WGS Statistics
Organism WGS Record. Vs Total IGHV IGLV IGKV TRAV TRBV TRGV TRDV
Galeopterus variegatus JMZW00000000.1 (JMZW01) 228 49 9 64 54 38 8 6
Vgene Table
Organism Vgene Locus contig Contig Pos. AA sequence
Galeopterus variegatus V54 trav JMZW01015689.1 2103 VSSLHMLEQSPSFLSIPEGTHAILNCTYQEKTFYNFYWFRQYPGKELVSLTLIQSSQKEQADKNLKELFGRKKLFNVLNISTSHPGDSATYFCAL
Galeopterus variegatus V55 trav JMZW01015691.1 2588 ANKRRWSRILNPSVFQSEPLPLSIVCAYSDRASQSLLWYMQYCGKGPEVVMSSYSNGDKEGRFTVQLNKASLYVSLLIRDSQPSDSATYLCA
Galeopterus variegatus V56 trav JMZW01015695.1 2657 TTNGDSVTQTKGPVTLPEGRALTLNCTYQTSYSAFLFWYVQYKNKEPELLLKSSSENQKGDSRGFQAHLVKSDSSFHLQKPSVQTSDSAVYYCALR
Galeopterus variegatus V102 trav JMZW01041492.1 1393 RSHGNSVTQMKGQVILSEKTFLTINCTYTSTGYPSLFWYVQYPGEGPQILLKATTANEKGSNKGFEATYHTETTSFHLKKASVQESDSAMYYCALS
Galeopterus variegatus V146 iglv JMZW01062641.1 13980 SATSYVVTQALSVSVPLGQTASITCSGEKLSEEYVHWYQQKPGQAPLLVIYRDSNRPSGIPDRFSGSNSGNTATLTISGAQAGDEAEYYCHVWDGSF
Galeopterus variegatus V198 igkv JMZW01094345.1 3866 SSGDVVLTQTPLSLPVTPGESASISCKASQSLLHSNGNTYFSWYLQKPGQAPQLLLYLVSNRASGVPDRFSGSGSGTDFTLKISRVEAEDLGVYYCQQD
Galeopterus variegatus V222 ighv JMZW01107338.1 32500 VLSQVQLQESGPGLVKPSQALSLTCTVYGSFITTSISWWHWIRQPLGKGLQWIGEIDHSGVTKHNPFLRSCIFISRDTSKNQFFLQLSSVTAEDTAVYYCAT
Galeopterus variegatus V223 ighv JMZW01107338.1 62156 VLSELTLQESGPGLVKPSQTLSLTCTITGGSVTSAGWNWIRQAPGKALEWMGYINSGGGTAYNPSLKSRISITRDTSKNQFFLQLSSVTDEDTGMYYCAR
Galeopterus variegatus V224 ighv JMZW01107338.1 81622 VLSDVQLQESGPGLVKPSQTLSLTCTVSGFSITSGYGWSWIHQPTGKSLEWMGYISYSGSTAYNPSLKSRTSITRDTSKNQFSLQLSSVTDEDTGVYYCVR
Galeopterus variegatus V225 ighv JMZW01107339.1 17013 VLSEVQLQESGPGLVKPSQTLSLTCTVSGDSITTSSSYWHWIRQLSGKELEWMGRIYYSGSTAYNPSVKSRISITRDTSKNQFSLQLSSVTDEDTAMYFCAR
Galeopterus variegatus V226 ighv JMZW01107339.1 26085 VLSQVQLQGSGPGLVKPSQTLSLTCSVSGFSLTSYGVNWIHQHPGKGLEWVGAIWSDGSTKYNTDLKSRVTITRDTSKSQAYLTLSSLIVEDTAVYYCAR
Galeopterus variegatus V227 ighv JMZW01107339.1 39866 VQCEVQLVESGGGGLVQPGGSLRLSCVASGFTISDYYMDWVHQAPGKGLEWVSFIRNKANSHSTEYAASVKGRFTISSEDSKSTVYLQMDSVKSEDTAMYYCVR
Galeopterus variegatus V269 iglv JMZW01134269.1 5570 SWAEVVFTQPQSVSGSLGQTVTISCTRSSGSIDDRYVHWYQQRPGSAPTTVIYEDNQRPSGVPDRFSGSVDSSSNVASLTISGLRPEDEADYYCQSSDGSY
Galeopterus variegatus V270 iglv JMZW01134272.1 2842 SVAQAELTQLPSMSKALGQMVTLTCTGNSNNVGNQGAAWLQQHPGHVPKLLMHRNNNRPSGISERFSGSRSESTASLTISGLQPEDEADYYCTAWDSSLNA
