSTSRDTSKNQFSVQLTSVTAEDTAVYYCAR
Dasypus novemcinctus V668 igkv AAGV03269895.1 3303 ARGDIVMTQSPGSVAASAGETVTFKCKASQSFSNYLAWHHQKPGQAPKLLIYAASIRVSGVPDRFSGSASGTDFTLTISGVQTKDFGDYYCQQYKSYP
Dasypus novemcinctus V669 igkv AAGV03269899.1 567 ASGDIVLTQSPGSVAASAGETVTLKCKASQSVSSYLHWYHQKPGQAPKLLIYDASTRPSGVPDRFSGSGSGTDFTLTISRFQPEDSDYYCQQRQSYP
Dasypus novemcinctus V672 trbv AAGV03271421.1 447 SIDSGVTQTPRFLIKTRGQDVTLKCSPISGHASVSWYQQTLGKALQFLFEFYEHFQRAKGDFPDRFSAQHFREYHAELNVSSLELGDSALYLCASSR
Dasypus novemcinctus V673 trbv AAGV03271423.1 3754 HTGAGVSQSPKHGVRELGQPVTLRCDPISGHTFLYWYRQTLEQGLQLLTYFQNEFSPDKSGLPKDRFFAERPEGSYSTLKIQPTQLEDSAVYLCASSL
Dasypus novemcinctus V674 trbv AAGV03271424.1 2316 SVDAGVLQSPRHLIKEKAGTAILKCHPMSGHRSVYWYQQALGQGPQFLFEYFGKSERQKGNIPERYSAQQFGDSSSELNVSSLQLEDSALYLCASSL
Dasypus novemcinctus V675 trbv AAGV03271432.1 3829 HTEAGVTQSPRYEITEQRQNVTLWCDPISGHNTLYWYRQMLGQGLKILVHFENNGAIDDSQLPKDRFSAERPKGVDSTLKIKSADLGDSAVYFCASSL
Dasypus novemcinctus V676 trbv AAGV03271432.1 16665 HTDTRVIQTPRNKVAKMKQEVTMRCEPISGHNTLFWYRQTVVQGLQLLAYFRNQAPIDDSGMPKNRFTVRMPEGSFSTLQIQPTELEDSAVYLCACRL
Dasypus novemcinctus V677 trbv AAGV03271432.1 22942 YIAAGVTQLPSHRVIQKERTVTLTCDPISGHNALFWYRRVGGQGMEFLIYFFKADIQDKSGMPQDRFSATRTTGTYSTLKIQPVELEDSGVYFCASSQ
Dasypus novemcinctus V678 trbv AAGV03271432.1 29092 HMGAMVIQNPRYRVTKMGKSVTLSCFQNLNHDSMYWYQQKQSQGLKLLFYYYDNDFNNGTDTSDNFQSSRPNTSFCTLGIRSPGLGDSAMYLCASSR
Dasypus novemcinctus V679 trbv AAGV03271433.1 4382 SLDAEVTQTPKHLVKGQGQKAKMNCVPIKGHTYVFWYQQNLAKELKFLIAFQNTDVFGTPEMPKERFSAECLRNSPCSLEIQPTELQDSAVYLCAAVN
Dasypus novemcinctus V680 trbv AAGV03271436.1 3492 LTNAGVTQTPQYLMRGRGEEATLRCSPERGHSHVYWYRQLPEEGLKFMVYLQKEQTVDDSGMTTKRFSAEFPQEGPSILKVKLAELGDSAVYFCASSS
Dasypus novemcinctus V682 trbv AAGV03271438.1 5304 PGLGGLVSQHPRTVICKSGTSVKIQCHLMNFQFPTVFWYHQYPKQGLTLITTVNQDFSVSYEKDFSKDKFPISHSNGTLSVLAVTSAQPEDSNFYFCSAS
Dasypus novemcinctus V683 trbv AAGV03271444.1 485 PGLGGLVSQHPRTVICKSGTSVKIQCHLMNFQFPTVFWYHQYPKQGLTLITTVNQDFSVSYEKDFSKDKFPISHSNGTLSVLAVTSAQPEDSNFYFCSAS
Dasypus novemcinctus V688 ighv AAGV03276822.1 105 VLSEVQLVESGGDLRPPGGSLRLSCSVSGFTISNNGMSWVRQAPGKGLEWVSYISSSGGSTYYADSVKGRFTISKDNNKNQVYLQMNGLKTEDTALYYCAK
Dasypus novemcinctus V702 igkv AAGV03282913.1 8367 ASADIVVTQSPGSVAASAGETITLRCKSSQSVSDNLHWYHQKPGQAPKLLIYYASNRPSGVPDRFSGSGSGTDFTLTISRFQPEDLGDYYCQQSNSRP
Dasypus novemcinctus V709 trav AAGV03289320.1 28376 GLRAQSVIQPEDRVTVTEGDLLTKKCTYSLPVSPYLFWYVQYPNQGFQLLLKYITGDNLVKGSYGFEAEFNKSQNSFHLKKQSVLGNDSALYFCAVS
Dasypus novemcinctus V710 ighv AAGV03290149.1 2974 VLCEVQLVESGGDMRKPGDSLTLSCKASGFTFTNYSRHWVRQAPGQGLEWVAQVSQPSGSKQWYSPSVQGRFTISRDNPTSTASLKMTNLKEEDTAVYYCVR
Dasypus novemcinctus V711 ighv AAGV03290172.1 308 VLSERTLKESGPGLVKPSQTLSLTCSVSGGSISSYIWSWIRQSPEKGLEWMGYWHTSAGTSYNPAFQGHISITADTSKNEYSLQLSSMRTEDIAKYYCAR
Dasypus novemcinctus V712 ighv AAGV03290174.1 7880 VLSQVQLKESGPGLLTPSQTLSLTCSVSGFSITTSGYSWEWIRQPPGKGLQWLSSIWYDGSTYYDPSLKSRLSISRDTSKNQFSMQLTSVTAEDTAVYYCAR
Dasypus novemcinctus V713 ighv AAGV03290189.1 7836 VLSQVQLKESGPGLLMPSQTLSLTCSVSGFSITTSGSCWDWIRQPPGKGLQWLSRICYHGSTNYDPSLKSRLSTSRDTSKNQFSVQLTSVTAEDTAVYYCAR
Dasypus novemcinctus V724 ighv AAGV03295962.1 3342 ILSQVQLQESEPGLVKPSETLFLTCSVSGISITTNPYCWNWIRQTPGEGLQWLSVICYNGGTDYAPSLKSRLSTSRDTSKNQFSMQLISMTAEDMAVYYCAR
Dasypus novemcinctus V728 igkv AAGV03297837.1 600 ASGDIVMTQSPGSVAASAGETVTLKCKASQSVSSYLHWYHQKPGQAPKLLIYGASTRPSGVPDRFSGSGSGTDFTLTISRFQPEDLGDYYCQQSNSYP
Dasypus novemcinctus V740 ighv AAGV03306132.1 7025 VLSEVQLVESGGDLKQPGGSLRLSCSASGFTFKDYAMHWVRQPPGKGLDWVSVISSSGGSTYYADSVNGRFTISRDNNKNQVYLQMNGLKPEDTALYYCAK
Dasypus novemcinctus V742 iglv AAGV03307548.1 516 ADSQTVVVQEPSLSVSVGGTVTLTCGISSGSVSTSQYPSWYQQTPGQAPHMLIYRTSSRPSGVPNRFSGSISGNKAALTITGAQPEDEAEYHCAVYAGSYS
