WGS Statistics
Organism WGS Record. Vs Total IGHV IGLV IGKV TRAV TRBV TRGV TRDV
Alligator sinensis AVPB00000000.1 (AVPB01) 334 112 60 28 77 29 15 12
Vgene Table
Organism Vgene Locus contig Contig Pos. AA sequence
Alligator sinensis Vs358 trgv AVPB01064389.1 19468 GDAKGLTQFKLSITKKESKTALIECHVSGMGNTYIHWYQQKSGKAPERILYLLSGKTVFDKESSQGKFEAYGDPSKDTYALTVKQIHKDDAASYYCAYWD
Alligator sinensis Vs359 trgv AVPB01064391.1 7570 GDSQGLRQSQTSVTRGVRKTARIQCHVSTVSFSSVYIHWYRQMPEETPERILYFSSEKPVFDKDSDKRKFEAEKELTESTCTLTIKTVNQNDSSTYYCAYWD
Alligator sinensis Vs352 trgv AVPB01064386.1 22245 LLWAIGLEQEPSFIVKQSKLGSTARITCHVTGGSSSTLIHWYRVLPRQALQRILYLSLSGDNLEQDIGSKDKFSAYGKQQACNFIVRNLKKTDSGDYYCAIWDL
Alligator sinensis Vs353 trgv AVPB01064386.1 25544 VLRAISVKQEQISITQPVDLHSTVSISCKVTGGSASTYVHWYRALPGQALQRLLYLTLEGSNVKRDTGFSREKFTAIVRQSTCTLLVRKVEKTDSGHYYCATWE
Alligator sinensis Vs351 trgv AVPB01064386.1 18359 LLWAIHLEQTPSVIVQQSHSSSTAAFTCKITDGLSSTYVHWYRVLPGQAPQRLLHLTLDGSNMKRESGISWDKLSASANPRVCTLEIHKLEKKDSGYYYCAVWD
Alligator sinensis Vs356 trgv AVPB01064389.1 5904 GDAQELTQSQLSITKDESKTAPIQCRVSGISLDSAYIHWYRQKPGKAPERILYLSSGTPSFDRDSDKGKFEAEKIPTASICTLTVRRISKKDAATYYCAYWD
Alligator sinensis Vs357 trgv AVPB01064389.1 14278 GDAQELKQPQVSITKQEYKTAPIQCRVSGISLDSAYIHWYRQKPGKAPERILYLSSGKPIFDRDSDKGKFEAEKILSDSTCTLTIEQTSKDDAATYYCAYWT
Alligator sinensis Vs354 trgv AVPB01064387.1 1204 GDAQVLKQSKSFITKEVQKTARIQCFVSGISLSSAYIHWYQQKPANAPEWILYLSSGEPVIDQGFKKEKFEVEKELTNSTCTLTVKQINKNDAATYYCAYWD
Alligator sinensis Vs355 trgv AVPB01064389.1 586 GSTQVLKQTQVSITKVESKTIRIECHVTVSNFGNAYIHWYRQRPGAPPERILYFSSQLHLDSDSDKEKFNAEKKIDKSLCILTIRRIASSDAATYYCATWT
Alligator sinensis Vs860 ighv AVPB01164404.1 4030 AWSQVQLVESGGDAKKPGGSLRLSCKASGFTFSSYHMNWVRQAPGKGLEWVAQISPDGSSQWYSPAVQGRFTISRDNSQNLLYLQMSSLKPEDTALYYCAR
Alligator sinensis Vs861 ighv AVPB01164405.1 3834 AASAVQLVETGPGVAKPGETLTLTCTVSEQSITASSTYWNWIRQAPSTGLEWMGVINYQGGTSYNSALQSRIAISRDTSKNQFSLQLRSLTAADTATYYCA
Alligator sinensis Vs862 ighv AVPB01164406.1 8253 TQSQVWLAESGGGVQVPGGSLRLTCQTSGFKFIGYWVEWFQLTPDMGLQWASEIRNAANNHADYYSNTVKGWFTVSSDDSSDLLYLQMNDLKAEDTALYYCT
Alligator sinensis Vs863 ighv AVPB01164406.1 13643 VLSEIKTVEYGGAIRKPGDSLRLSCKASGFTFSDTWMAWARQPPGKGLQWVGEIIGNSKTINYAPAVKGKFTISRDNTQNLLFLQMDSLSPADTARYYCAR
Alligator sinensis Vs864 ighv AVPB01164406.1 20800 AWSQVQLVESGGDVRKPGDSLRLSCKASGFTFSSYGMHWVRQAPGKGLDWVATINYGGSSQWYSPAVKGRFTISRDNSQNMLYLQMDSLKPEDTALYYCAR
Alligator sinensis Vs865 ighv AVPB01164408.1 3553 AQSQVQLVETGGDVRKPGDSLRLSCKASGFTFSNYWLGWVRQAPGKGLEWVSAIDNSGSSTYYIPGVSGRFTISRDNARALLHLDMSDLRPEDTGRYHCER
Alligator sinensis Vs866 ighv AVPB01164408.1 9799 ALSQVVLTQSGAAMKKPGESHTLQCVTSGFTLSDYGMNWVRQVPGKGLEWLIYYYSTSYNFYASSIKGRFTASKDSSTFYLQMSSLEASDTAVYYCAR
Alligator sinensis Vs867 ighv AVPB01164408.1 21581 VSSALHLVQSGPGLVKPGETLTLTCAISGFSITAQYYSWDWVHQHPGKGLECVYPFNRHTGSTTALKSQTTISADTSKNHVFLQLCSLTPTDAATYYCA
Alligator sinensis Vs868 ighv AVPB01164408.1 25862 VLSQIQMVQSGPGVLKPGETLTLTCAVTGESITTSSTYWEWILQSQSAGLKWMGQISFGGGTTYNSALQSRISMSRDTAKNQLSLELRSLTAADTATYYCAR
Alligator sinensis Vs1 trav AVPB01000118.1 5062 AASQEGLWLQQSPAEIWMIPGQTAELNCTILHKRSFLHWYKEHQDGSLQWVAQSGKYVEPKQRYSSKVSSTGKTHSLVINKLQEEDSGVYYCALDVS
Alligator sinensis Vs49 ighv AVPB01006787.1 392 PGVVKPGETLTLTCIVTGDSDKIISSDCCGWNWIRQSPRKGLEWMGYIVKSGSTSYVPSLQSRISLTVDSSRNQFSLHLRSLTAADTATYYCAR
Alligator sinensis Vs457 igkv AVPB01088467.1 6179 SLGEVVLTQTPETLAASPGDTVTIKCKASTSISNYIGWYLQKPGEAPKLLIYDSTNRVSGIPDRFSGSGSGTDFTLTISRVETKDAGDYYCQQRQ
Alligator sinensis Vs456 igkv AVPB01088457.1 1163 SSGDILVTQTPEAVVVSPGDTVTIKCKTSSSVSNWMNFYQQKPGQAPKLLVYKTSNRPSGIPDRVSGSGSGTDYTFTISRVEAGDAGDYYCQQASSP
Alligator sinensis Vs518 iglv AVPB01102045.1 7256 SSSQSVVTQPPAESVSSGNTVKLSCAMSSGTSISGYYVYWFQQKPGTPPRHLLRYKSDSNKHQGSGVPARFSASKDTSSNTCYLTIAAALAEDEADYYCAV
Alligator sinensis Vs516 iglv AVPB01102043.1 4807 PGSLAQYVLTQPPAASVSPGQTARLTCTGTSFRSYYVQWFQQKPGSAPLQLIYQDSKRPSGIPDRFSGAKSGDTATLTITGVQAQDEADYYCQVWDSSSSQ
Alligator sinensis Vs517 iglv AVPB01102044.1 5051 SLAQYVLTQPPSVSVSPGQTAPLTCSGTNIGSYNVQWYQQKPGSAPRLIIYNDDSRPSGIPDRFSGANSGNMATLTITGVQAQDEAEYYCQVWDSSSDL
Alligator sinensis Vs34 ighv AVPB01005178.1 5323 VQSAVELVQSGAVVKKPGETVKISCKTSGFTFTDSYMDWVQQAPGKGLVWVGDIDPEDGSTNYAETLKGRVSITTDNSISTVYLQLSRLSPADTAMYYCA
Alligator sinensis Vs30 ighv AVPB01005173.1 9647 AVGAVTLTQPGSAFARPGESITLTCGTSGYNINDHHMHWLRQADGKGLVWMAAFRTGHATYIANEFKGRVTPSTSGSTAKLQIARLTLADTATYYCTRE
Alligator sinensis Vs31 ighv AVPB01005173.1 13999 AVGAVTLTQPGSVFARPGESIILTCDTSGYNINDYLMHWLRQADGKGLVWMAAFRTGHATYIANDFKERVTPSTNDSTAKLQIARLTLADTATYYCTRE
Alligator sinensis Vs32 ighv AVPB01005174.1 2118 TLGAVTLTQPGSASARPGESITLTCDTSGFSVDYYHINWIQEAPGKGLVWMAGFRMGYDTYIANDFKGRVTPSTNDSTAKLQIARLTLADTATYYCARE
Alligator sinensis Vs33 ighv AVPB01005178.1 2610 VQSAVELVQSGAVVKKPGETVKISCKTSGFTLTDYYMGWVQQAPGKGLVWVGRIDPEDGSTSYAETLKGRVSITTDNSISTVYLQLSRLSPADTAVYYCA
Alligator sinensis Vs810 trav AVPB01153375.1 5307 AEGRAEILQPDSTYVVERAPLNLTCSHPSVLSNAYIHWYRQFPNGGPKYIVHALKRTVHFSAPEGALHISADKKSSTLELRGAGLGDAAVYYCAVG
Alligator sinensis Vs1184 trav AVPB01068069.1 22767 AASQEGLLLQQSPAEIWMTPGQTVEINCTVSRQQRLVPWYREHQDGSLQWVARTGKHVPAQGRYSSKVSSTEKSFSLVISDVREEDSGVYYCALAAY
Alligator sinensis Vs601 trbv AVPB01111918.1 1354 LLDARITQTQSLVLRKGGTAQLQCEQTYGHQRMFWYRQDLGQGPQLLFQFDHEEETGKGNVSHQFTAKRSGAKVLHLNITSVEPQDSAVYFCASSA
Alligator sinensis Vs974 iglv AVPB01013350.1 3117 LFAQNVVTQPPAVSVSPGQTAQLTCSGPGSYVHWYQQKPGSAPLLIIYGNTNRPSGISDRFSGSKSGNTATLTITGVQAQDEADYYCSMWVSSSSQ
Alligator sinensis Vs789 igkv AVPB01150145.1 20428 SSGQVVVTQTPESLAVSPGDQVTIKCKASSSFTYSSYQVLAWYQQKPGQAPKLLIYRASTQQSGLPARFSGSGSGTDFTLTISSVEAEDAGDYYCQQ
Alligator sinensis Vs600 trbv AVPB01111917.1 4106 LCSGVTVTQKKKFIAIQNGTSAILPCEHNDNKYFTILWYRQKAGAGGELEFVARSVDESPAEIEEKFQRFFKLKRENTLKASLEISGTAGDSAVYFCAAR
Alligator sinensis Vs1477 trdv AVPB01132566.1 3072 AARWALAQVSQPPRLTALEGGRLHISCNHNITPHQRMYWYRQPPQGQGAPIFLGSGYDGTSPAGELTMEVYLASRSSTLSRDGARLQDAGIYYCATE
Alligator sinensis Vs83 iglv AVPB01012624.1 2353 SSSQSVVTQPPAESVSPGNTVKLSCTMSSGTSISGYYVYWFQQKPGTPPRHLLRYKSDSNKHQGSGVPARFSGSKDTSSNTGYLTIAGALAEDEADYYCAV
Alligator sinensis Vs781 igkv AVPB01150137.1 31322 SSGDIVMNQTPESLAVSPGDTATITCKAVTYSGSNIAWYQQKSGQPPKLLIYSTNSRPSGIPDRFSGSRSGSDYTLTISRVEVGDAGDYYCQQYSSSP
Alligator sinensis Vs780 igkv AVPB01150137.1 26527 SNGDVVLIQTPESLTVAPQDTVTITCNAGSYTSSSIAWYQQKSGKSPKLLIYSTSSRASGISDCFSGARSGNDYTLNISRVEAGDAGDYYCQYHGAA
Alligator sinensis Vs783 igkv AVPB01150137.1 43254 SSGDIVMNQTPESLAVSPGDTATITCKAVTYSGSNVAWFQQKSGQPPKLLIYSTNSRPSGIPDRFSGSRSGSDYTLTISRVEVGDAGDYYCQQHSSYP