Dasypus novemcinctus V744 iglv AAGV03308804.1 1877 CWAQSVLTQEASVSGSLRETVTLTCKGSSSTTISIGGTGWYQQHPGGAPKTVMLGTTRPSGIPDRFSGSKSGNTASLTIAGLQAEDEAAYFCSTFDI
Dasypus novemcinctus V747 igkv AAGV03309968.1 12414 ASGAIVMTQSPGSVAASAGETVTLKCKASQSVSSYLAWYHQKPGQAPKLLIYAASTRPSGVPDRFSGSGSGTDFTLTISRFQPEDLGDYYCQHGYGYP
Dasypus novemcinctus V748 igkv AAGV03309971.1 10857 ASGDIVMTQSPGSVAASAGETVTLKCKASQSVSSSYLHWYHQKPGQAPKLLIYGASNRPSGVPDRFSGGGSGTDFTLTISRFQPEDLGDYYCQQGSSYA
Dasypus novemcinctus V754 igkv AAGV03313645.1 5408 ASGDIVMTQSPGSVAASSGETVTLKCKASQSVSSYLAWYHQKPGQTPKLLIYGASTRASGVPDRFSGSGSGTDFTLTISRFQPEDLGDYYCQRYYSGS
Dasypus novemcinctus V755 igkv AAGV03313645.1 34716 ASGDIVMTQSPGSVAASAGETVTLKCKASQSVSSYLNWYQQKPGQAPKLLVYYASRRPSGVPDRFSGSGSGTDFTLTISRFQSEDLGDYYCQQYDDYP
Dasypus novemcinctus V756 igkv AAGV03313649.1 23987 ASGAIVMTQSPGSVAASAGQTVTLKCKASQSVSSNLAWYHQKPGQVPKLLIYGASTRASGVPDRFSGSGSGTDFTLTISRFQPEDVGDYYCQQYNSYT
Dasypus novemcinctus V767 trav AAGV03006428.1 636 SSGEMNVEQRPPSLSTQEGEGCVFYCNYSSTISVRLHWYRQHSGRRLESLFLLLSNGAVKQEGQLTASLDTKARLSTLHVAASQRGLAATYFCAVE
Dasypus novemcinctus V784 trbv AAGV03017104.1 7125 HTGAGVSQSPRHRIAGSGQPVALRCDPISGHAALTWYQQTLGQGLEFLIYFQNKDVADESGMPEDRFSAQRPNGSYSILKINSAKRGDSVAYLCASSS
Dasypus novemcinctus V785 trbv AAGV03017104.1 1555 PVDAGIIQIPRYHITQTGKKTILQCSQDMDHFVMFWYLQDPGQGLRLIHYSDGISSLEKGDAWEGYSVSQNEKEHFPLTVESASTNQTFLYFCASSN
Dasypus novemcinctus V801 trbv AAGV03025702.1 409 HTETRVSQTPSHSITESGQRVALRCGIISGHLYLYWYRQNPGKGVEFLISFYNKIPSEKADFFKDRFSAEMLDGSSSILKIQPAQLGDSATYLCASSS
Dasypus novemcinctus V805 ighv AAGV03026321.1 8518 VLSELTLKESGPGLVKPSQTLSLTCSVSGGSISSYYWSWICQSPGKGLEWLGLWTGSTRYNPAFQGRNSITADTSKNEYSLQLSSMRTEDTAKYYCAR
Dasypus novemcinctus V806 ighv AAGV03026338.1 7141 VLSQVQLKESGPGLLKPSQTLSLTCSVSGFSITTSGYCWHWIRQPPGKGLQWLSVICYDGSTNYNPSLKSRLSTSRDTSKNQFSVQLTSMTAEDTAVYYCAR
Dasypus novemcinctus V807 ighv AAGV03026342.1 10291 VLSELTLKESGPGLVKPSQTLSPTCSVSGDSVASSYYWSWIRQSPGKGLESMGYWSGGSYYNPAFQGRISITADTSKNEYYLHLSSMRTEDTAKYYCAK
Dasypus novemcinctus V808 ighv AAGV03026345.1 5508 VLSELTLKESGPGLVKPSQTLSLTCSVSGGSLTDYWHWIRQSPEKGLERMGYWYTSGSPSYNSAFQGRISITADNSKNEYYLQLSSMRTEDTAKYYCAK
Dasypus novemcinctus V809 ighv AAGV03026346.1 16052 VQSEIQLLESGGNLVQPGGSLRLSCATSGFTFSSSWMNWIHQAPGQGLERMGEINTDGGTKNFAPSLKGLSDISRNKSKNTLYLQMNSLREEDTARYYCAS
Dasypus novemcinctus V846 ighv AAGV03048906.1 398 VLSEVQLVESGGDLRQPGGSLRLSCSASGFTFKDYSMHWIHQAPGKGLEWVSYIRYDSSNTYYADSVKGRFTISRDNNKNQVYLQMNGLKTEDTALYYCAK
Dasypus novemcinctus V851 trbv AAGV03051113.1 464 PGLGGLVSQHPRTVICKSGTSVKIQCHLRDFQIPAVFWYHQYPKQGLTLITTVNQDFSVAYEKDFPGDKFSISHSNRTLSVLAVTSAQPEDSNFYFCSAS
Dasypus novemcinctus V865 igkv AAGV03057291.1 9562 ASGDIVMTQSPGSVAASAGETITLKCKASQSVSNGLAWHHQKPGQQPKLLIYHASNRASGVPDRFSGSGSGTDFTLTISRFQPEDLGNYYCQQYNSYP
Dasypus novemcinctus V866 igkv AAGV03057301.1 32566 ASGDIVMTQSPGSVAASAGETVTLKCKASQSVYSNLAWYHQKPGQAPKQLIYGASTRPSGVPDRFSGSGSGTDFTLTISRFQPEDLGNYYCQQYNSSP
Dasypus novemcinctus V867 igkv AAGV03057317.1 1065 ASGDIVMTQSPGSVAASAGETVTLKCKASQSVSNYYLNWYHQKPGQAPKLLIYYASKRPSGVPDRFSGSGSGTDFTLTINRFQPEDLGDYYCQQSNYYP
Dasypus novemcinctus V868 igkv AAGV03057321.1 644 ASGDIVVTQSPGSVAASAGETVTLKCKASQSVYSRLHWYHQKPGQAPKLLIYNASNRASGVPDRFSGSGSGTDFTLTINKFQPEDLGDYYCQQDYNSP
Dasypus novemcinctus V869 ighv AAGV03057420.1 1374 VLSQVQLQESGPGLVKPLQTLLLNCKVTGFSLTEYYVLWFRQSPGKGLEWIGRIRPDGSTDRNPTLQSRLSITRDTSKNEVYLKLNNLQAQETAKYYCAE
Dasypus novemcinctus V874 ighv AAGV03063107.1 4744 VLSQVQLQESGPGLMKPSQILSLTCKVSGFSITTSGYCWGWIRQPPGKGLQFLSRICASSNSYYNPSLKSRLSTSSDTSKNQFSLQLSSVTAEDTAMYYCSR
Dasypus novemcinctus V875 ighv AAGV03063119.1 20109 VLSQVQLQESGPGLVKPSQPVSLTCSVSGFSITTNYNCWSWIRQLPGKGLQWLSAICTDNSNYYNPSLRSRLSTSRDTSKNQFSVQLSSGTAEDTAVYYCAR
Dasypus novemcinctus V885 ighv AAGV03068229.1 1779 LLTPSQTLSLTCSVSGFPITTSGYCWHWIRQPPGKGLQWLSRICYDGSTNYNPSLKSRLSTSRDTSKSQFSVRLTSMTAEDTAVYYCARDTQ
Dasypus novemcinctus V888 igkv AAGV03070226.1 3879 ASGDIVMTQSPGSVAASAGETVTLKCKASQSVSSYVAWYHQKPGQAPKLLFYGTSTRPSGVPDRFSGSGSGTDFTLTISRFQPEDLGDYYCQQYDDYP
Dasypus novemcinctus V893 ighv AAGV03073007.1 21971 VLSELTMKESGPGLVKPSQTLSLTCSVSGDSISSYAWNWIRQRPEKGLEWMGSWYASASTGYNPAFQGRISITGDTSKNEYYLQLNSLTTEDTAKYYCAG
Dasypus novemcinctus V895 trbv AAGV03074186.1 6828 SVFSTLLSQTPSQVIRESGTSVTIQCRQIDNQDTFMYWYYQLPGQSLIMIATANQGSSATYESGFTEEKFPISRPELKFSVLTVSNVSPKDSGLYFCSSG
Dasypus novemcinctus V896 trbv AAGV03074188.1 1869 LMNAKVTQTPRYLVTRIGKKASLECVQHLGHDRMFWYRQDPAEGLRLIYYSFGVTMNEKGDVPDGYNVSRKNKEDFSLILESASTDQTSVYFCASSL
Dasypus novemcinctus V897 trbv AAGV03074190.1 5571 PTEAEVTQTPSHLITGTGKEVAVTCSQNMNHEAMYWYRQNPGMGLKLICYSINVDIVNKGEAPDGYVVSRKEKKNFPLTLVLTSTNQTSLYLCASSL
Dasypus novemcinctus V898 trbv AAGV03074191.1 10289 SMDSGVTQTPRNRITKTGKSITLECSQTNGHNQMYWYRQDLGLALRLIYYSFDVNEFKEGDVPNGYSVSRKDLTKFSLSIQSAIPNQTSLYFCASSD
Dasypus novemcinctus V899 trbv AAGV03074197.1 923 SMDTEVIQNPRHLVKGKGQTAKMNCTPIKGHSYVFWYRKTLEEELKFLIYFQNEDDIDKTGMPRERYSAKCFRNSSCSFEIENTEQEDSALYFCASSK
Dasypus novemcinctus V907 igkv AAGV03079100.1 1903 ASGDIVMTQSPGSVAASVGETVTLKCKASQSVYSSLYWYHQKPGQAPKLLIYGASNRPSGVPDRFSGGGSGTDFTLTISRLQPEDLGDYYCQQSSSYP
Dasypus novemcinctus V908 igkv AAGV03079111.1 25276 ATGDIVMTQSPGSVAASAGETVTVKCKASQSVYSNLAWYHQKPGQAPKLLIYYASTRPSGVPDRFSGNGSGTDYTLTISRFQPEDLGNYYCQQYDSRP
Dasypus novemcinctus V920 iglv AAGV03086402.1 19741 AVSQAVVTQEASLPISPGGTVTLTCGSSAGAVTSSNYAHWVQQKPYQTPRVLIYSTNNRIAGVPARFSGSLLGNKASLTITRAQPEDEADYYCAL
Dasypus novemcinctus V921 iglv AAGV03086416.1 14225 SWAQSVLTQEASVSGSLGGTVTLTCQGSSSSSIIGVVGAGWYQQHPGGALKTVMLGDTRPSGIPDRFSGSYSGNTASLTIAGLLPEDGAAYYCS
Dasypus novemcinctus V923 iglv AAGV03086421.1 10634 ASSQAVVTQEPSLTVSPGGTVTLTCGFSSGEVTNGHYPYWVQQKPGQAPRTLIYNTHSKPSGTPARFSGSLLGGKAALTLSGAQPEDEAEYYCWL
Dasypus novemcinctus V924 iglv AAGV03086427.1 29754 SWAHSVLTQPPSVSGNLGDSVTISCLGSSATVGSFYVHWYQQLPETAPRLLIYQDSSRSLGTPERFSASKSGSSASLTITGLQPEDEAAYYCECFN
Dasypus novemcinctus V925 iglv AAGV03086431.1 4824 SWAQAVLTQSPSASGALGQRVSISCSGSRTNIGRGISMYWLQELSGTSPRLLVYANSNRTSRVPDHFSSSTSGTLGTFTITELQPEDEADYYCSVWDSTSVL
Dasypus novemcinctus V926 iglv AAGV03086434.1 5216 SLSQTVLTQPTSLSSSPGTTARLPCTLSSDVSVGDKSIYWYQQKPGNPPRYLLRYKSDSSKYRDSGIPSRFSGAKSTSANEGLLLISGLQPKDEADYYCSI
Dasypus novemcinctus V927 iglv AAGV03086440.1 63557 ADLQPVVTQEPSLSVSVGGTVTLTCGMSSGSVSTSQYPSWYQQTPGQAPHMLIYSTSSRPSGVPNRFSGSISGNKAALTITGAQPDDEAEYHCALYIGSYK
Dasypus novemcinctus V928 iglv AAGV03086440.1 43666 TLSQPVLTQLSFLSASAGTSARLPCTLSSGFNVDDFWIHWFQQKPRSTAWYLLNYFSDADKYQCSGSSATYLEPKLPWPIQGCWLITELQPEDETAYYCDIWHE
Dasypus novemcinctus V929 iglv AAGV03086440.1 40294 SLSQSLLTQPPSLSAFSGTTTRLPCTLSSGISVGSKKIFWFQQKPGSPPQLFLSYYSDSDKQLGPGVPSRVSGSKVTSSNAAYLHISGVQPEDEAAYYCMF
Dasypus novemcinctus V936 ighv AAGV03090263.1 530 VLSEVQLVESGGDLKQPGGSLRLSCSASGFTFKDYTMHWVHQAPGKGLEWVSYISSTGGSTYYADSVKGRFTISRDNNKNQVYLQMNGLKTEDTALYYCAK
Dasypus novemcinctus V937 trbv AAGV03090300.1 1029 PADAGITQNPKYKIMRTGQDMTLTCTQNMNHDSMYWYRQDPGLGLRLIHYSVNVGITDKGEVLDKYNVSRTNKTHFPLLLESASASQTSVYFCSSSD
Dasypus novemcinctus V952 iglv AAGV03101810.1 13670 SWAQSVLTQEASVSGSLGGTVTLNCRSSSRSTTISIFGASWYQQHPGQAPKPVMLGTTRPSGIPTRFSGSKSGNTASLSISDLQTEDEADYFCSAAD
Dasypus novemcinctus V953 iglv AAGV03101813.1 14824 SWAQSPLTQPPSVSGTPGQTVALSCAGSSSDIGGYNCVSWYQQHPGTAPKLLIYDVSKRPSGIPARFSGSKSGNAASLSISGLLPEDEADYYCESYAGS