Alligator sinensis Vs782 igkv AVPB01150137.1 34571 SNGDVVLIQTPESLTVAPQDTVTITCNAGSYTSSSIAWYQQKSGKSPKLLIHSTSSRASGISDRFSGARSGSDYTLTISRVEAGDAGDYYCQYHGNTP
Alligator sinensis Vs785 igkv AVPB01150139.1 1951 CSGDIVMTQTAESLTVSPGQTATMNCKAVSYCGSSIAWYQQKSGQPLKLLLYSTNTRPSGIPDRFSGPSLGSDCTPAMSQVEAGNAGDYYCQQH
Alligator sinensis Vs784 igkv AVPB01150137.1 46538 SSGDVVVTQTPASLSVSPGDTATINCNTGSYSTSSIAWYQQKPGQAPKLLIYSKTSRPSGIPDRFSGSGSSTAFTFTISRVEAGDAGDYYCQYHGATP
Alligator sinensis Vs787 igkv AVPB01150145.1 1226 SSGQIVVTQTPESLAVSPGDRVTIKCKASSSLASGSYQLLAWYQQKPGQAPKLLIYFGSTRQSGVPARFSGSGSGTDFTLTISSVEAEDAGDYYCQQ
Alligator sinensis Vs786 igkv AVPB01150140.1 6040 SSGQAVLTQTPASLSLFPGDRVTINCRASSSIKATSEVSYLNWYQQKPGQAPKLLIRYASSRPSGIPDRFSGSGSGTDFTFTISRVEAGDAANYYCQQSFQ
Alligator sinensis Vs1134 igkv AVPB01053098.1 11684 SSGQVVMTQTPESLSVVPGQTVTINCKASSSIGSYAHWYQKKPGQAPKLVIYNANSRPSGIPDRFSGSGSGTDFTLTISRVEADDAGDYYCSQSGYSVP
Alligator sinensis Vs778 igkv AVPB01150133.1 5553 VCGDIALTQTPESLAVSAGDTVTIKCKASEYSGSSSMAWYQQKSGQAPKLLIYDVSSRPSGIPDRFSGSGSGTDFTLTISRVEAGDAGDYYCQQYYGSP
Alligator sinensis Vs779 igkv AVPB01150137.1 12007 SSGDILLMQMPESLAVSPGETITIICKAITSSGSYIHWYQQKKGQPPTLLISGTNSRVLGIPDQFSSSKSDSNYTLTISRVEADDAGDYYCQQTGSLPF
Alligator sinensis Vs1441 trav AVPB01130489.1 2895 GISAQSVRQTEGSLTVREGHPVFINCTYKDSGAPFLLWYRQVPGDAPRLLLTQYKDLEEEKEKGGRGFSADLDKSSSSFHLEKSASEVSDSAVYYCAMS
Alligator sinensis Vs1442 trdv AVPB01130491.1 2058 LTQGQSSASQTQRDVARLRGENVTLECTFSTSSQYYSLFWYRQRGPGAMEFLFRVDEDSYERKAAGRRFSVEFKKSERSLSLSVAELELEDAALYFCS
Alligator sinensis Vs1443 trav AVPB01130492.1 10742 AAVTAEILQPGSAEAREGAPLNLTCSHGSVSTQYIFWYRQFPNGGLQFLVSGYSGFVPVSAPEGALHISADRRASALALRRAGRGDAAVYYCALS
Alligator sinensis Vs1444 trav AVPB01130492.1 7924 GISAQSVRQTEGSLTVREGHPVFINCTYKDSGAPFLLWYRQVPGDAPRLLLTQYKDLEEEKEKGGRGFSADLDKSSSSFHLEKNASEVSDSAVYYCAMS
Alligator sinensis Vs1445 trav AVPB01130492.1 4065 AVRGDSVHPEKAHVTAAEGHIVTIRCNYTASTAYDYYVYWYRQHQNRTLQYILRRGTKTVSGVRDNAPFAEERFLSEAGDSDTTLNITALELADTAVYHCALQ
Alligator sinensis Vs1446 trav AVPB01130492.1 1667 AVRGDSIQSQDPDMSRGEGDSVTLRCSYSTSDRYVYLYWYRQYPNQAPQYILYKGARSSSSSSDTAGFAQKRFSSQADYSTTVLNIAALEPADSAVYYCALRV
Alligator sinensis Vs1447 trav AVPB01130493.1 6071 ATGRAQILQPGSAEAPEGAPLNLTCAHSSIKTNENVFWYRQFPDRGLQFLVSGYKGTVSSSALEGALHISADRRASALALRRAGRGDAAVYYCALS
Alligator sinensis Vs1448 trav AVPB01130493.1 2190 FCCRAQVSQSPEALVTREGDRSTMACAYSSTFQTFQWYRQAPSGEITHLLSVSANRNVTEGRFTGESREDGKKGSLHLSQTQMGDSGRYFCAVQD
Alligator sinensis Vs1449 trav AVPB01130494.1 5227 AVRGDTVHPEKPQVTAAEGDAVTLRCNYTSNSIGYNDYLYWYRQFPNQTLQYILRRGTKTDSGVRDNAPFAKEKFSSQAGDSDTTLNITALEWTDTAVYHCALQ
Alligator sinensis Vs1611 iglv AVPB01163628.1 10763 SLAQYVLTQPPSVSVSPGQTAQLTCSGDNVASKNVYWYQHKVSSSPVLVMYNSRSRPSGIPDRFSGASSGNMATLTITGVQAQDEAVYYCEVWVTASS
Alligator sinensis Vs1613 iglv AVPB01163631.1 9859 SLAQYVLTQPPSVSVSPGQTAQLTCSGDNVASKNVYWYQHKVSSSPLLVMYNSRSRPSGIPDRFSGVSSGNTAVLTIIGVQAQDEAVYYCEVWVTASS
Alligator sinensis Vs1612 iglv AVPB01163631.1 15017 SLSQFTLTQPPSESVSLGNTVKLSCTISSGKTLGGVAWYQQKNGNSPRYLLMFNTDSDKHQGSGVPSRFSGSKDTSNKIGYLTITNAQAEDEADYYCTAWTSE
Alligator sinensis Vs322 ighv AVPB01057895.1 23865 VLSAIQLLQSGPAAAKPGQTLTLTCAVSGESITSQTKGWTWLQQPPGRSLEWMGYLHHSGTTYYSPALQSRITISRDTSKNQFSLQLRSLTAADTATYYCATG
Alligator sinensis Vs321 ighv AVPB01057895.1 17106 VLSQVQLQESGPAVVKPGETLTLTCAITGGSVSSTSHTWDWIRQPPSQGLEWAGRIYYRSSWSTDYATSLKGRITITQDTSKNQFSLQLRSLTAADTATYYCAR
Alligator sinensis Vs320 ighv AVPB01057895.1 10302 AVSAVTLVESGPGVVKPGETLTLTCAVSGVSITDSSYSWHWIRQPPGRELKWVAQIYPYDGRTWFNPALQSRTTISADKSKNQFSLQLRSLAAADTATYFCAR
Alligator sinensis Vs859 ighv AVPB01164403.1 9885 AWSQVQLVESGGDAKKPGGSLRLSCNASGFTLSSSYMNWVRQTPGKGLDWVAEISPDGSNQRYSPAVRGQFTISKDNSQNLLYLQMSSLKPEDTALYYCST
Alligator sinensis Vs858 ighv AVPB01164403.1 7407 VSSQIQLTQAGAEVKKPGEAVRLTCKASGYTFTSYGINWVRQAPGKGLEYIGRLNANSGATAYAEAFKGRLTITIDTSISTAYLQLSSLGASDTAMYYCTR
Alligator sinensis Vs851 ighv AVPB01164398.1 2817 VQSQFQLHESGPGVVKPGETLSLTCTVTGGSVTSSSWWNWVWQAPDKGLEWMGMWTDSTYYHTNLQNRITISVDSSSTNYYLRLSSLTAADSAMYYCAR
Alligator sinensis Vs850 ighv AVPB01164397.1 1867 ATSAVTLVESGPGVVKPGETLSLTCAVSGVSISDASYGWQWIRQPPGKGLEWVARIYPHNGGTLFNPSLQSRTTISADKSKDQVSLQLRSLASADTATYFCARR
Alligator sinensis Vs853 ighv AVPB01164400.1 2234 AASAVTLVESGPGVVKPGETLTLTCAVSGISITDSSYVWDWIWQPPGKGLEWVAQIYPHGGGTAFNPSLRSRATISADKFRNQFPMQLHSLTATDTAKYYCAS
Alligator sinensis Vs852 ighv AVPB01164399.1 5219 ATSAVTLVESGPGVVKPGGTLTLTCAVSGASIYDSSYGWNWIRQPPGKGLEWVAYIYPYSGGTLFNPSLQSRTTISADTSKDQVSLQLRYLAAADTATYFCAR
Alligator sinensis Vs1023 iglv AVPB01027895.1 13871 LFAQNVVTQPPAVSVSPGQTARLTCSGTGSYVHWYQQKPGSAPLRIIYDDTKRPSGISDRFSGSKSGSTATLTITGVQAQDEADYYCSMWVSSSSP
Alligator sinensis Vs854 ighv AVPB01164400.1 5866 CFVSLLPGVLSEVQLILTLICAVSGESITTTSGWWTWAQKPPRKGLDYMGQIYGNSAALESVASLQSQITIPTDTSKNQFSLHLCSLTLTDTATYYCVRV
Alligator sinensis Vs857 ighv AVPB01164403.1 3053 AVSAVTLVQSGPGVAKPGETLTLTCTVSGVSIADSSYEWNWIRQPAEKGLEWVAYIHPYGGSTYYNPSLQSQTTISADTSKNQLSLQLRSLAAADTATYYCARE
Alligator sinensis Vs856 ighv AVPB01164402.1 11185 AWCEIQLVESGGDVRKPGASLHLSCKGSGYTFSSHQMVWVRQAPGKGLEWIAFIDVTTIYYADSVKGRFTISRDNPSSLLHLQMNSLKPEDTALYYCAR
Alligator sinensis Vs85 iglv AVPB01012625.1 6486 SLAQYVVTQPPSVSVSPGETTRLTCSGNSISGKYVQWYQQKPGTAPLLIIYENSKRPSGIPDRFSGAKSGDTATLTITGVQAQDEADYYCQVWDSSK
Alligator sinensis Vs84 iglv AVPB01012625.1 4768 SLAQYVVTQPPSVSVSPGQTARLTCSGNNIGRKSVHWYQQKPSSAPLLIIYSDSNRPSGIPDRFSGANSGNTATLTITGVQAQDEADYYCQVWDSSSSQ
Alligator sinensis Vs521 ighv AVPB01102463.1 267 VQSAVELVQSGAVVKKPGETVKISCKTSGFTFTDSYMDWVQQAPGKGLVWVGDIDPEDGSTDYAETLKGRVSITTDNSISTVYLQLNRLSPADTAMYYCA
Alligator sinensis Vs520 ighv AVPB01102438.1 888 GVSSQIQLTQSGAEVKKPGELVKLTCRTSGYTFTSYNMNWVRQAPGKGLEYIGYINTTTSGTSYAEAFKGRFTITMDTSISTAYLQLNSLKTDDTAVYYCAR
Alligator sinensis Vs398 ighv AVPB01074690.1 867 PVQSQLQLQESGPGVMKPGETLSLTCTITGGSVTSSHWWNWVQQAPGKGLERVGGWGGSTYYNAAFQNRITSSVDSSSTKYYLRLSSLTAADTATYYCARG
Alligator sinensis Vs399 ighv AVPB01074690.1 2664 VLSAVQLVESGPRVVKPAETLTLTCTVTGSSITSGYDWSWIQQPPGKGLEYMGYINYGGSTGYNPSLQSRITISRDTSKNQFSLQLRSLTATDTATYYCAR
Alligator sinensis Vs88 ighv AVPB01013189.1 428 VSAEIQLTQSRAEIKRAGESVQVMCKASGYTFTSNNMNWARQAPRKGLEWLAYINPSSGDTGYAKALQGRLAVSKDASISTAYLQLSSLKVDDTAMYYCGR
Alligator sinensis Vs932 ighv AVPB01006285.1 6888 VLAQVTLKESGPEVVKPGETLSLTCTVSGFSLTSYGVEWVRQAAGKGLQWVGGIGSDGNTGYNSALQSRLTITRDTSSSQVHLRLTGVQPVDTARYYCAG