Dasypus novemcinctus V954 iglv AAGV03101816.1 1708 SVASYELTQPHSVSVALGQMVRLNCGGENIGHKIVQWYQQKASRAPRLLIYCNSNRASGIPDQFSRANSGNTAMLTISRAEAGDEADYYCPVWGSRISA
Dasypus novemcinctus V955 iglv AAGV03101827.1 11895 SVISNMLTQPSSLSVALGQTASLTCSGEMLSKIYAQWYQQKPGQAPVLLIYKDTERPSGISDRFSGSSLGNTVTLTISGAQVEDEAAYYCLSGENHI
Dasypus novemcinctus V956 iglv AAGV03101832.1 11927 SWAQSTLTQPPSVSGAPGQTVTIFCAGSSSDIGAYDSVSWYQQHPDTAPKLLIQDVSKRPSGIPARFSGSKSGNTASLSISGLQPEDETEYYCC
Dasypus novemcinctus V957 iglv AAGV03101836.1 15288 SVVSNMLTWPPSMIVALGQTARLTCSGGILTKKYTQWYQQKPGQAPVLIQDKNWPFGISDRLSGSSSGNIITLTISRIQVGDKADYYCQSVDSGA
Dasypus novemcinctus V958 iglv AAGV03101840.1 4379 SVASNELTQPRSVSVALGQTARLSCGGDNIGDSYVHWYQQKAGQAPLLVIYKDSERPSGIPDRFSGANSGNTATLTITGAEAGDEADYYCQALGSSSSA
Dasypus novemcinctus V974 igkv AAGV03108989.1 1290 ASGAIVMTQSPGSVAASAGETITLKCKASQSVRSYLAWYYQKPGQAPKLLIYDASNRASGVPDRFSGSGSGTDFTLTISRFQPEDLGDYYCQQDKSSP
Dasypus novemcinctus V976 ighv AAGV03109646.1 15341 VLSELTLKESGPGLVKPSQTLSLTCSVSGGSISSYSYGWGWIRQRPEKGLEWMGYWHTSAGTKYNPAFQGRISITADTSKNEYSLQLSSMRTEDTAKYYCAR
Dasypus novemcinctus V977 ighv AAGV03109649.1 39554 VQSEIQLLESGGDLLQPGGSLRLSCVTSGFTFSNYWMQWIRQAPGQGLEWIGEIHPNGGSQNYATSLKGRVTISRDNSKNTLYLQMSNLREQDTAMYYCGR
Dasypus novemcinctus V978 ighv AAGV03109658.1 10004 VLSELTLKESGPGLVKPSQTLSFTCSVSGGSVTSSYYWHWIRQSPEKGLEWMGDWSGSTSYNPAFQGCISITVDTSKNEYYLQLSSMRTEDKAKYYCTR
Dasypus novemcinctus V988 ighv AAGV03113429.1 33741 VLCEVQLVESGGDLRKPGGSLHLSCSASGYTFSDYGISWARQAPGKGLEWISSISYTGDSIAYADSVEGRFTTSRDNNKNQLYLQMNNLKIEDTGRYYCV
Dasypus novemcinctus V989 ighv AAGV03113430.1 15335 VLSELTLKESGPGLVKPSQTLFLNCSVSGGSISSYHWTWIRQSTAKGLEWMGEWSGSANYNPAFQGRISITADTSKNEYYLQLSSMRAEDTAMYYCA
Dasypus novemcinctus V990 ighv AAGV03113432.1 38206 VLSELTLKESGPGLVKPSQTLSLTCSASGGSISSNSYYWSWIRQRPEKGLEWMGYWHKSVSTKYNPAFQGRISITADTSKNEYYLQLSSMRTEDTAKYYCAG
Dasypus novemcinctus V992 ighv AAGV03114049.1 5831 VLSELTLKESGPGLVKPSQTLSLTCSASGDSITSSYYWCWIRQSPGKGLEWMGYWYPSANTHYNPAFQGRISITGDTSKKEYYLQLSSLRTEDTAKYYCAR
Dasypus novemcinctus V993 ighv AAGV03114052.1 1879 VLSELTLKESGPGLVKPSQTLSLTCSASGGSFTSSNYWSWIRQSPGKGLELMGYWYTSGSPYYDPAFQGRISITGDTSKNEYYLQLSSLRTEDTAKYYCAR
Dasypus novemcinctus V1011 igkv AAGV03122920.1 8077 ASGDIVMTQSPGSVAASAGETVTLKCKASQSVSNYLAWYHQKPGQAPKLLIYDVSNRPSGVPDRFSGSGSGTDFTFTISRLQPEDSDYYCQQRQSYP
Dasypus novemcinctus V1021 ighv AAGV03126557.1 4086 ILSQVQLQESGPGLVKPSQILSLTCSVSGFSITTSPYCWDWIRQSPEMGIQWLSRICYNGNIHYNPSLKSQLSTSRDISKNQFSVQLSPVTTEDTAVYYCGR
Dasypus novemcinctus V1022 ighv AAGV03126559.1 16099 VLSQVQLQESGPGLVRPSETLSLTCKVSSGSLTDYAMYWIRQGPGKGLEWVGCIYRSGSTDYNPSLQSRVGITRDTSKNEVYLKLTSVRTEDTAKYYCAI
Dasypus novemcinctus V1023 ighv AAGV03126562.1 25215 VLSQVQLQESGPGLVKASQTLSLTCTVSGFSLNSYHIHWVCQAPGKELEWAGRILSGGSMYYNPTLQSQLSITRDTSKNEVYLKLSRLRAEDTAKYYCAR
Dasypus novemcinctus V1032 igkv AAGV03128328.1 510 SSGDIVMTQSPGSVAASAGETVTLKCKASQSVSNYLNWYQQKPGQAPKLLIYYASRRPSGAPDRFSGSGSGTDFTLTISRFQPEDVGNYYCQQYESYT
Dasypus novemcinctus V1038 igkv AAGV03131113.1 1359 ASGAIMMTQSPGSVAASAGETITLKCKASQSVSSYLAWYHQKPGQAPKLLIYGASTRASGVPDRFSGSGSGTDFTLTISRFQPEDLGDYYCQQDKSSP
Dasypus novemcinctus V1049 igkv AAGV03135720.1 4726 ASGDIVMTQSPGSVAASAGDTVTLKCKASQSVSSYLNWYHQKPGQAPKLLIYGASYRPSGVPDRFSGSGSGTDYTLTISRFQPEDLGNYYCQQSSSYP
Dasypus novemcinctus V1052 igkv AAGV03136038.1 9636 SSGDIVMSQSPGSVAASAGETVTLKCKASQSVSNYLAWYHQKPGQAPKLLIYAASNRPSGVPDRFSGSGSGTDFTLTISRFQPEDLGDYYCQQRSSNP
Dasypus novemcinctus V1053 ighv AAGV03136127.1 13327 VLSEVQLQESRPALVNPLETISLICTVSDYSIASNFCWSWLRQSIEMGLEWIGCIRYDGSLYYNPSLQHRATISRDTFKNQFFLELKSATAVDTAMYYCAR
Dasypus novemcinctus V1080 igkv AAGV03145264.1 2530 ASGDIVMTQSPGSVAASTGETVTLKCKASQSVSSYLNWYHQKPGQAPKLLIYNASNRPSGVPDRFSGSGSGTDFTLTISRFQPEDLGDYYCQQRNSRP