Alligator sinensis Vs933 ighv AVPB01006285.1 624 VWSQVQLLQSGPGVVKPGETLTLTCAVSGQAITTSNTWWHWIRQPQPELESMGYISYSGSTGYSPSMQSRISISRDTSKSQISLNLRSLTAADTATYYCAR
Alligator sinensis Vs931 ighv AVPB01006284.1 3141 VWSQVQLLQSGPGVVKPGETLTLTCTVSGQAITTSNTWWHWIRQPQPELESMGYISYSGSTGYSPSMQSRISISRDTSKSQISLNLRSLTAADTATYYCAR
Alligator sinensis Vs934 ighv AVPB01006288.1 416 VLSQITLKETGPGVVKPGETLSLTCTVSGFSLTSYDVSWVRQAGGEGLQWVGVIWGDGSTNYNSALQSRLTITRDTSRSQVHLRLTAVQPADTAQYYCAR
Alligator sinensis Vs1533 ighv AVPB01144640.1 3301 VSSQIQLTQSGTEVKKPGESVNLTCKTFGYSFTTYNVDWVRQVPGKGLEYIGGINTNTGGTSYAEAFKGRFTITRDTSISTVYLQMSSLKTDDTATYYCAR
Alligator sinensis Vs738 trav AVPB01142631.1 6344 AVRGDSVHPEKPLVTAAEGDAVTLRCNYKTSTSANYYLYWYRQHPDQTLQYILLRGTKTVSGVQDTAPFAEQRFSSQASDSDTTLNITALELADTAVYHCALQ
Alligator sinensis Vs739 trav AVPB01142631.1 10888 AVRCDSIQSQESQVSRGEGDSVTLRCSYSTSDQYPFLYWYQQYPNRASQYILVRGARSSSSITRTADFAENRFSSHADHSTTVLNITALGRADTAVYYCALRL
Alligator sinensis Vs632 iglv AVPB01119654.1 3328 ANSQPALTQPPAESVSPGNTVKLSCTMSSGTSISDYAVYWYQQKPGTPTRYLLYYKSDSDKHQGSGVPARFSGSKDTSSNTGYLTIAGGPQEDEADYYCTV
Alligator sinensis Vs730 trav AVPB01142620.1 9474 AALADAIQSAAAQVSAAEGGTVTLRCSYNTSYNAAYYLYWYRQYPNRTLQYLLYRGAKTAKSASSTADFARERFSSETDDTSTELKIITLELADTAVYHCALQE
Alligator sinensis Vs731 trav AVPB01142620.1 11661 AARGDSIRPEEEQVSAAEGATVTLRCFYTTTYSAGYYLYWYRQHRDRALQYILYRGTKERRRERGAADFAQARFSSQTNDNSTVLNITSLELGDTAVYHCALQY
Alligator sinensis Vs732 trav AVPB01142624.1 9228 AVRGDSIQSQDPELSRTEGDSVTLRCSYSSNDNYVVLFWYRQYPNRAPQYILYRGAKSLSSDSNTAGFAQNRFSSLADHSTTVLNITALEWADTAMYYCALRG
Alligator sinensis Vs733 trav AVPB01142626.1 2693 VRGTAQILQPPSAEALDGAPLNLTCDHSSFTLGDYIHWYRQFPNRGPQFIVSGSKDTVQVSDPEGALHISADRKSSRLALRAAGRGDAAVYYCAVS
Alligator sinensis Vs734 trav AVPB01142627.1 3573 AALGDSIQPEEFQVSATQGVAVTLRCSYSTTYTSGYYLYWYRQHRDRALQYILYRGTKELSKYGGTAEFARERFSSQADDNSTALTMTALEQTDTAVYHCALQY
Alligator sinensis Vs735 trav AVPB01142628.1 907 AVQGNSIQSQESQESRGEGDSVTLRCSYSTSDEYVYLYWYRQYPNRAPQYILYRGARSRSSVTHTAGFAQKRFSSQADRTTTLLVISTLELADTAVYYCALIL
Alligator sinensis Vs736 trav AVPB01142631.1 961 QANANTVSQSAGTVTVREGDSVSINCTYSYAGPSFLFWYVQFPNEAPRLLLTQYEAQDEEEEKRRLGFSADLQKDSSSFHLGKTSSQASDSAVYYCALR
Alligator sinensis Vs737 trav AVPB01142631.1 3566 AVTADSIQPEEAEVSAAEGDQVTLRCFYTTTYSTGYLVYWYRQHRDRALQYILHRGTKDRSRSSDTADFAKVRFSSRADDNSTVLNITALELGDTAVYHCALRY
Alligator sinensis Vs594 trbv AVPB01111912.1 21908 LLDARISQTQSLVLKKGGLALLECEQTDGHYAMFWYRQDVGQGLQLVFYFYNEKERERGNISDRFTASQLGAKVFHLNISAVEPQDSAVYFCASSL
Alligator sinensis Vs596 trbv AVPB01111913.1 4755 RLDARISQTQSLVLKKEGLALLQCEQTYGHNTMFWYRQDLGQGPQLLFCFYHETETERGNISHRLTAARSGEKVLHLNISAVQPQDSAVYFCASSK
Alligator sinensis Vs597 trbv AVPB01111914.1 3732 LCTGVMVTQKKFIAIKNGTTASLPCEHDDSSYYVILWYRQQEGTGGEMEFVARHAEGNEVEIGPKFKERFTLNRKNTLKASLDIKETAEDSAVYFCAASK
Alligator sinensis Vs591 trbv AVPB01111911.1 1625 AGAGDLISQWPKSTVQSPGETVALSCYQNHTTHIYMFWYLQPRGHGLILIASAYTNTEASYEKGYNKSKFPISRNETKLSVMTVMSITAGDAATYFCAASE
Alligator sinensis Vs593 trbv AVPB01111912.1 17621 VCTGVTVTQEKFVSIETGTNASLHCEHNDSSYITILWYRQQEAARGQLEFVALHVDRNEAEIESKFKKRFKLTRTNTLKASLEITGGTAEDSAVYFCAASK
Alligator sinensis Vs598 trbv AVPB01111915.1 11651 LCSGVTVTQKKKFITIQNGNNAILPCEHNDNSYIIILWYRQKTGAGGELEFVARSVDNNPEEIEEKFKTFVKLKRENTLTASLEISGRAGDSAVYFCAAST
Alligator sinensis Vs595 trbv AVPB01111913.1 1284 LCTGVTVTQKKFIAIMNRTTASLPCEHDDSNNYAILWYRQQKGAGRKLEFVARQITGNEAEIETKFKERFKWKQTNTFKSSLDIMVGAAEDSAVYFCAASK
Alligator sinensis Vs599 trbv AVPB01111916.1 3292 LLDARITQTQSLVLRKGGTAQLQCEQTYGHQRMFWYRQDLGQGPQLLFYFYYEKETEKGNIPDRFTAEMAGAKVLHLTISAVESQDSAVYFCASSA
Alligator sinensis Vs183 ighv AVPB01035708.1 1767 GVTSQVQLTQSGVEVKKPGESVKLTCRTSGYTFTSYSMRWVRQAPGKGLEYIGWINTNGTGYAEAFKGRFTITMDTSISTAYLQQNSLKTEDTAVYYCAR
Alligator sinensis Vs1659 ighv AVPB01168195.1 2445 IQSQSQLQESGPGVVKPGETLSLTCTITGGSVTSSYWWNWIRQASGKGLEWIGAWTGSTSYNPALQNRIAISVDSSGTKYCLRLSSLTAADTTMYYCVGS
Alligator sinensis Vs745 igkv AVPB01143799.1 679 SSGDILITQTPESLAKSPGDTVTIKCTASSSVSSWMHLYQQKPGQAPKLLVYRTNNRPSGIPDRFSGSGSGTDFTFSISRVEDGDAGDYYCGQSSYNP
Alligator sinensis Vs1650 ighv AVPB01168190.1 2015 ALSQVTLTQSGAAVKKPGESHTLQCVTSGFSLSGTSMYWIRQAPGKALEWIVYFYSSSDNSYASSIKGRFTASKDSSTFYLQMNSLKAEDTAVYYCAR
Alligator sinensis Vs1653 ighv AVPB01168192.1 6079 GSSQIQLTQSGAEVKKPEESAKLSCKTSGYTFTSTNMYWIRQPPGKGLQWVGEINPSSDGTWYGQGFQGRFTISKDTSTSTVFLQLSSLRTDDTAMYYCAH
Alligator sinensis Vs1652 ighv AVPB01168191.1 1721 VHPQIQFSQSGAEIKKPGESMKLTCKASGYTFTDYSIAWVRQAPGKGLEWIANIRTDNFNTFYPEGLKGRITVSVDTSISTSYLQLNTLKTEDTAVYYCA
Alligator sinensis Vs740 trav AVPB01142631.1 13286 AVLGDWIRPQKSLVSGAEGSAVTFGCSYSSSYSGVILSWYRQYPARAPQYVLARGAKGSKGYEHYAAFARVRFSSQADDSSTVLRIAALERADTAVYYCALSE
Alligator sinensis Vs1657 ighv AVPB01168194.1 13580 VLSQGQLVQSGPGVVKPGETLTLTCAVSGESITTTDTWWHWIRQSQVTGLEWMGHIFFDGSTSYKSALQSRISISRDTSENQFSLQLRSLMAADTATYYCVRE
Alligator sinensis Vs1656 ighv AVPB01168194.1 25791 AWSQVQLVESGGGVQKPGGSLRLSCKASGFTFSNFYMDWARQAPGKGLEWVAVIRNPSNGLTAEYNSAVKGRFTISRVESSSTVYLQMDSLKVEDTAQYYCA
Alligator sinensis Vs165 trav AVPB01030020.1 233 LCPPGCVAVTGPRTVTGPEGGSVSVTCGYDKGYEKNGKFWCREGSSYRCSNGEHILETNGSEAKVQKGRFSLQDNHSLRTFTVTMEHLTKADAGTYHCGVART
Alligator sinensis Vs166 trav AVPB01030021.1 2090 IDLLSLTDPNTVTGPEMVTGPEGGSVSVTCHYKKGYEEYPKFWCRDDMLSCLGSHIIETTGSEAEVWQDRFSIQDNHTQRTITVTVKNLVMADTGTYLCGVAR
Alligator sinensis Vs163 trav AVPB01030016.1 16111 SVALTGPWTVTGPEGGSVSVTCGYDKGYEEYGKFWCREGSSFRCSNGEHILETNGSEAKVQKGRFSIQDNHTLRRFTVTMEHLTKADAGTYHCRVLRT
Alligator sinensis Vs162 trav AVPB01030016.1 11671 SVALTGPWTVTGPEGGSVSVTCGYDKGYEEYGKFWCREGSSFRCSNGEHILETNGSEAKVQKGRFSIQDNHTLRRFTVTMEHLTKADAGTYHCRVLRT
Alligator sinensis Vs200 iglv AVPB01040001.1 4018 SLAQYVMTQSPSVSVSPGETAKLICTGRNIDSNYVQWYQQKSGSAPVLIIYENSKRPSGIADRFSGSKSGSTATLTITGAQAQDEADYYCQAYDDDSSS
Alligator sinensis Vs201 iglv AVPB01040003.1 180 CLAQTAPTQPPSVSVSPGQTATLTCTGSSIGSYGAAWYQQKPGSAPLTVMYSNNNRPSGISDRFSGSKSGNTATLTITGVQAQDEADYYCSAYDSGSSS
Alligator sinensis Vs895 trav AVPB01000114.1 18148 LGVQLHLHQPQRFLVVEVGGTAEIHCSSSKDVDGGAKLHWYLRRAGEAPMHRKDCADDTKGPKFACKHQKYGTTLEIWDMQRKESGIYYCAHA
Alligator sinensis Vs894 trav AVPB01000113.1 5461 LGVQLHLHQPQRLLFVEVGRTAEIHCSSSKDLQGRHYVQWYLRRAGEAPKHIMACGDTKNVNKYDCKYKSHSTTLEVRSIQRKESGIYYCAYEQ
Alligator sinensis Vs897 trav AVPB01000118.1 1170 LGVQLHLHQPQRFLVVEVGGTAEIHCSSSKDVDGGAKLHWYLRRAGEAPMHRKDCADDTKGPKFACKHQKYGTTLEIWDMQRKESGIYYCAHA
Alligator sinensis Vs896 trav AVPB01000116.1 5312 LGAQFHLHQPQRFLFVDVNGVAEIHCFSREDLAGGANVLWYLRRVGEDLKCIKDCGDDKNGHKFACKHQIRNTTLEIRNIQKKESGIYYCARA