Dasypus novemcinctus V1093 igkv AAGV03150801.1 963 ASGDIVMTHSPGSVAASAGETITLKCKSSHSVSDNLHWYHQKPGQAPKLLIYYASNRTSGVPDRFSGSGSGTDFTLTISRFQPEDLGDYYCQQGSSYP
Dasypus novemcinctus V1097 iglv AAGV03152577.1 7925 NWAQSVLTQAHSVSGALGQKVTITCSGSSTNIGGGNYVHWYQQLPGLAPKVLIYDNSNRPSGVPDRFAGSKSGTSGSMTITALQSEDEAVYYCQSYDNSLSA
Dasypus novemcinctus V1101 igkv AAGV03153079.1 13804 ASGDIVLTQSPGSVAASAGETVTLKCKASQSVSSYLEWYHQKPGQAPKRLIYKASTRPSGVPERFSGSGSGTDFTLTINGVQDEDLGMYYCQQWDTRP
Dasypus novemcinctus V1105 iglv AAGV03153491.1 4879 SVTSYELTQPRSVSVALGQTAKLSCGGDNIGNKYAHWYQQKAGQAPVMVIYEDSKRPSGIPDRFSGTNSGNTATLTISGTQAMDEADYYCQVWDSSSYA
Dasypus novemcinctus V1106 iglv AAGV03153495.1 2889 SMVSYELTQPGSVSVALGQTARLNCGGENIGNQHVQWFQQKEGQAPVQLIKLSSTRLSGIPDRFSGANSGNTATLTISRAESGDEADYYCQV
Dasypus novemcinctus V1122 iglv AAGV03162334.1 7842 SLSQPVLTQPPSASASLGASVKLSCTLSREHSSYIIEWYQQKPEKGPQFLMHVGSSGMTGSKGDGIPDRYSGSSSGADRFLSITNLQSEDEADYYCGVSHSSGY
Dasypus novemcinctus V1123 iglv AAGV03162345.1 6429 SWAQSVLTQETSVSGSLGGTVTLTCQDSSSNTIIGVIGAGWYQQHPGGAPKTVMLGNTRPSGIPDRFSGSYSGNTASLTITGLLPEDEADYFCSS
Dasypus novemcinctus V1124 iglv AAGV03162365.1 24005 VASQAVVTQEPTLSTSPGGTVTLTCGSSVVGVITARNYAHWVQLKPYQTPRGLIYDSNNRIPGVPARFSGSLLGNKALLTITGAQPEDEAEYYCAL
Dasypus novemcinctus V1125 iglv AAGV03162369.1 27515 SWVHSVLVQEVLVLGSLGGTVTITCTWSSTSIGQDGGVWYQQHPRNAPKTVMLRTTVPSRTPAWFSSSKSGILASLTISGLLPEDEAVYYCSAFGL
Dasypus novemcinctus V1126 iglv AAGV03162369.1 24448 VVSQAVVTQEASLSTSPGGTVTLTCGSSAGAVTMQSYVQWVQQKPYQTPWGLIYNDNRNTGVPARFPGSLLGDKASFTITGAQPEDEAQYYCAL
Dasypus novemcinctus V1129 igkv AAGV03162991.1 966 VSGDIMLTESPGSAAASAGKTVTLKCKSSQSVSHYLNWYQQKPGQSPKLLIYYGSNRASGVPDRFSGSGTGTDFTLTISRFQDEDSGNYYCQQSNDLP
Dasypus novemcinctus V1133 igkv AAGV03164580.1 18616 ASGDIVMTQSPGSVAASAGETVTLRCKASQSVSSYLHWYHQKPGQPPKLLIYSASNRPSGVPDRFSGSGSGTDYTLTINRFQPEDLGDYYCQQGNSYP
Dasypus novemcinctus V1134 igkv AAGV03164586.1 34738 ASGDIVMTQSPGSVAASAGETVTLKCKASQSVSSYLNWYHQKPGQAPKLLIYYTSNRPSGVPDRFSGSGSGTDYTLTISRFQPEDLGDYYCQQYYSSP
Dasypus novemcinctus V1135 igkv AAGV03164588.1 51619 ASGAIMMTQSPDSVAASAGETITLKCKTSQSVSSYLHWYHQKPGQAPKLLIYDASSRPSGVPDRFSGSGSGTDYTLTISRFQPEDLGDYYCQHGYL
Dasypus novemcinctus V1165 igkv AAGV03177915.1 30959 CRGHIPLTQFPETLAASPGSFVSITCRSSYNVGTSVACYQWRPKEVPRLLLCGASAWATGTPSRFRGSGSGFDFSLAIHRVEAEDMGVYYCQ
Dasypus novemcinctus V1170 igkv AAGV03179292.1 1128 ASGDIVMTQSSGSVAASAGETVTLKCKASQSVSSYLAWYQQKPGQAPKLLIYSASTRASGVPDRFSGSGSGTDFTLTISRFQPEDLGDYYCQRYYSGS
Dasypus novemcinctus V1171 iglv AAGV03179468.1 3154 ADSQTIVVQEPSLSVSVGGTVTLTCSLSSGSVSTSQYPSWYQQTPDQAPQVLIYRTSSRPSGVPNRFSGSISGNKAALTIMGAQPEDEAEYHCALHMGSDH
Dasypus novemcinctus V1176 iglv AAGV03182435.1 499 SLSQPVLTQPASLSSSPGTTARLPCTLSSDLSVGGKSIYWYQQKPGSPPQYLLLYKSDSSQHQGSGVPSRFSGAKDTSANAGLLLISGLQPEDETAYYCGT
Dasypus novemcinctus V1177 igkv AAGV03183738.1 13650 SSGDIVMTQSPGSVAASAGETITLKCKASQSVSSYLSWYHQKPGQAPKLLIYAASTRPSGVPDRFSGSGSGTDFTLTISRFQPEDLGDYYCQQRSSYP
Dasypus novemcinctus V1178 igkv AAGV03183746.1 12939 SSGDIVMTQSPGSVAASAGETVTLKCKASQSVSSYLHWYHQKPGQAPKLLIYYTSNRASGVPDRFSGSGSGTDFTLTISRFQPEDLGDYYCQHSYGYS
Dasypus novemcinctus V1179 igkv AAGV03183754.1 4709 ASGGIIMTQSPGSVAASAGETVTLKCKASQSVSSYLAWCHQKPGQAPKLLIYGASNRPSGVPDQFSVSGSGTDFTLTISRFQPEDVGNYHCLQGYSGS
Dasypus novemcinctus V1180 igkv AAGV03183765.1 13169 ASGDIVMTQSPGSVAASAGDIVTLKCKASQSVSSYLAWYHQKPGQAPKLLIYDASNRPSGVPDRFSGSGSGTDFTLTISRLQPEDLGHYYCQQRSSYP
Dasypus novemcinctus V1184 igkv AAGV03188572.1 1854 ASGGIVMTQSPGSVAASSGETVTLRCKASQSVSSYLNWYQQKPGQAPKLLIYGASNWASGVPDRFSGSGSGTDYTLTISRFQPEDSGHYYCQHGYGSP
Dasypus novemcinctus V1189 igkv AAGV03192036.1 1409 VSGDLVMTQSPGSVAASAGETVTLKCKASQRVYNYLNWYQQKPGQALKLLIYGASNRPSGVPDRFSGSGSGTDFTLTISRFQPEDLGDYYCQQYNSSP