Alligator sinensis Vs893 trav AVPB01000109.1 13709 LGVQLHLHQPQRFLFVEVGGTAEIHCSLGEDVEAGVKVHWYLRRAGEVPKRMKDCGDGTNGSKFACKHQKYNTTLEIRDIQRNESGIYYCAHA
Alligator sinensis Vs292 iglv AVPB01053423.1 907 VWSQPVLTQEPSASSVSPGGTVTLSCSLSTGAITTSNYPAWFRQKPGSAPQQLVYYTSNRPSRIPTRFNGSISGQKAILTIMGVQAEDEADYYCAVWYSSGYM
Alligator sinensis Vs291 iglv AVPB01053408.1 1307 SFSQITLTQPSSESVSLGNTIKLSCTLSSGGTFGAVYWLQQKGGNSPRYLLWYNTDSSKHQGSGVPSRFSGSKDTSNKIGYLTITSVQAEDEADYYCA
Alligator sinensis Vs290 iglv AVPB01053404.1 14725 VWSQPVVTQEPAMSVSPGGTVTLSCSLSTGAITSSNYPGWLQQKPGSPPRLLIYNTNSRPSEIPARFSGSISGQKATLTITGVQADDDADYYCSVWTGSA
Alligator sinensis Vs296 trav AVPB01053545.1 1873 AVRGDSIQPEETQVSAAEGNTVTLRCSYSTEKKDPFYLYWYRQYPNRTLQYILYKGIRSASSARGTADFAEERFSSSTDDNSTVLNITGLERADTAVYHCALQ
Alligator sinensis Vs295 trav AVPB01053545.1 323 ALGTAQILQPPSAEAMEGAPLNLTCDHSSITRGDYIQWYRQFPNRGPQFIVSGFKDTVQVSDPEGALHISADGKSSALALRAAGRGDAAVYYCAVS
Alligator sinensis Vs294 iglv AVPB01053490.1 2343 SLAEYVLTQPPAVSVSPGQTAHITCSGEKLNKKYAQWYQQKPGSVPRLLIYKDKERPSDVPDQFSGASSGTTATLTITGVQAQDEADYYCLSSDDS
Alligator sinensis Vs29 ighv AVPB01005173.1 3860 SMGAITLTQPGFSSAHPGESTTLTCAVSGYNINEHHIHWLREVPGKSFIWMAAFKTGATTYIANDFNGRINPSTSGSTAKLQIARLTAADTATYYCTRQTQCSL
Alligator sinensis Vs806 trav AVPB01153372.1 1453 PVRSDSIRPEEAQVSAAEGATVTLRCFYTTTYSDGYYLYWYRQHRDRALQYILYRGTKERSRVSDTAEFARERFSSRADDNSTILNITALKRADTAVYHCALRR
Alligator sinensis Vs807 trav AVPB01153373.1 2998 TVRGDTVHPENPQVTAAEGDAVTLRCNYKTSTSADYYLYWYRQHPNQTLQYILRRGTKDYSAVSVNAPFAEERFSSQASDSDTTLHISALEWTDTAVYHCALQ
Alligator sinensis Vs804 ighv AVPB01153370.1 150 AWSQVQLVESGGDVRKPGDSLRLSCKASGFTFSSFEMNWVRQAPGKGLEWVAYISTSSSPIYYADSVKGRFTISRDDSSSLLHLQMNSLRAEDMARYYCAR
Alligator sinensis Vs805 trav AVPB01153371.1 3918 QANANSVSQSAGTVTVREGDSVFINCTYSLSVTPYLFWYVQFPSAAPRLLLTQYEAQDEEDEKRRRGFSADLQKDSSSFHLRKTSSQASDSAVYYCALR
Alligator sinensis Vs808 trdv AVPB01153373.1 12255 GSSLEDSVTQRQEDASGVQRGAVTLDCTYETGESYYYLYWYKQRPGGSLAFLLWQYSDGSKRSAAGPRFTIDFQKRQRSFNLSISDLQLNDSATYFCTFRR
Alligator sinensis Vs809 trav AVPB01153373.1 17342 AALADAIQSAAAQVSAAEGGTVTLRCSYNTSYNAAYYLYWYRQYPNRTLQYLLYRGAKTAKSASSTADFARERFSSETDDTSTELKIRVLELADSAVYHCALQ
Alligator sinensis Vs365 trgv AVPB01064396.1 1591 GDALVLKQSEPSKTREETKSASIKCHVTGTTTVIHWYRHKPGEGPERILYLSAGKAVYDKESEKKFSARQESTKGMYSLTIHDISTDDAAMYYCASWDE
Alligator sinensis Vs364 trgv AVPB01064394.1 6225 LILTQSPLSTTKSEGRTARMKCVFTDFTGAFDSAAIHWYQQSPGEAPKRVLYFTSGEAAVDDQSQKSRFTVVKDSLKLSCTFQINRAKKTDTGVYYCAYWD
Alligator sinensis Vs363 trgv AVPB01064391.1 19409 GDAQVLKQSQPSIVRGVHKTALIECHVSGISFSNAYIHWYRQKPREAPERILYLSSGRPSFDKESDKGKFEAKKNIDDNTCTLTLNQIRTEDAATYYCAYWH
Alligator sinensis Vs361 trgv AVPB01064391.1 14433 GHAQLLLQQIQTSVTKEQYKTARMDCKISGLQNFKSAVIHWYRQISGRAPEWILFISESEPSIDQHFDKNKFHCEKDPNKQISTLTVNDVTHNDTATYYCAAW
Alligator sinensis Vs360 trgv AVPB01064391.1 12976 GSAEVLKQTQLSISRAASRTARIECHVAVSDFGRAYLHWYQQRPGAAPERILYFSSQVRVDRESDKGKFNVQKNLNKSICVLTINRISSSDIATYYCATWA
Alligator sinensis Vs1288 ighv AVPB01091174.1 9511 VQSQLQLQESGPGVVKPGETLSLTCTVTGGSVTSSDWWNWLRQVPGKDLEWMGAWTGSTSYNPVFRSRITISVDSSSTRYYLQLSSVTAADTATYYCAG
Alligator sinensis Vs1289 ighv AVPB01091178.1 4419 VLSAVQLVQSGPGVVKPGETLTLTCGVSGASVTDSNNYAWNWIRQPPGKGLEWIVNIYSKSGDMYYSPALKSRTTISRDTAKNSFSLQLRSLTATDTAMYYCAR
Alligator sinensis Vs793 ighv AVPB01150481.1 738 AWSQVQLVESGGDVRKPGDSLRLSCKASGFTFSNYYMGWVRQAPGKGLEWVAYISTSSSPIYYADSVKGRFTISRDDSSSLLHLQMNSLRAEDTARYYCAR
Alligator sinensis Vs790 igkv AVPB01150145.1 29763 SSGQIVLRQTPESLAVSPGDRVTVKCKASSSLTYSGNEYLAWYQQKPGQAPKLLIYGGSTRQSGVPARFSGSGSGTDFTLTISSVEAEDAGDYYCHQSRSD
Alligator sinensis Vs791 igkv AVPB01150146.1 7526 SSGDRVMTQTPESLAVFPGDTATIKCKCSSSLTSAGKEFLAWYQQKPGQAPKLIITFASTRQPGVPARFSGSGSGTDFILTISRVEAEDAGHYYCQQKYGT
Alligator sinensis Vs491 ighv AVPB01097463.1 79 VLSAVQLVESGPGVVKPAETLTLTCTVTGYTISSGYVWSWIRQPPGKGLEWMGDLIGSSGSTGYNPSLKSRITISKDNSKNQFSLQLRSLTAADTATYYCAR
Alligator sinensis Vs490 ighv AVPB01097454.1 1274 ALSQVTLTQSGAAVKKPGESHTLQCVTSGFTLSSINMYWIRQAPGKALEWIVYFYSSSDNIYDSSIQGRFTASKDSSTFYLQMNSLKAEDTAVYYCAR
Alligator sinensis Vs1451 trav AVPB01130496.1 10460 ALGTAQILQPRSAEALEGAPLNLTCDHSSITMRDSIHWYRQFPNRGPQFIVSGVKDFVQVSDPEGALHISADRKSSRLALRAAGRGDAAVYYCAVS
Alligator sinensis Vs1450 trav AVPB01130494.1 789 SCCSAQVSQSPAALLTREGDRAAMACAYSTTYRTFQWYRQVPSGEITHLLTVAANRNATEGRFTGESREDGKKCFLHLSQARLGDSGLYFCAVD
Alligator sinensis Vs631 iglv AVPB01119654.1 849 SLAEYVLTQPPEVSVSPGQTAQLTCRGEKFDKYYVYWYQQKSGSVPKLVMYKDKERPSDVPDRFSGASSGDTATLTITGVQAQDEANYYCQVWDSDS
Alligator sinensis Vs630 iglv AVPB01119650.1 2420 SLAEHVLVQPPAVSVSPGQTAQITCSGEMLTKNYAQWYQHKPGSVPKLVMYKDTERPSDVPDRFSAASSGTTLTLTITGVQAEDEADYYCQSGEL
Alligator sinensis Vs1015 igkv AVPB01024716.1 840 AQGQIVVTQSPESVAVSVGETVTIQCRSSRSIGTEMSWYQQKPGQAPKLLINSVSRYTGIPDRFSPSGSGTDFTLTISGVAAEDAGDYYCQQDYDTP
Alligator sinensis Vs1014 igkv AVPB01024715.1 1541 SSGQIVLTQSPESLSVPVGGTVSITCKASTSVSTCLNWYQQKPGQVPNLMIYYASSLQSGVPAWFSGSGSGTDFTFTISSVEADDAADYYCQQCNQWP
Alligator sinensis Vs1013 igkv AVPB01024704.1 3628 SSGDIVVTQTPESLAVSPGDTVTIKCKTSSSVSSWMALYQQKPGQAPKLLLYRASNRPSGIPDRFSGSGSGTDFTFTISRVEAGDAGDYYCQQHDDTP
Alligator sinensis Vs1625 trav AVPB01165425.1 4210 AASQEQLWLQQSPGEIWTTPGQAAELNCTVSYRRSSVYWYKESQDGSLQWVAETGKHGSAEGRYLSQVSSSGKMFSLVINKLQEEDSGVYYCTLDVS
Alligator sinensis Vs400 ighv AVPB01074691.1 2452 VLSAVQLVESGPGVVKPAETLTLTCTVTGSSITTSGYDWSWIRQAPGKGLEWMGYINYRGSTGYNPSLKSRITISRDTSKNQFSIRLRSLTATDTAMYYCVS
Alligator sinensis Vs334 ighv AVPB01060662.1 820 AWSQVQLLESGGAVRKPGGFLRLSCKTSGFPFSDEHMDWVRQAPGKGLEWVAGVNSVGSTEWYSAAVEGRFTVSRDNSQNTAYLQMSSLEPEDTALYYCSR
Alligator sinensis Vs335 ighv AVPB01060663.1 4642 ILAQVTLKESGPGVVKPGETLSLTCTVSGFSLTSYHMQWVRQAAGKGLECVGGIWSAGGTNYNSALQSRLNISRDTSRSQVHLRLTGVQPGDTAWYYCARD
Alligator sinensis Vs333 trav AVPB01060651.1 1024 AVRGDTVHPEKPQVTAAEGDVVTLRCNYKTSSSLGYYLYWYRQHTNQTLQYILRRGTKDYSAASDNAPFAEDRFSSQVSDSATALNISVLELADTAVYHCALQ
Alligator sinensis Vs1239 ighv AVPB01080410.1 3999 ILAQATLKESGPGVVKPGETLSLTCTVSGFSLTSYGVGWVRQAAGKGLEWVGGIWADGNTYYNSTLQSRLTISNDMSSSQVHLRLTGVQPGDTAQYYCSR
Alligator sinensis Vs1238 ighv AVPB01080410.1 7026 VSSQIQLTQSRAEVKKPGESVKLSCKASGYTFTDYSMNWVRQCPGKALEWVGYITTDQGSTGYAEAFKGRFTITTDTSISTAYLQLNSLKTDDTAVYYCAR
Alligator sinensis Vs67 iglv AVPB01009785.1 11538 YLAQYMPTQPPIVSVSPGQTAQITCTGNNVGGHNVHWYQQKPGSVPLLIIYDNSKRPSGIADRFFGSKSGNTVTLTISGVQAQDEAYYYCQCYAGDSRT
Alligator sinensis Vs66 iglv AVPB01009785.1 9083 AGAQFVLTQPPSVSASPGGTVTITCARSSGSISDSWNSWYQQKPGRAPVMVIYGDTERPSGIPSRFSGSIDKSANTVTLTISGAQPDDEADYYCSAG
Alligator sinensis Vs65 iglv AVPB01009785.1 1044 CLAQTVLTQPPLVSIFPGQTATLTCTGNSISSHGPDWYQQKPGSVPLLVVDRSNNRASGISDRFSGSKSGNTATLTITGVQAQDEADYYCGAYTGSYS
Alligator sinensis Vs64 iglv AVPB01009782.1 176 SLAESMTTQPPSVSVSPGQTATLTCTANTISGFGASWYQQKPGSAPLIIMGNDNKRPSGISDRFSGSKSENTATLTITGVQAQDEADYYCFALVG
Alligator sinensis Vs848 ighv AVPB01164395.1 2129 ATSAVTLVESGPGVVKPGQTLTLTCAVSGVSMSQASYGWHWIRQPPGKVLEWVAATYPYDGTTYYNPSLQSRTTISADTSKSQFSLQLRSLTAADTATYYCV
Alligator sinensis Vs849 ighv AVPB01164395.1 12664 GVSEVRLDQWGTQLLKSTQSATLKCAVFGGTFSDHAWNWVRQAPGKGMEWLGHLWGDGNLHYNPTFRNRISITRDKSKNQVHLQLNNMEAADTAIYYCARRPG
Alligator sinensis Vs847 ighv AVPB01164261.1 3836 ILAQVTLKESGPGVMKPGETLSLTCTVSGFSLTSYGVNWVRQAAGKGLQWVGVIWASGSSYYNSALQSRLTITRDTSSSQGHLHLTGVQPVDTARYYCAG
Alligator sinensis Vs539 igkv AVPB01106378.1 6516 ASRDFVLTQMPQSLGASPGDRFTIWCKASSSLTDSGNEYFSWYQQRPGRAPKLLICVPSASPPLQSRLPAWFSVEGSGADFSLTSSSVEAQDAGDYYCLQ
Alligator sinensis Vs1024 iglv AVPB01027895.1 10028 SLAQYVLTQPPSVSVSPGQTAPLTCSGTNIGSYNVQWYQQKPGSAPRLIIYNDDSRPSGIPDRFSGANSGNMATLTITGVQAQDEAEYYCQVWDSSSDL
Alligator sinensis Vs1025 iglv AVPB01027895.1 4143 LFAQNVVTQPPAVSVSPGQTARLTCSGTGSYVHWYQQKPGSAPLLIIYGNTNRPSGISDRFSGSKSGNTATLTITGVQAQDEADYYCSMWVSSSSQ
Alligator sinensis Vs909 ighv AVPB01001390.1 14471 VCSQVQLLQDTAAQEKPSGTLRLTCAVSGFSLTASGSVVSWIWQPPGKGLEWLCLIFWDDDKCYQDSMKSRLTISRDTSKSEVYLEVRGLEARDSGTYYCAK
Alligator sinensis Vs907 ighv AVPB01001390.1 23717 VLAQVTLKESGPGVVKPRETLSLTCTVSGFSLTSNHMYWVRQAAGKGLELVGGIWASGSSYYNSALQSRLTISRDTSSSQVHLRLTGVQPGDTARYYCAGE
Alligator sinensis Vs906 ighv AVPB01001388.1 1593 GVSSQVQLTQSGAEVKKPAESVKLTCRTSGYTFTSYYMSWVRQAPGKGLEYIGYINPSNGGTSYPEAFKGRFTITRDTSISTAYLQLNSLKRDDTATYYCTR
Alligator sinensis Vs905 ighv AVPB01001385.1 6414 ARSQVVLTQSGPEAKRTGESTTLRCAVSGFDANGWWMAWIRQRPGKGLEWLVSYRSSSQSNHYSPVIQGRIRVSKDSSNFYLELKSLKPEDMAMYYCARD
Alligator sinensis Vs904 ighv AVPB01001384.1 7952 VLSAVQLVESGPGVVKPAETLTLTCTVTGYSISSSVYWSWIQQPPAKGLEWMGYIVGSSGGTSYNPSFQSRITISKDNSKNQFSLQLRSPTAADTATYYCAE
Alligator sinensis Vs1481 trdv AVPB01132568.1 2545 AVRWALAQVFQPPQVTALEGGRLHIPCNQNITPHNTMYWYRQPQQGQGALISLGSGYSGASPAGELTLTVDQASRSTNLSSDGARLQDAGIYYCAVR
Alligator sinensis Vs1483 trav AVPB01132570.1 591 SGGQESVTQVRLEVTVSEGENASLACNYTTTYAPSLLWDRRGPSHQLDYLLQVDSWGVRYGQDGSLSHLGAQLDTEQRTALLQVHAAQLSDSAVYFCAL
Alligator sinensis Vs994 ighv AVPB01019113.1 4903 GLAQVTLKESGPGVVKPGETLSLTCTVSGVSLTSRDVSWVRQAAGKGLEWVGGIWASGSTSYIQSRLTITRDTSSSQVHLRLTGVQPVDTARYYCAG
Alligator sinensis Vs995 ighv AVPB01019115.1 2893 ILAQVTLKESGPGVVTPGETLSLTCTVSGFSLTSSGVSWARQAAGKGLEWVGGIWTSGSSYYNSALQSRLTINRDTSSSQVHLRLTGVQPADTARYYCAG
Alligator sinensis Vs996 ighv AVPB01019116.1 9392 VQSQGSLIQPPSEVKRPGETLKLSCKYSGSDFTKYWMQWVRQPHSLGLSWIGEANKDTTSTNVRRAFQERVKITRDNANSLIHLEVRNLQPEDSAVYYCA
Alligator sinensis Vs997 ighv AVPB01019116.1 5562 VTLLQSGTDVVRPGETLTLQCTVSGVSLTDNSYVWFWARLGPGKGLNEIEWIGAYSPAVGKALPDPLFENRTKISADASQNQLSLQMHSLTAADTATYYCARA
Alligator sinensis Vs998 ighv AVPB01019116.1 3054 VLAEVQLVQSGPGVVKPGETLTLTCAGSGVAITTRYNYWHWIRQPPGKGLEWMGRIYPYNTGENKYNPSLQSRTTISADNSKNQFSLQLHSLAAADTAMYYCAR
Alligator sinensis Vs628 iglv AVPB01119648.1 7452 SLAEHVLVQPPAVSVSPGQTAQITCSGEMLTKNYAQWYQHKPGSVPKLVMYKDTERPSDVPDRFSAASSGTTLTLTITGVQAEDEADYYCQSGESGS
Alligator sinensis Vs629 iglv AVPB01119649.1 8464 ARSQSVLTQPPTESVSSGNTVKLSCAVTSGTSISGYSVYWYQQKPGTPPRYLLYYKSDSDKHQSSGVPARFSGSKDTSSNTGYLTIARVLAEDEADYYCAV
Alligator sinensis Vs198 iglv AVPB01039992.1 72 CLAQTAPTQPPSVSVSPGQTATLTCTGSSIGSNGAAWYQQKPGSAPLTVMYYNNNRPSGISDRFSGSKSGNTATLTITGVQAQDEADYYCSTYDTGSSS
Alligator sinensis Vs199 iglv AVPB01040000.1 274 CLAQTAPTQPPSVSVSPGQTATLTCTGSSIGSYGASWYQQKPGSAPLTVMYSTNNRPSGISDRFSGSKSGNTATLTITGVQAQDEADYYCSAYDSGISS
Alligator sinensis Vs1660 ighv AVPB01168203.1 3237 VLSAVQLVESGPGVVKPAETLTLTCTVTGSSISSGVYWGWIRQPPGKGLEWMANIYGSSGSTYYNPSLKSRITISKDSSKSQFSLQLRSLTAADTATYYCAR
Alligator sinensis Vs1466 trav AVPB01132552.1 8157 ASEQLSQSPGALQGQEGQDVELRCDYSTAQDSFTLDWYQQQPGGRPAFLVGCYSFGSRRTVPSTPPRFSTKLDAGGRVSMLSIAGAQPADSALYLCALRG
Alligator sinensis Vs1467 ighv AVPB01132552.1 5126 AHTQMQLVASGPGTEEVAKPITLTCTASGVSVTSDYTWFWYRQAHGKRLEVVAWGYYSSSKWYPGTAPSFQGWATTSVQTSKNQFFLQLKSLTVADTSTYYCCVG
Alligator sinensis Vs1464 ighv AVPB01132548.1 13339 IQPQVTFAASGGDVKKPGDALQLSCKGSGFRGQSFGDYWMSWYRHTPSNGLEWVATISYWAGDTKKYADSVKGRFTISRHNALNMLYLQMKNLQPGDSGYYYCFE
Alligator sinensis Vs1465 ighv AVPB01132548.1 7475 VQSKVEFLESGEDLKKPGDSLRLSCKTSGFTFSNHWMSWYRRAPSKGLEWVSSIEKLPGSTKNYANSVQGRFTISRDDSKNMLYLEMKNLRPEDTAVYYCRA
Alligator sinensis Vs1463 ighv AVPB01132547.1 2335 VQSKVEYVASGGTVKMLGDSLGISCTASGIDFDNSWLGWVRHVPGRGLQQVAYISKLAGDTVYYSDAVKGRFTISRDNSRKLLHLQMSNLRPEDAAEYYCSWV
Alligator sinensis Vs756 trav AVPB01145746.1 8302 LGVQLHLHQPQRFLVVEVGGTAEIHCSSSKDVDGGAKLHWYLRRAGEAPMHRKDCADDTKGPKFACKHQKYGTTLEIWDMQRKESGIYYCAHA
Alligator sinensis Vs754 trav AVPB01145741.1 1941 LGVQLHLHQPQRFLVVEAGRTAEIHCSSSEDLQGRHYVQWYLRRAGEAPKHIMACGDTKNVNKYDCKYKSHSTTLEIRSIQRKESGIYYCAYEQ
Alligator sinensis Vs755 trav AVPB01145744.1 3546 LGVQLHLHQPQRFLFVEVGGTAEIPCSSREDLDGGGTVHWYLRRVGEAPTRMKDCINDKNVSKFACKHQRYSTTLEIRDIQRNESGIYYCARA
Alligator sinensis Vs1468 trav AVPB01132553.1 8541 AALGDLIQIVESQVSGEEGGAVTLRCSYESNAEYVDLLWYRQFLSGQLQYILLRGVKKRRGIQNTAGFAQERFLCPASDTSTELTISALQLADSAVYYCALS
Alligator sinensis Vs1469 trav AVPB01132554.1 5902 AVLGDSIWAMEAQVSGEEGGTVTLRCSYESNVDYISLMWYRQFLSRGLQYILARGAKVIRDAQDFTEFSRGRFSSQTSDNSTELTLPALQLADSEVYYCA
Alligator sinensis Vs279 iglv AVPB01053388.1 1126 VWSQPVVTQEPALSVSPGGTVTLSCSLSTGAITSRNYPAWFQQKPGSPPRQLIYLTSSRPSGIPTRFSGDISGQNNTLTIMAVQAEDEANYFCGVRAGSSDA
Alligator sinensis Vs278 iglv AVPB01053387.1 50151 QSSQSALTQAHPTLSVALGQTATLQCTLQGVEFISSSNPAWYQQRPESSPRLLIYKSRSRASGVPERFSADTTGNTALLTITGVQAEDEADYYCAV
Alligator sinensis Vs1042 ighv AVPB01031695.1 3174 ARSQVVLTQSGPEVKRTGESTTLRCAVSGFDVNSWWMAWIRQSPGKGLEWLVSYSSSSHSNHYSPVIQGRARVSKDSSNFYLELRSLKPEDMAMYYCARD
Alligator sinensis Vs273 iglv AVPB01053383.1 12631 VWSQPVVTQEPAVSVSPGGTVTLSCSLSTGAITSSNYPGWLQQKPGSAPRLLIYEISKKPSGIPTRFSGSISGQKAALTIAGVQAEDEADYYCAVHAGSSAW
Alligator sinensis Vs272 iglv AVPB01053382.1 9792 PSFQQLLSVQSSASVSLGGTVTLSCSQSSGAITTVSHAHWIQQRLGHAPRRLIYGASDRGPGVPERFTASISASTMSLTIAGAQAEDEGAYYCAVWNAGA
Alligator sinensis Vs275 iglv AVPB01053387.1 7644 SSSQQLQSLKPSEQVSPGGTVTIACSLSSGAVGDGNYPQWVQQKPGHVPRLLIYSTSTQPSGVPARFSGSRSGSTMSLTITGAQPEDDADYYCLVWTGSA
Alligator sinensis Vs274 iglv AVPB01053384.1 1772 VWSQPVVTQEPAVSVSLREIVTLSCSLSTGAITSTNYPHWFQQKPGSAPRQLIYNTDSRPSGIPTRFSGSISGQKAVLTIKGVQAEDEADYHCMVHTGS