Dasypus novemcinctus V1193 igkv AAGV03193885.1 433 ACGDIVMTQTPGSVAASAGETITLKCKASQSVGSYLNWYHQKPGHVPKLLVYLASTRPSGVPDRFSGSGSGTDFTLTINGVQDEDLGMYYCQKGNPTP
Dasypus novemcinctus V1198 trbv AAGV03195264.1 9380 HTGAGVSQSPRHRIAGSGQPVALRCDPIPGHAALIWYQQTLGQGPVLLIYFQNKDITDESGMAEDRFPAQRPNGSYSILKINSAKRGDSAVYLCASSS
Dasypus novemcinctus V1199 trbv AAGV03195264.1 3799 EVNSEVIQIPRYLIKAKEEHVTLRCSPKSGHNTVYWYQQALNQGLLFLVQYISGKETGKGNIPDRFSGLQFSDYRSELNMSSLQLEDSALYLCASSL
Dasypus novemcinctus V1200 trbv AAGV03195264.1 1010 EVNSEVIQIPRYLIKAKEEHVTLRCSPKSGHNTVYWYQQALNQGLLFLVQYISGKETGKGNIPDRFSGLQFSDYRSELNMSSLQLEDSALYLCASSL
Dasypus novemcinctus V1201 trbv AAGV03195265.1 9461 PVDSGVTQTPKHLVKARGQSVTLSCSPISGHLSVSWYQQALGQGPQFLVQYYNTKESDKGNIPDRFSSVQFGDFRSEFTVSSLQLEDSALYLCASSL
Dasypus novemcinctus V1202 trbv AAGV03195265.1 5751 PADAGITQTPKYKVMQTGQDMTLRCTQNMNHDSMYWYRQDPGLGLRLIHYSVDVGITDKGEVPDKYNVSRTNKTHFLLLLESASASQTSVYFCASSD
Dasypus novemcinctus V1203 trbv AAGV03195270.1 2915 AVDSGVLQTPRHLIRAKGQEVTLKCYPMSGHKNVYWYQQAPGQGPQFLVQHYNGGETDRGNIPNRFSGKQLSSHSELNINSSQLEDSALYLCASSL
Dasypus novemcinctus V1211 ighv AAGV03199990.1 8350 VLSQLTLQESGPGLVKPSQTLSLTCIISGGELSSSYYWYWIRHHPRKGLEELGFWTWKTSYNPAFEGRISITADTSMNKYYLQLTSMDVEDTATYYCAR
Dasypus novemcinctus V1216 ighv AAGV03203387.1 632 VLSELTLKESGPGLVKPSQTLSLTCSVSGGSITSSYGWNWIRQSPGKGLEWMGYWSGGTGYNPAFQGRISITADTSKNEYSLQLSSLTIEDTAKYYCAR
Dasypus novemcinctus V1219 igkv AAGV03205576.1 28099 ASGDIVMTQSPVSLSVSPGEMATINCKSSQNILSSSNQKNYLAWYQQKPGQAPKLLIYYASTRASGVSDRFNGSVSGTDFTLTISRFNAEDMADYYCL
Dasypus novemcinctus V1225 trdv AAGV03208792.1 2287 VMSAIVLVPEKQVVTVTVGKSVTLKCSMEGGAMRNYYMNWYRTTQDSTLTFIYREGGKYGPGFQSRFRGSVYSSNNLAVLEIREASLKDEGSYYCAGD
Dasypus novemcinctus V1226 trav AAGV03208799.1 11278 GSCRAKIMQSSSMTTIIGTDVTLLCQYDILDGNYDSVYWYLQKANQRLTYIYHATQDTTESGHYQLSVNRELSSSNLTIKHVQPKDKAIYYCAVQ
Dasypus novemcinctus V1227 trdv AAGV03208799.1 4900 VSLDIILEPRVKTLTVVAGNTAAFHCNITGDLNYRMSWYKKNEDNSLILVYRLSNTSNDDSRNNFKGKVDTLKNQFILEILKATTKDAGSYYCGAD
Dasypus novemcinctus V1228 trdv AAGV03208809.1 7130 ASQIQVHQSTNMVYKKEGEFVTLDCRFTVSYQYYYMYWYRQSSSGELSNVIYLYSETANSRKGRYSVVFQKTSKSLKLTISALMLEDSAVYFCAIRD
Dasypus novemcinctus V1229 trav AAGV03208819.1 1768 TRGKNKAEQSPEYLISQEGEFVTINCSYSTGMTTLQWLQQISGGSIVSLFLLSLEMKKKGRFSATINIEKSRSSLHITAAQPRDSANYICAV
Dasypus novemcinctus V1230 trav AAGV03208828.1 9248 SSTAQTVNQSQPEISVQEAEMATLDCTYDTSDSNYYLFWYKQRPSGKMIFIIRQHTYQEQNATENRFSVNFQKIAKSFSLKISDTQLEDTAVYFCALMG
Dasypus novemcinctus V1231 trav AAGV03208829.1 13906 SSLAQTVNQSQPEMSVQEAEMATLDCMYDTSDSNYYLFWYKQRSSGEMIFIIRQDAYKQQNAVQNRFSVNFQKAARSFSLKISDSQLGDAAVYFCALGD
Dasypus novemcinctus V1232 trav AAGV03208832.1 3067 VSSDKVIQSPPSLAVQEGDSATLNCSYEVTNFQNLQWYKQEEKAPSFLFTLFSNGDKKKAGRVSGTLDKKEFLSTLHITDTQPGDSATYLCAVE
Dasypus novemcinctus V1233 trav AAGV03208835.1 7117 VSGQQLNQSPQSMSIQEGENFTMNCNSSSIFNTFLWYKKDPGQGPVLLIALYKTGELTRNGKMAAQFGGTRKDSFLTISASKPDDAGTYFCAG
Dasypus novemcinctus V1234 trdv AAGV03208839.1 11298 SSMADNVIQDQTTITMQEGEDATFNCKYETTLTYYSLFWYKQPPSGEMVYLIHQDASKSNAKQDRYSVKFQKAKKSISLTISSLQLSDSAKYFCALL
Dasypus novemcinctus V1235 trav AAGV03208839.1 1480 IMGDAKTIQPNSIESTEGEPVKLPCNHATIIGSEYIYWYRQIFHQGPEYVIHGLKTNVTNGMASLIIPADRKSSTLILPRVTLRNTAVYYCILR
Dasypus novemcinctus V1236 trav AAGV03208841.1 7513 VSGQEKDVVQSPSILNVWEKETAVFNCTYRDEAWNYFPWYKKEAGKGPNLLVEIRSNVDRKQDGRVTVLLNKKAKHVSLHIKATQPGDSALYLCAA
Dasypus novemcinctus V1237 trav AAGV03208846.1 1774 GRVQLEVKQSPQVLILQEGRNSSLICNSSINIRNVQWFQQNPGGHLITLFSIATGMQQNGRLRATVNTRERYSHLYIRDSQSGDSATYFCAVE
Dasypus novemcinctus V1238 trav AAGV03208847.1 39451 VSSKLDVEQNPRLLHVQEGKSTNFTCNFPSNSLYALHWYRLEPEESPKILFVVSSNGDEKVEGRLRVTLNTKEGYSYFYIKGSQPEDSATYFCAL