Alligator sinensis Vs277 iglv AVPB01053387.1 38100 VWSQPVVTQEPVMSVSPGGTVTLSCSLSTGAITTSNYPAWLQQKPGSPPRQLIYSTSSRPSGIPTRFSGSISGQKAVLTITGVEAEDEADYYCAVYTGSN
Alligator sinensis Vs276 iglv AVPB01053387.1 12117 VWPRPVVTQEPAVSSVSPGGTVTLSCSLSTGAITSSNYPGWLQQKPGSAPRQLIYEISKKPSGVPTRFSGSISGQKATLTITGAQPEDDADYYCMLWIGST
Alligator sinensis Vs882 ighv AVPB01173365.1 1003 VQSQGSLIQPPSEVKRPGETLKLSCKYSGSDFTKYWMQWVRQPHSLGLSWIGEANKDTTSTNVRRAFQERVKITRDNANSLIHLEVRNLQPEDSAVYYCA
Alligator sinensis Vs284 iglv AVPB01053399.1 9546 AGAQFVLTQPPSVSASPGGTVTITCARSSGSISDSWNSWYQQKPGRAPVMVIYEDTERPSGIPSRFSGSIDKSANTATLTISGAQPDDEADYYCLTSDSSSN
Alligator sinensis Vs285 iglv AVPB01053400.1 1825 VWSQPVVTQEPAVSSVSPGGTVTLSCSLSPGAISTGYYPAWYQQKPGSPPQMIMYYASSRPSGIPTRFSGSISGQKAALTITGIEVEDDADYYCSVWTGSV
Alligator sinensis Vs286 iglv AVPB01053400.1 4879 VRSQSVVTQEPSLSVSPGGTVTLSCSLSTGAITSSNYPGWYQQKPGSPPRVLIYSTNSRPSGIPTRFSGSISGQKAVLTITGVQAEDESDYYCSVYIGSDV
Alligator sinensis Vs287 iglv AVPB01053400.1 11573 VWSQPVVTQEPAVSVSPEGTVTLSCSLSTGAITSSNYPGWLQQKPGSPPRQLIYRTNNRPSGIPTRFSGSISGQKAALTITGVQAEDEADYYCIVHTG
Alligator sinensis Vs281 iglv AVPB01053390.1 4080 SSSQQLQSLKPSEQVSPGGTVTITCSLSSGAVGDGNYPQWVQQKPGQAPQLLMYSTSTRPSGVPARFSGSRSGSTMSLTITGAQPEDDADYYCSVWTGSA
Alligator sinensis Vs282 iglv AVPB01053392.1 2128 SSSQQLQPLTPSEQVSPGGTVTIACSLSSGAVADNSYIHWLQQKPGQAPRLLIYSTSTRPSGVPARFSGSRSGNAMSLTITGAQPEDDADYYCVAWIGS
Alligator sinensis Vs283 iglv AVPB01053399.1 3321 VWSQPVVTQEPALSVAPGGTVTLSCSLSTGAITTNNYPGWYQKKPGSPPRQLIYSTNSRPSGIPTRFSGSIPGQNAALTITEAQAEDEADYYCMLWYSSEW
Alligator sinensis Vs288 iglv AVPB01053403.1 1171 VRSQSVVTQEPSLSVSPGGTVTLSCSLSTGAITTSNYPGWYQQKPGSPPRQLIYSTNSRPSGIPTRFSGSISGQKAVLTITGVQAEDESDYYCLVYIGSGIL
Alligator sinensis Vs289 iglv AVPB01053404.1 9934 VWSQPVVTQEPAVSVSPGGTVTVSCSLSTGAMTSNNYRGWYQKKPGSAPQLLMSNNNTRPSGIPTRFSGSISGQKAVLTITGAQLEDDADYYCKVWTGSA
Alligator sinensis Vs578 trbv AVPB01111900.1 26869 AGAGDLISQWPKSTAQSPGETVAMSCYQNHTTHIYMFWYLQPRGHGLMLIASAHTNREASYEKGYNKTKFPISRDETKLSVMTVTNITAGDAATYFCA
Alligator sinensis Vs579 trav AVPB01111900.1 29222 LCTGVTVTQNKFAAIRNGANVSLPCEHDGDANYDTIFWYRQDGAAGKELGLVARHIDGSEPEIEAKFKGKYHLQPKTRTKASLCIISGTAEVSAVYFCATSK
Alligator sinensis Vs576 trbv AVPB01111900.1 15995 VSSAYVEQPPFVVEVPGRSPSVQCKLIQTSCSFLYWYRQRAGGQLEALFYSLGGAPQNNMAEPMNAERSGNIWTLNWKQLSQSDSAMYYCACSE
Alligator sinensis Vs577 trbv AVPB01111900.1 23373 SGSDYVEQPPFLTGISGKPRTVQCTLKQSAYDWMYWYRQRGSKELEALFYSAGNGNENPFTAELMTAKRSRNIWTLTWSNISLADTAMYYCACSS
Alligator sinensis Vs574 trbv AVPB01111900.1 5744 VGSAPVEKTAFLMGVPRSNLTLQCTLKQADCKWMYWYRQQGSKALEALFYSYENSLVNFTAEPMQAERKMGHFTPKWINLSPSDSAVYYCACSS
Alligator sinensis Vs575 trbv AVPB01111900.1 10702 VGSDYVEQPPFLMGVSGASPILHCELKEAIYLYMYWYRQPAGRELQVLIYSAGDGSGYNFTAEPMTANRHGNNWTLTWKRLSHLDSAVYYCACSD
Alligator sinensis Vs1569 iglv AVPB01153574.1 1028 CLAQTAPTQLPSVSVSPGQTATLTCTGSSIGSYGAGWYQQKPGSAPLPIMKYDNTRPSGISDRFSGSKSGNTATLTITGVQAEDEADYYCSAYAGSGF
Alligator sinensis Vs1364 trbv AVPB01111935.1 1565 QTYAEITQTPSVVLERKRTAYLRCKQNNGHENMFWYRQNPRQGQGLQFLFFFQYREERERAANFSHFKANRAQDDVLYLNISSVEPDDSAVYFCATSP
Alligator sinensis Vs1363 trbv AVPB01111933.1 2526 HSDGRIIQKQSLALENGARAQLDCEQTDGHPRMFWYRQVQKQELVLLVYSLAQSDVQNSISTKEVTASRPETSLFHLTIPSVNVQDSAVYFCATSL
Alligator sinensis Vs1362 trbv AVPB01111932.1 27454 ITDAKITQIASLILRRGEAQLTCKQNDDHNNMYWYQQKQGQGLKLISYSIGTGNKNVEQGDNSDSFHPSRPNTENFNMNISAVQVDHSATYFCASSL
Alligator sinensis Vs379 trav AVPB01068065.1 5068 LGVQLHLHQPQRFLFVEVGGTAEIHCYSSIDVDGAAKLHWYLRRVGEAPILIKKCKEQNESRFACKYQKSNTALEIKSIRRKDSGIYYCAHA
Alligator sinensis Vs957 ighv AVPB01012830.1 2273 ARAQIRLVASGGGFRNAGGSASLSCKASGFTFEDYWMHWYRQAAGKGPERVSTISYGAGDTKRYAESVRGRFVIWKDNAQSLLHLEMNSLKPEDTAVYYCGS
Alligator sinensis Vs958 trdv AVPB01012832.1 359 ARSAELLRQDAQNKTVREGEEVTFSCSLEGEEMSKYWMYWYRKGEQGTLTWIYREGDHYGDGFQGRFEGKVKSSENRFTLRLLQAARADRAVYYCAAR
Alligator sinensis Vs959 trdv AVPB01012833.1 1183 VRSAVLLRQHPPDLAVWEGEEVTFQCSMDGGSMGSYYMYWYRKGEQGTLTWIYREGDRYGDGFPGRFEGETDSSENRFTLRLLQATRADRAVYYCAAR
Alligator sinensis Vs1290 ighv AVPB01091218.1 1603 VLSQITLKESGPGVVKPGETLSLTCTVSGFSLTSYGVSWVRQAAGEGLQWVGAIWGGGGTNYNSALQSRLTITRDTSSSQVHLRLTGLQPADTARYYCAR
Alligator sinensis Vs1099 igkv AVPB01043985.1 1731 SSGDILVTQTPESLAVSPGDTVTIKCKTSSSVSKWMNFYQKKPGQAPKNLLYKTSNRPSGIPDRFSGSGSGTDYTFTISRVEAGDAGDYYCQQYQSFP
Alligator sinensis Vs1098 ighv AVPB01043963.1 17994 QLLASGPSTVKVSEPLTLTCAVSGKLITTTGFRGYWYQQFQGKGLKWMSLIDGAGTTQYAPSLQSRTKVSRDTSKNQFSLHLESPTTADTAVYYCALG
Alligator sinensis Vs1651 ighv AVPB01168191.1 8313 VCSQVQLLQPGAAQAKPSGTLRLTCTVSGFSLTTSGYGAGWIRQPPGKALEWLCTVYWNDDKYYQDSLKSRLTISRDTSKSEVYLELRGLEAGDSSTYYCAG
Alligator sinensis Vs489 ighv AVPB01097453.1 3372 ATSAVKLVEFGAGLVKPGETLALTCAIYDVSISDGSYIWTWIRQPPGKGLEWVANIYSYDGRTWFNPSLQSQTTISADKSKNQVSLQLRSLTAADTATYFCA
Alligator sinensis Vs717 trav AVPB01142615.1 2488 SLGTAQILQPGSAEALQGTPLNLTCEHSSINLGDYIYWYRLFPNRGPQFIVFGSKDTVQVSSPEGALHISKDRKSSALALLAPGRGDAAVYYCAVG
Alligator sinensis Vs1655 ighv AVPB01168193.1 1635 AVSQVQLLESGPGAVKPGETLTLTCTVSGQSITTSNTWWHWIWQPPRKRMEWMGEISYSGTTKYNPSLQSRLTISRDTAKNQFSLQLPSLTAADTATYYCART
Alligator sinensis Vs718 trav AVPB01142616.1 893 AVRGDSIRPEEEQMSAAEGATVTLRCFYTTTYSTGYYLYWYRQHRDRALQYILYRGTKELSTYSDTAGFATVRFSSQADANYTVLTITALERADTAVYHCALR
Alligator sinensis Vs719 trdv AVPB01142617.1 4663 AVRGDSIEPEGTQVSAAEGDNVTLRCNYKTSNNYAYYLYWYRHYPDRALQFILYRGIRTASSTSNAADFAQKRFSSQTDDNSTALEIIALELADTAVYYCALRD
Alligator sinensis Vs69 iglv AVPB01009785.1 25007 SLAQDVLRQPPSVSVSPGQTAKLTCTGEDFDSNAVSWYQQKPGSAPLLLIYADDSRADEIPERFSGAKSGNTATLTITGVQAQDEADYYCAAYDATSD
Alligator sinensis Vs1654 trmv AVPB01168193.1 13433 TWSQVQLVESGGDVRKPGDSLRLSCKASGFTFGDYWMSWVRQAPGKGLEWVAKISYWAGSTINYVNSVKGRFTISRDNPKNLLHLQMNSLKPEDTALYYCT
Alligator sinensis Vs68 iglv AVPB01009785.1 19587 SLAQDVLRQPPSVSVSPGQTAKLTCTGENFDSKIMSWYQQKPGSAPLLLIYIDDSRADEIPERFSGAKSGNMATLTITGVQAQDEADYYCAAYDMDS
Alligator sinensis Vs1423 ighv AVPB01126485.1 8255 ILSQVTLKESGPGQVKPGETLSMTCTVSGVSITDSNYAWSWIRQPPGKGLEWMGYVYPADGSTSYNPSLQSRVTMSGDSSKNQFSLQLRSLTASDTATYFCTR
Alligator sinensis Vs1420 trav AVPB01126100.1 27363 SVIDTCEVTVAQPSLREVDYTVSTVNITCSFSASGCSGSAQVLWFRFLAHKHEALCTPLCTNTGKFKVTEPSKNNVSLQISHLTVNDSAVYFCGVAF
Alligator sinensis Vs872 trav AVPB01165425.1 10110 LGVQLHLHQPQRFLFVEVGGTAEIPCSSKENLEGGANVHWYLRRAGETPTHIKKCRDKNVSRLACKHTVYSATLEIREIQRKESGIYYCALA
Alligator sinensis Vs642 ighv AVPB01122056.1 4049 AWSQGQLVESGGDVRKPGDSLRLSCKASGFTFNSYYMAWVRQAPGKGLDWVGGIKSDGSSQWYSPAVKGRFTISRDNSQNMLYLQMSSLKPEDTALYYCAK
Alligator sinensis Vs728 trav AVPB01142618.1 28951 AVRGDSVHPEKPQVTAAEGDAVTLRCNYKTSSSFSYYLYWYRQHLNQTLQYILQRGTKDYSAASDNAPFAEDRFSSQVSDSATALNITALELADTAVYHCALQ
Alligator sinensis Vs919 ighv AVPB01004138.1 620 VLSQITLKESGPGVVKPRETLSLTCTVSGFSLTSYGVGWVRQAGGEGLQWVGVFWSGGSTDYNSVLQSRLTITRDTSSSQVYLRLTGVQPADMAQYYCA
Alligator sinensis Vs1492 ighv AVPB01134107.1 617 GVSSQVQLTQSGAEVKKPGESVKMTCRTSGYAFTSYSMHWLRQAPGKGLEYIGWISTNNGNTGYAEAFKGRFTITRDTSISTAYLQLNSLKTEDTAVYYCAR
Alligator sinensis Vs969 trav AVPB01012839.1 4307 LAQSDSVFQSRPEVAVSEGHTVSIPCNFTTVSSNPYLFWYRQFPNQLPQHVLTVYKSAEVKNRFSEGKFSSVLFPENKTVPLTIEEVSVQESAVYYCALS
Alligator sinensis Vs968 trav AVPB01012839.1 7741 QTNAQFLTQTEGTVSVLEGEAVFLNCTFETSQYPFLFWYVQFPGEAPRLLLTDNARREEEVEERKHQRGFSAKLERNPESFHLEKPSSDRNDSAVYYCALS
Alligator sinensis Vs965 trav AVPB01012836.1 7262 ASRGDSVQSHEPHVSAAEGHAVTLRCSYTTSYVPSVYLYWYRQYPDRPLQFILYKGSKEAGSVSNTADFVQGRFSSQVINKSTLLTIMALERADTAVYYCAIQR
Alligator sinensis Vs964 trav AVPB01012836.1 11686 AAVTAEILQPGSAEALEGAPLNLTCSHGSVSTQYIFWYRQFPNGGLQFLVSGYSGFVPVSAPEGALHISADRRASALALRRAGRGDAAVYYCALS
Alligator sinensis Vs967 ighv AVPB01012836.1 686 AQSQVRLVASGGGFRNAGDSATLSCKASGFTFGNYWMHWYRQAAGIGPQWISTIGYLTEDIKNYAESVTGRFTISRDNAQSLLHLQMHSLKTEDTAVYYCGR
Alligator sinensis Vs966 trav AVPB01012836.1 2046 VSLGDSIQPNDSEVSVEEDKNVTLSCSYHTSHTGSVYLHWYRRYPNRPLHYILSRGAKTARSFSDIAEFAKERFSSQTNVSSTMLKITAVERADSAVYYCALYV
Alligator sinensis Vs961 ighv AVPB01012835.1 19143 VSEPLVLTCAVYKKRINSYRYCWYWYKQLPGKGQEEVAWIYPYDGSKKYTSPFQNRVTISADTSRNQVCLQLVSPAVADSATYYCAGSYDAHSS
Alligator sinensis Vs960 ighv AVPB01012834.1 3843 QLLVSGPSTVKVSEPLTLTCAVSGKLITTTGFRGHWYRQLQGKGPEWMGVIDGTGGTQYAPSLQNRTKISGDTSKNHFSLSLLSVTTADTAKYYCALG
Alligator sinensis Vs963 trav AVPB01012836.1 13030 AAGSAQILQPPSAEAPEGAPLNLTCAHSSIKTNENVFWYRQFPGRGLQFIVSGYTGTVPSSAPEGALHIFADRRASALALRRAGRGDAAVYYCALS
Alligator sinensis Vs962 trav AVPB01012836.1 15333 SCCGAQVSQSPRALETSEGARAAMACTYSSAFQTFQWYRQVPSGEITHLLTVAANENGTNGRFTGERLESGQKSFLHVAETRLEDSGRYFCAVG
Alligator sinensis Vs1474 trav AVPB01132565.1 8116 RAQQDSVTQSPSALVIHAGDTATLSCSFSTSDTYPYLYWYRQHPNRSLEMLMQLYKAEWRKQAGRLSAELHFGNSSGRLAIQGTTLQDSAGYLCALS
Alligator sinensis Vs682 trdv AVPB01132549.1 7423 KDLLCDHVTQSPSVLLATAGSQAKLFCSYATSYGNPDLYWYRQLSDNSLQYILYRDNSRSHNANFAKERFTVERQTSEKTFHLVVSAVRVEDSALYLCALS
Alligator sinensis Vs1476 trav AVPB01132566.1 4842 HAQQDSVTQSPSALVIHAGDTATLSCSFSTSDTYPYLYWYRQHPNRSLQQLMQLYKAEWRKQAGRVSAELHVGNSSGRLAIQGTTLQDSAGYLCALS
Alligator sinensis Vs1470 trav AVPB01132554.1 1876 AALGDSIQPTGSQVTGAEGGTVTLHCSYESSADYVFLFWYQQFLSGQLQFILYRGEKRGRGTQHTAAFAQERFSSQVNDSSTELTLSALQLADSALYYCALE
Alligator sinensis Vs1473 trav AVPB01132555.1 3796 ASLGDSIWVMESQVSGAEGGTVTLRCSYESSTDSVYLHWYRQLLPGGLQYILYRGAKERSDLENTAKFAQERFSSQATDTSTELTLSALQLADSALYYCALE
Alligator sinensis Vs1472 trav AVPB01132555.1 7656 AALGDSIQTVESQVSGAEGGTVTLRCSYESSADAVFLLWYRQFLSRQMEYILARGAKGGTGAQDNAEFALIRFSSQASDSSTELTLSALQLADSAMYYCAL
Alligator sinensis Vs1478 trdv AVPB01132568.1 42006 AARWALAQVFQPPRLTTVEGGQLLIQCNQNVTSADQMSWYHQSLQGRGGLIFLGSKFDGTSSMGEFTLTVDKTSRFTSLTRNSTRLRDAGIYYCAV
Alligator sinensis Vs141 igkv AVPB01026858.1 8039 SSGQIVLTQTPESLAVSPGDQVTIKCKASSSLTYSSSWGSYQQLAWYQQKPGQAPKLLIYGGSTRQSGVPAWFSGSGSGTDFTLTISGVAAEDAGDYYCQQ
Alligator sinensis Vs269 trav AVPB01053374.1 24070 WPTQITSESSSSHSAPEGSTVTLKCDFTANMTGNFTQLFWIHELSGQAQFRLIAWHGLPQRDGTYCGTGSRFHSQLDLDKHRSYLTITDLEVNDSGRYHCEGL
Alligator sinensis Vs145 ighv AVPB01027022.1 1353 VLSQVQLQQSGPGVVKPGETLTLTCTITGGSVSSTSDTWNWIRQPPGQSLEWAGRSYYRSSWSTDYASSLKGRITITQDTSKNQFSLRLSSLTAADTATYYCAR
Alligator sinensis Vs543 igkv AVPB01106383.1 1490 SSGDRVMTQAPESLAMSPRDRVTIKCKCSSSLTYSGREELAWYQQKPGQAPRLLITFASTQQPGVPTWFSGSGSGMDFTLTISSVEAEDAGDYYCPQHYDTS
Alligator sinensis Vs542 igkv AVPB01106380.1 5686 SSGDRVMTQTPESLAPSLGDTVTIKCKCSSSLTSAGKEFLGWYQQKPGQAPKLIITFASTRQPGVPARFSGSGSGTDFTLTISSVQAEDAGDYYCQQNYG
Alligator sinensis Vs541 igkv AVPB01106379.1 10085 ASRDFVLTQMPQSLGASPGDRFTIWCKASSSLTDSGNEYFSWYQQRPGRAPKLLICVPSASPPLQSRVPARFSVRGSGADFSLTSSSVEAQDAGDYYCLQ
Alligator sinensis Vs540 igkv AVPB01106379.1 1617 SSGAIVMTQTPQSLALSPRDTATIKCKSSSSLTYSGREELAWYQQKPGQAPKLLIYNAVTRQSGVPARFSGSGSGTDFTLTISHIEAEDAGDYYCQLYY
Alligator sinensis Vs1606 iglv AVPB01163617.1 4527 CLAQTAPTQPPSVSVSPGQTATLTCTGSSIGIVGASWYQQKPGSAPLLVMDSNNKRPSGISDRFSGSKSGNTATLTITGVQVQDEADYYCLTADISSAS
Alligator sinensis Vs1607 iglv AVPB01163624.1 3509 CLAQYVMTQPPSVSIPSGETAKLTCTGRNVASHGVQWFQQKPGSAPVQIIYENSKRPSGIADRFSGSKSESTATLTITDIQAQDEADYYCQAWDSDSNA
Alligator sinensis Vs1605 iglv AVPB01163616.1 454 CLAQTAPTQPPSVSVSPGQTATLTCTGSSIGSYGATWYQQKPGSAPLTVMYNNNNRPSGISDRFSGSKSGNTATLTITGVQAQDEADYYCIAYDSGSNS
Alligator sinensis Vs1609 iglv AVPB01163627.1 3691 SFAQYVMTQPPSVSVSPGETAKLTCTGRNVGRYSLQWFQQKPGSAPLQIIYSNSNRPSSIPDQFSASISGNTATLSITGVQAQDEADYYCQAWDSDSSA
Alligator sinensis Vs211 ighv AVPB01041083.1 8871 VLSQVTLKESGPEVVKPGETLSLTCTVSEFSLTSYDMHWVCQAAGKGLEWVGAMWRGRGGGPDYNSDLQSLLSISRDPSSNQVHLSMTGLQPADIAWYYCIRD
Alligator sinensis Vs318 ighv AVPB01057891.1 9879 VFSAVQLVESGPGVVKPAETLTLSCAVSGVSISDSSYAWNWIRQPPGKGLEWIARIYPHDGRTWFNPSLQSRTSISADKPKNQFSLQLRSLTTTDTAMYYCASD
Alligator sinensis Vs319 ighv AVPB01057895.1 3095 AMSQVQLVESGPLVAKPGETLTLTCAVSGESITTNNRWGHWIRQPQGTGLEWMGYISFSGSTSYSPALQSRIAISRDTFKNQVFLQLHSLTTADTAMYYCTRG
Alligator sinensis Vs1213 ighv AVPB01074820.1 8388 VYAQGSLVESGGGVQRPGETLSLTCTVSGVSLTSVGVHWFHQPKAKGLDWMGVIWSGGSTNYNSALKSRLSITRDTSSGKVQLQLSGLQPRDTAWYYCAR
Alligator sinensis Vs1212 ighv AVPB01074820.1 17456 TLVESGPGVVKPGQTLTLTCTVSGESLSSGNAWTWIRQPPGQGLQWIGRTYYSTSYSRWYTDYASSLQGRVTISADTSQKQFSLQLRSLTAADTATYYCAR
Alligator sinensis Vs1214 ighv AVPB01074825.1 1048 VLSQVTLKESVPVVVTPGQTLSLTCTVSGVSLTSSDMNWIRQAAVKRLEWVGAISSGGGIYYNSALRSRLSFSRDVSSSQVHLHLTGVQPADTARYYCVRE
Alligator sinensis Vs380 trav AVPB01068070.1 1126 LGVQLHLYQPQQFLFVEVGGTAEIHCSSRESVEWGGNVHWYLRRTGEAPMHIKKCADEQNVSRFACKHKGCTTTLEIRAIQRNESGIYYCAHA
Alligator sinensis Vs82 iglv AVPB01012620.1 2446 SSSQSVVTQPPAESVSPGNTVKLSCTMSSGTSISGYYVNWFQQKPGTPPRYLLYYKSDSDKHQGSGVPARFSGSKDTSSNTCYLTIAGALAEDEADYYCAV
Alligator sinensis Vs643 ighv AVPB01122058.1 4318 VLSAVQLVESGPGVVKPAETLTLTCTVTGYSITSGYYWSWIRQPPGKGLEWMGYITNSGSTGYSPSLQSRITISRDTSKNQFSLQLRSLTAADTAMYYCAR
Alligator sinensis Vs727 trav AVPB01142618.1 26566 AVQGDEIRPEEEQVSAAEGDEVTLRCFYTTTYSAGYYVYWYRQHRDRALQYILYRGIKENRRSRDTAEFAQQRFSSRADDNSTVLIITALERADTAVYHCALQF
Alligator sinensis Vs726 trav AVPB01142618.1 23385 HTYAESVTQTEGTVNVVEGEAMFLNCTFETSGYPSLFWYVQFPGEAPRLLPTDTAGREEEEEERKRRRGFSAKLERSVKSFHLEKPSSDRSDSAVYYCALS