Dasypus novemcinctus V1239 trav AAGV03208847.1 30954 VNGQQVKQIPQFLLIKEGEDSTLYCNSSSTFNNLQWYKQKPGGVPVLLMMLTKGGEVKKYKTLTAQFGEKRKDSSLHISATQTADAGTYFCAT
Dasypus novemcinctus V1240 trav AAGV03208847.1 21624 TLIDAKSTQPNSMDFTEGKAVTLPCNHSTISGNEYVHWYLQRPNQSPQYVIHGLRGNTTNEIASLIITTDRKSSTLILAQATLRDTAVYYCIVRD
Dasypus novemcinctus V1241 trav AAGV03208847.1 13455 GTRAQAETQSDDYISVSEGAPLELKCKYPSSGLTYLFWYVQYPNQGLQPLLKYVLGDSLVKGINGFEAEFKKSDSSFHLRKLSAHLSDSAEYFCVQS
Dasypus novemcinctus V1242 trav AAGV03208851.1 30130 VRGVEVKQYPPALSVQEGANSMLWCNFSTSVNNVQWFRQNPDGHLINLFYIPSGTQQKGRFSSTTVAKERHSSLNISSSQNTDSAIYFCAVVPQCSP
Dasypus novemcinctus V1243 trdv AAGV03208851.1 6749 SSVAQEITQVQSTISGQEGKSVTLDCLYETSWSLYYLSWYKQASSAELIFLIAQRSDSRNAKKDRYSTNLKKEDKSFRLTISTLQLKDSAKYFCTHSD
Dasypus novemcinctus V1244 trav AAGV03208854.1 14322 LSGEDRVEQHPQILRPQEGDRSSLNCSYSVSSFQGLQWYRQDPGKGPELLLLLYSVGDEKQKERLTATLSKKESFLHISDSTLEDSATYFCAVK
Dasypus novemcinctus V1254 ighv AAGV03213805.1 4100 VLCEIQLVESGGDLKQPGGSLRLSCLASGFTSGLTFDDYNMHWVRQAPGKGLEWVSGISTSGSTKYADSVKGRFTISRDNNKNQLYLQMNSLKPEDTARYYCTS
Dasypus novemcinctus V1255 ighv AAGV03213827.1 11347 VLSQVQLQESGPGLVKPSQTLSLTCSVSGFSITTSGYCWHWIRQPPGKGLQWLSEICYEGSTYYNPSLKSRLSTSRDTSKNQFSVQLRSGIAEDTAMYYCARE
Dasypus novemcinctus V1257 iglv AAGV03214954.1 9395 SLSQTVLTQPPSLSSSPGTTARLSCTLSRDVSVGDKYIYWYQQKPGGPPRYLLRYKSDSDKDQGSGVPRRFSGSKDASANAGLLLISGLQLDDEADYYCST
Dasypus novemcinctus V1258 iglv AAGV03214957.1 70422 SLSQPVLTQPASLSSSPGTTARLPCTLSSDLSVGGKSIYWYQQKPGSPPQYLLLYKSDSSQHQGSGVPSRFSGAKDTSVNAGLLLISGLQPEDEAAYYCGT
Dasypus novemcinctus V1259 iglv AAGV03214957.1 1968 SWTQSVLTQEASVSGYLGGSVTITCKVGSSGAAWYQQHPGGAPKTVMLRNTRLSGIPDRFSGSYSGNTAFLTISGLQPQDEAAYYCSTFDIPGV
Dasypus novemcinctus V1260 iglv AAGV03214960.1 5037 SLSQPVLTQPPSLSESLEKSVRLTCTLSSGFKVGDFWIRWYQQKQGNPPRYLLTFKSDSDKHQGSGVPSRFSGSTDVSANAGILLISGLQPGDEAHYYCCT
Dasypus novemcinctus V1268 ighv AAGV03218862.1 9678 ILCEVQLVESGGDLRPPGGSLRLSCLASGFTFSDYYMSWIRQAPGKGPEWVSEISSNGGSTYYADSVKGRFTISRDNNKNQLHLQMNSLKTEDTALYYCAK
Dasypus novemcinctus V1269 ighv AAGV03218869.1 16215 VLCEVQLVESGGDLRPPGGSLRLSCSASGFTFSSAYMGWIRQAPGKGLEWVSTITNTGGSTYYADSVKGRFTISRDNNKNQVYLQMNSLKTEDTALYYCAK
Dasypus novemcinctus V1272 igkv AAGV03219110.1 1543 ASRDTVMTQSPGSVAASSGKTVTLKCKSSQSVSSNLHWFQKKPGQAPKLLIYDASNRASGVPDRFSGSGSGTDFTLTISRFQDEDSGNYYCQQSNNLP
Dasypus novemcinctus V1281 igkv AAGV03225375.1 23760 AGVIGDIVMTHFPVSIAVSPGDTVTINCKSSQSISSNVDWFQQKKGQSPKLLIYRGSTKLSGVPDRFSGSGSGTDFTLTISRFQPEDVADYYCQQLNSYP
Dasypus novemcinctus V1291 igkv AAGV03230575.1 882 ASGDIVMTQSPGSVAASAGETVTLKCKASQSVSSYLHWYHQKPGQAPKLLIYDASKRPSGVPDRFSGSGSGTDFTLTINRFQPEDLGDYYCQQSNSRP
Dasypus novemcinctus V1295 ighv AAGV03232024.1 11318 VLCEVQLVESGGDLRQPGGSLRLSCSASGFNFGSTYMNWVRQAPGKGLEWVSEIRSTGGSTYYADSVKGRFTTSRDNNKNQLYLQMSGLKTEDTALYYCTS
Dasypus novemcinctus V1299 ighv AAGV03234371.1 20373 ILSQEHVQLQESGPNLVKPSQTLSLTCKVSGFSLASHSISWIRQSPGKGLEWVAAMVYDGETYYNPTHQSRLSITRDTLKNEVYLKLNSMTTEDMATYYCAR
Dasypus novemcinctus V1305 iglv AAGV03236315.1 601 SWTQSVLTQEASVSGSLGGRVTITCQDSSGSTDIPIVGATWYQQHPGGAPKPVMLGDTRPSGIPDKFSGSKSGNMASLTIRGLLPEDEAAYYCSAEII
Dasypus novemcinctus V1306 iglv AAGV03236316.1 1568 SWTQSVLTQEASVSGSLGGTVTITCQDSSGSTDIPIVGAAWYQQHPGGAPKPVMLGDTRPSGIPDKFSGSKSGNMASLTIRGLLPEDEAAYYCSAEII
Dasypus novemcinctus V1307 iglv AAGV03236318.1 37918 SWTQSVLTQKASVSGSLGGTITLTCQDSSGSTSIGEDGADWYQQHPGGTPKTVMVGDTRPSGIPDRFSGSYSGKTASLTIAGLLPEDEADYYCSAFDSTGA
Dasypus novemcinctus V1308 iglv AAGV03236326.1 21594 SWAQSVLTQVLSLSGALGQKVTITCSGSSTNIGGGNSVQWYQQLLGSAPKLLIYGNSNRPSGVPDRFAGSKSGISGSLTITALQPEDEAVYYCQSYDDSLRA
Dasypus novemcinctus V1309 iglv AAGV03236326.1 1842 SWTQSVLTQEASVSGSLGGTVTITCQDSSGSTSIPIVGAAWYQQHPGGAPKTVMLGDTRPSGIPDRFSGSKSGNTASLTITGLLPEDDADYYCSAVDSSAGV
Dasypus novemcinctus V1310 iglv AAGV03236330.1 26511 TWAQSVLTQVPSVSGALGQKVTISCSGSSTNIGGGNYVHWYQQLPGSAPKLLIYGNSNRPSGVPDRFAGSKSGTSGSLTINALQPEDEALYYCHSYDDSLRA
Dasypus novemcinctus V1324 ighv AAGV03247984.1 6035 VLSELTLKESGPGLVKPSQTLSLTCSVSGGSISGYYWSWIRQSPGKGLEWMGYWYTSGSSYYIPAFQGRISITGDTSKNAYFLQLSSLRPEDTAKYYCAK
Dasypus novemcinctus V1325 ighv AAGV03247992.1 1077 VLSELTLKESGPGLVKPSQTLSLTCSVSGGSISGYYWYWIRQRPEKGLEWMGNLYAPARTNYNPAFQGRISITADTSKNEYFLQLSSLTTEDTAKYYCAR
Dasypus novemcinctus V1331 iglv AAGV03253115.1 6957 SVASYVLTQPHSVAPGQTAKLSCGGDNIGDNYVQWYQQKTGQAPVLVIYEDSKRPSGIPDRFSGTNSGNTATLTISGTQALDEADYYCQVWKSGA
Dasypus novemcinctus V1348 ighv AAGV03264443.1 2187 HPEGVRPRTGEALADTIPHLLCSGGSITSSNYIWKWIRQSPEKGLEWMGFWYQSGSTYYNPAFQGRISITADTSKNEYYLQLSSLTTEDTAKYYCAR
Dasypus novemcinctus V1353 ighv AAGV03267287.1 1341 VQCVVHLLETVGELTQTRGFLRLSCTASGFIFSNSWMSWVRQTPGKLPEWLSNISTGTGTTKYYADSVKGRFITSRSNTKNQLYLQMTNLRTEDMALYYCA
Dasypus novemcinctus V1359 igkv AAGV03269278.1 4043 TSGDIVMTQSPSSVAASAGETVTLKCKASQSVYSNLAWYHQKPGQAPKLLIYSASNRPSGVPDRFSGSGSGTDFTLTISRFQPEDLGDYYCLHSYGYP
Dasypus novemcinctus V1360 ighv AAGV03269500.1 1598 VLSEVQLVESGGDLRQPGGSLRLSCSVSGLNINNNGMSWVRQAPGKGLEWVSSISSGGSTYYADSVKGRFTISKDNNKNQVYLQMNGLKTEDTATYYCTR
Dasypus novemcinctus V1362 igkv AAGV03269663.1 1107 ASGDIVVTQSPGSVAASAGETITLKCKSSQSVSSSLHWYHQKPGQAPKLLIYYASNRASGVPDRFSGSGSGTDFTLTINKFQPEDLGDYYCQQDYNSP
Dasypus novemcinctus V1367 iglv AAGV03271220.1 41201 NWAQAVLTQAPSVSGALGQKVTISCSGSSTNIGGGYSVQWYQQLPGSAPKLLIYGNSNRPSGVPDRFAGSKSGTSGSLTITALQPEDEAVYYCHSYDNSLSA
Dasypus novemcinctus V1368 iglv AAGV03271220.1 9998 SWTQSVLTQEASVSGSLGGTVTITCQDSSGSTDIGKYGADWYQQHPGGAPKTVMLGNTRPSGIPDRFSGSYSGNTASLTITGLLPEDEADYYCLAADI
Dasypus novemcinctus V1370 igkv AAGV03272228.1 1077 ASGDIVLTQSSGSVAASSGETVTLKCKASQSVSSYLSWYHQKPGQTPKLLIYYASTRPSGVPDRFSGSGSGTDYTLTISRFQPEDSGDYYCQHGYGSP
Dasypus novemcinctus V1371 igkv AAGV03272232.1 5780 ARGDIMLTESPGSAAASAGETVTLKCKSSQSVSHYLNWYQQKPGQAPKLLIYYGSNRASGVPDRFSGSGTGTDFTLTISRFQDEDSGNYYCQQSNYLP
Dasypus novemcinctus V1372 igkv AAGV03272234.1 11945 ASRDTVMTQSPGSVAASSGKTVTLKCKSSQSVSSNLHWFQKKPGQAPKLLIYDASNRASGVPDRFSGSGSGTDFTLTISRFQDEDSGNYYCQQSNNLP
Dasypus novemcinctus V1373 igkv AAGV03272237.1 25771 ASGDIVMTQSPGSVAASSGKTITLQCKASQDVSNSIAWNHQKPGQAPKWLIYDTSTRPSEVPDRFSGSGSGTNFSLTISRVQNEDLGDYYCQQYKRYP
Dasypus novemcinctus V1374 igkv AAGV03272238.1 4454 ARGDIVMTQSPGSMTASPGETITLKCTSSQSVRSHLAWYQQKPGQAHTLVVYAASNRAPGVPDRFSGSGYGTDFTLTISRVQPEDSGDYYCQQGNSNP
Dasypus novemcinctus V1392 iglv AAGV03279199.1 13783 SVSESVVTQPPSFSASLGTTARLPCTLSSGINVGRKNIFWYQKKPGSAPQLFLYYYSDSDKQLGPGVPSRVSGSKDTSSNIAHLLISEPQPEDEATYYCSI
Dasypus novemcinctus V1399 igkv AAGV03282049.1 1034 VSGDIVMTQSPGSVAASAGETVTLRCKASQSISSNLAWYHQKPGQAPKLLMYSASNRPSGVPDRFSGGGSGTDFTLTISRFQPEDLGDYYCQ
Dasypus novemcinctus V1402 igkv AAGV03283673.1 10554 AGASGDIMMTQSPGSVAASAGETVTLKCKASQSVSSYLNWYQQKPGQAPKLLVYYASRRPSGVPDRFSGSGSGTDYTLTISRFQPEDLGDYYCQQDYSSP
Dasypus novemcinctus V1405 ighv AAGV03286034.1 13524 VLSELTLKESGPGLVKPSQTLSLTCSVSGDSVASSYYWSWIRQSPGKGLESMGYWSGGSYYNPAFQGRISITADTSKNEYYLQLSSMRTEDTAKYYCAK
Dasypus novemcinctus V1408 igkv AAGV03289222.1 10223 ASGDIVMTQSPGSVAASAGETITLKCKASQSVSNYYLNWYHQKPGQAPKLLIYDASNRPSGVPDRFSGSGSGTDFTLTISRFQPEDLGDYYCQQDYSRP
Dasypus novemcinctus V1433 igkv AAGV03300345.1 2386 ASGDIVMTQSPGSVAASAGETVTLKCKASQSVSSYLNWYHQKPGQAPKLLIYNASNRPSGVPDRFSGSGSGTDFTLTISRFQPEDLGDYYCLQHNSRP
Dasypus novemcinctus V1448 igkv AAGV03310489.1 2089 VSGDIVMTQSPGSVAASAGETVTLKCKASQSVSSYLNWYHQKPGQALKLLIYGASNRPSGVPDRFSGSGSGTDFTLTISRFQPEDLGDYYCQQYNSYP