Alligator sinensis Vs725 trav AVPB01142618.1 21326 SCCGAQVSQSPEAMVIREGDRAAMACTYSGAYRTFQWYRQVPSGEITHLLTVAADKNVTEGRFTGERLESGQRSSLHVSETRLGDSGRYFCAE
Alligator sinensis Vs724 trav AVPB01142618.1 8388 AVLGETDQSEEQAVSRGEGDAVTLRCSYNTRDSNVRLYWYRQYPNRSSQYILFRGARSLSGQGNTAGFAQDRFSPRLDYNTFVLNISALQRADTAVYFCAVR
Alligator sinensis Vs723 trav AVPB01142618.1 3370 ALRGDSVHPENPQVTAAEGDAVTLRCNYKTSSSADYYLYWYRQHPNRALQYILHRGTKDYSAVSGNAPFAKERFSSQASDSATTLNITALERADTAVYHCTLQ
Alligator sinensis Vs722 trav AVPB01142618.1 1223 GAVRSDSVQPEEEQVSAAEGDEVTLRCFYTTTYSAGYYVYWYRQHRDRALQYILYRGIKENRRSRDTAEFAQQRFSSQADDNSTVLIITALERADTAVYHCALQF
Alligator sinensis Vs721 trav AVPB01142617.1 11415 AAAGDQVTQTEGAVSLSQGDPVSLNCTYDSSYSVFPFWYVQRPGGAPGLFLRDVGRQESDEGTRRGFEATHKKSAPKSFHLWKSAGEWSDSGTYYCAVS
Alligator sinensis Vs720 trav AVPB01142617.1 7556 SCCRAQVSQSPEALVTREGDRSTMVCTYSSAYLPFQWYRQVPSGEITPLLSVPANRNATEGRFTGESQDGGKKSSLNLAETRVADSGRYFCAVA
Alligator sinensis Vs589 trbv AVPB01111906.1 16125 VGSDKVEQPPFFTGVLGELPTLHCTLKDEAFPYMYWYRQQGSKELEALFYSATGSSVTSYTTEPMTAHRTKNTWTLTLNSPSQTDSALYYCACSK
Alligator sinensis Vs588 trbv AVPB01111906.1 2109 VGSDYVQQPRFLMGVPGKRTHLTCTLKMSSYIHMFWYRQQGGKELEALFYSGGDTSTVSYTKEPMEAERSGNDWTLTWKNLSHSDSAVYYCACSD
Alligator sinensis Vs583 trbv AVPB01111902.1 3661 AGAGDLISQWPKSTVQSPGETVAMSCYQNHTTHIYMFWYLQPRGHHTNRESSYEKGYNKTKFPISRDETKLSVMTVTNITAGDAATYFCAASE
Alligator sinensis Vs582 trbv AVPB01111901.1 17630 SGLGVLITQVPKSATQRLGGAVKLTCYQNDTSYTYMYWYKQRQGEGLSLMAWGADRSKANYEEGYKKQTLIAERTSSKAFTMNFTELEAQDSASYFCAASD
Alligator sinensis Vs581 trbv AVPB01111901.1 11064 VASDKVEPPPFLMGVPEEFPPLQCTLKDQTFFHMYWYRQRGSKEMEALFYSTTNDKETNFTAEPMTAKRRGNTWTLTLNSPSGTDSAMYYCACSE
Alligator sinensis Vs580 trbv AVPB01111901.1 7866 SGSDYVEQPPFLTGISGKPRTVQCTLKQRAYDWMYWYRQIGSKELEALFYSSGNGNGSPFTAELLTAKRSENIWTLTWSNVSLSDTAVYYCACSST
Alligator sinensis Vs587 trbv AVPB01111903.1 7922 SGSDYVEQPPFLTGISGKPRTVQCTLKQSGYGWMYWYRQIGSKELEALFYSTGNGDGNPFTAELMTAKRSENIWTLTWSNVSLADTAIYYCACSS
Alligator sinensis Vs586 trbv AVPB01111903.1 5470 FCSIYVEQPPFLTGVPGDTTPLQCTLIKTSYYHMFWYRQRGGRDLEALFYSAGGVSETSFTKEPMEAKKNGNDWTLTWKSLSPSDSAEYYCACCD
Alligator sinensis Vs584 trbv AVPB01111902.1 5687 AGAGDLISQWPKSTVQSPGETVAMSCYQNHTTHIYMFWYLQPRGHGPMLIDSAHTNREASYEKGYNKTKFPISRDETKLSVMTVTNITAGDAATYFCAASE
Alligator sinensis Vs1648 ighv AVPB01168186.1 746 AWSQGQLVESGGDVRKPGDSLRLSCKASGFTFSSYYMNWVRQAPGKGLDWVGDINPDGSTQRYSPTVKGRFTVSRDNSQNMAYLQMSSLKPEDTALYYCAT
Alligator sinensis Vs1649 ighv AVPB01168187.1 2371 SRSQIVLTQSGSEIKKPGESTRLRCAVTGFTATDYSMSWLRQGPGKGLEWLVTYWKAGQSDYYSPSIKGRFTASKDSSNFYLQMTSLKPEDTAVYYCAK
Alligator sinensis Vs1642 ighv AVPB01167978.1 1801 VQSAVELVQSGAVVKKPGETVKISCKTSGFTFTDYYMYWVQQAPGKGLVWVGEIDPEDDTTYYAETLKGRVSITTNISISTVYLQLSRLWPADSAMYYCA
Alligator sinensis Vs1643 ighv AVPB01167980.1 9236 VWSQVQLVEAGGDVRKPGDSLRLSCKASGFTFSSYEMNWVCQAPGKGLEWVAFISTSSSPIYYADSVKGRFTISRDDSSSLLHLQTNSLRAEETARYYCAR
Alligator sinensis Vs1641 ighv AVPB01167977.1 2814 VQSAVELVQSGAVVKKPGETVKISCKTSGFTFTDYYMYWVQQAPGKGLVWVGEIDPEDDTTYYAETLKGRVSITTNISISTVYLQLSRLWPADSAMYYCA
Alligator sinensis Vs1646 ighv AVPB01168184.1 13531 VQSQLQLQESGPGVVKPGETLSLTCTVTGGTFSSSYWWSWVRQAPGKGLDWMGMWDGSTRYNTAFQGRITISGDFSSRKYHLQLSSLRAADTAMYYCAR
Alligator sinensis Vs1647 ighv AVPB01168184.1 1491 IQSQWQLQESGPRVAKPGETLSLTCTVTGGSITGSYWWSWIQQAPGKGLEWMGLWTGSTYYSPAFQNRITISMDSSNTKYYLRLSSLTAADTAMYYCAG
Alligator sinensis Vs1645 ighv AVPB01168183.1 1963 VPSAVQLVESGPGVVKPAEILNLTCTVTGYTISSGYGWSWIRQPTGKGLEWMGYISYSGSTYYNPSFQSRFTISTDNSKNQVSLQLRSLTAADTATYYCAS
Alligator sinensis Vs585 trbv AVPB01111902.1 8237 LCTGVTVTQTKFVTVRNGANASLHCEHDGDVDYNTILWYRQDRAEGNQLEFVVRHTHGGKTETEAKFTEKYHLQPESRTKASLCIISGTAEASAVYFCAASK
Alligator sinensis Vs592 trbv AVPB01111912.1 5212 LCTGVTVTQNKFVTVRNGANVSLPCEHDGDANYNTILWNLQDGASGKELQLVVGHTDGGKPETEAKFKGKYILQPKTRTKASLYIISGTAEVSAVYFCAASR
Alligator sinensis Vs1475 trdv AVPB01132565.1 6998 AARWALAQVSQPPRLTALEGGRLHISCNHNITPHQRMYWYRQPPQGQGAPIFLGSGYDGTSPAGELTMEVYLASRSSTLSRDGARLQDAGIYYCATE
Alligator sinensis Vs741 trdv AVPB01142632.1 3452 GSSLEDSVSPRQADASGVQRGAVTLDCTCETEETYYYLHWYKQRPGGSLAFLLWQKSGGSHMNEAGVSFSVEFPRSHRSFLLSISALRLGDSATYFCAFSK
Alligator sinensis Vs515 iglv AVPB01102043.1 1962 ARSQSLLTQPPSESVPPGHSVKLSCTMSSGTSISGYEVHWYWQKPGSPPQYLLRYKSSSDKCLDSWLPSHFSASKDPSSNTCYLTITGPLAEDEADYYCNVWYG
Alligator sinensis Vs788 igkv AVPB01150145.1 17117 ACAPVGLAGIYHKAALILCKASSSLTDSGNECLAWYQQRPGRAPKLLLCLPSASPPLQSRLPARFSVRGSGADFFLTSSGVESKHAGDYYCFQ
Alligator sinensis Vs1610 iglv AVPB01163628.1 14979 SLSQYTLTQPSSESVSLRNTVKLSCTISSGYTHGAVYWLQQKGGNSPRYLLWYNTDSSKHQGSGVPSRFSGSKDTSNKIGYLTITSVQAEDEADYYCAAYSSNV
Alligator sinensis Vs855 ighv AVPB01164402.1 2844 PGALKPGETLTLTCTVTGDLDKIFSSGCCWWGWVRQSPAKGLEWLGDLNNGGSAYYPPSMQSRLSVTVDSSKNWYSLQMQSLTATDTAMYYCGR
Alligator sinensis Vs981 ighv AVPB01015484.1 2268 VLSAVQVVESGPGVVKPAETLTLTCTVTGYSISTTCSYWSWIRQPPGKGLEYMGYISYDGSTSYYPSLQSCITISRDTSKNQFSLQLRSLTAADMAMYYCAS
Alligator sinensis Vs1658 ighv AVPB01168194.1 7400 VLSQITLKESGPGVVKPGETLSLTCTVSGFSLTSSDVSWVRQADGEGLQWVGVIWYDGSTGYNSVLKSRLTISRDISSSQVHLRLTGLQPADTARYYCAR
Alligator sinensis Vs362 trgv AVPB01064391.1 17127 LILTQSPVSIRKSGGSTARMKCVFTIFMGTFDTAAIHWYQQSPGEAPKRVLYFTSGEAAVDDQSQKSRFTVVKDSLKVSSTFQINRAKKTDTGVYYCAYWD
Alligator sinensis Vs940 ighv AVPB01006785.1 2042 VLTQVQVVASGPGLVKPGDILTMTCSVSGVSITDSSYDWHWIRHPPGNVLEWMGRIYPNNGNTNYASSLQSRIMISAATSKNQFFLQLHSLTAADTAMYYCG
Alligator sinensis Vs908 ighv AVPB01001390.1 17410 AVSAIQLVLSGPGVVKPGETLALTCAVSGESIATSTTWWTWVQQPPGKGLEWMGEISYSVGTSYNPPLKSRVTISRDTSKNQFSLQAQLLMAADTATYYCAR
Alligator sinensis Vs903 ighv AVPB01001384.1 11854 VSSQIQLTQSGAEVRKPGESVKLTCKTSGYTFTNNNLDWARQPPEKGLEWIGDINPSAGSVIYGQAFQGRFTITRDTSVSTTCLQLSNLRNEDTAVYYCA
Alligator sinensis Vs270 iglv AVPB01053378.1 2863 CYAQVTQPPTASVSPGGTVRLSCTLGGSYTVSSNRVLWLQQKPGNAPRFLLYFFTESNKGMGSGVPSRFSGSRSGSDKEGYLTISGAVEEDDADYYCATWTGSA
Alligator sinensis Vs280 iglv AVPB01053388.1 5615 VWSQPVVTQEPAVSVSPGGTVTLSCSLSTGAITSSNYPGWYQQKPGSPPRLLIYNTNSRPSEIPTRFSGSISGQKATLTITGVQAEDEADYYCIVYTGSSAW
Alligator sinensis Vs910 ighv AVPB01001390.1 5311 VLAQVTLKESGPRVVKPRETLSLTCTVSGFSLTSSDVSWVRQEAGKGLEWVGDSWIGGNTYYNSALQSRLTISRDTSSSQVHLRLTGVQPGDTARYYCVR
Alligator sinensis Vs1608 iglv AVPB01163625.1 8924 SLAQYVMTQSPSLSVSPGETAKLTCTGRNIGSNYVQWYQQKSGSAPVLIIYDNSNRPSGIANQFSGSKSGSTATLTITGAQAQDEADYYCQAWDSDSSA
Alligator sinensis Vs729 trdv AVPB01142620.1 3758 GSSLEDKVTQRQADASGVERGTVTLDCTYETGESYYNLYWYKQSPGGSLVFLLRQPSGGSKESEAGPRFTVDFQKRQRSLSLSISDLQLNDSATYFCAFST