Galeopterus variegatus V279 trav JMZW01141239.1 17448 DAGAQSVTQPDVHVTVSEGAFLELRCNYSYATTPYLFWYVQYPSQGLQLLLGYFLGETLVKGIKGFEAEFRKSDSSFHLRKPSVHLSDAAEYFCAVS
Galeopterus variegatus V280 trav JMZW01141246.1 1683 ESQGENVEQHPSTLSAQEGDRAVINCTYSDSTSSYFPWYKQGLGKGPQLIIDIRSSMDKKSDHRLTVLLNKKDKHLSLHIAATQPGDSAVYFCAA
Galeopterus variegatus V281 trav JMZW01141246.1 8908 SSIAQKVTQAQPAVLVQEKEAATLECTYDTTAGSYGLFWYKQPSSGEMIFLIRQDSYNQQNATESRYLLNFQKARKSIKLVISAAQVGDSAVYFCALRE
Galeopterus variegatus V334 trav JMZW01168178.1 4294 VSSQELEQSPHYLVIQEGEDLTVNCNLSKTFYGLQWYRQKYGEHLIFLMMLQKSGEEKSHGKITAKFDEKKQQSSLHIQASQPSHSGIYFCGAD
Galeopterus variegatus V335 trav JMZW01168180.1 1207 SGLQLHQIPRSVSIQEGGDVYMNCSSSTFNTLLWYKQDPGKSPVPLITLYKGGELAKNGKITTQFGASRKDSFLNISVSKPSDVGVYFCAGQHSAPQ
Galeopterus variegatus V336 trav JMZW01168182.1 938 ASSEDKVVQSPPSLVVHEGDSAILNCSYEVTNFQSLQWYKQEEKAPTFLFTLISSGNEKKSGSLSSTLDKEKLLSTLNITATQPGDSATYLCAVE
Galeopterus variegatus V347 trbv JMZW01175278.1 9547 ARAQTIHQWPATRVQLVSSPLSLECTVKGASNPTLYWYRQAERGALQLLVYSISVGQVDLEGPQNLSASRPQDGQFILSSKKLLLSDSGFYLCAWS
Galeopterus variegatus V358 trav JMZW01182914.1 14633 VRSLEVEQNPESLSVPEGATAPLNCTYSDRASQSFLWYRQYSGKGPELLMSTYSNGDKVEGRFTVQLNKASLYVSLLIRDSQPRDSATYLCAV
Galeopterus variegatus V359 trav JMZW01182914.1 19872 GTGAQSVTQPDRHLTVSEKAPLELRCNYSSSFSPYLLWYVQYPNQGLQLVLKYASGNTLVKGIKGFEAEFFQSETSFHLKKPSAHWSDAAEYFCALS
Galeopterus variegatus V360 trav JMZW01182917.1 10440 VNSQQGEENPQILSIQEGDNATMSCSYKTSINNLQWYRQDSGRGPVLLILIRSNEREKHSGRLRATLDTSAKSSSLSIMSSQAADTAAYFCAIN
Galeopterus variegatus V361 trav JMZW01182917.1 13340 SSKAQKVTQTQSAISVVEQEAVTLNCVYESRDTTYHLFWYKQPASGEIRFLIRQDSYTEQNETNGRYSVNFQKSANSISLTITASQLTDSAVYFCALRE
Galeopterus variegatus V362 trav JMZW01182920.1 880 RSNGDSVTQTGPVTVSEGAPVILNCTYQTTYSISVLLWYVQYLNKAPQLLLKSSTENQRTEGQGFQANHVKSDSFFYLKKPSAQMSDSAVYYCALI
Galeopterus variegatus V363 trav JMZW01182922.1 572 VSSKQEVNQNPEALNVHEGESLVLNCSYTDSAIYFLQWFRQDAGKGLTSLLLIQSSQTEQTSGRIKASLDKSSRHSTLYIGDSQPGDSATYLCAV
Galeopterus variegatus V364 trav JMZW01182923.1 2883 VRGVRVEQSPPTLSLQEGANSTLRCNFSTSVNNVQWFRQNPGEHLISLFYIPSGTKQNGRLSSTTVTTERHSSLYISSAQTTDSATYLCAVEPQCSP
Galeopterus variegatus V377 ighv JMZW01193090.1 11539 VLSEVQLQESGPGLVKPSQTLSLTCTVSGYSITSGYDWSWIRQPTGKSLEWMGYISYSGSTGYNPSLKSRTSITRDTSKNQFFLQLSSVTDEDTGVYYCAR
Galeopterus variegatus V378 ighv JMZW01193091.1 51902 VLSQVTLKESGPGLVKPTQTLTLTCTFSGFSLTTSDTGVGWIRQPPGKALEWLATIWWDDDKYYSPSLKSRLTISKDTSKNQVVLTMTSMDPSDTATYYCARR
Galeopterus variegatus V379 ighv JMZW01193091.1 72733 VLSEVQLQESGPGLVKPSQTLSLTCTVSGDSITTSGYYWSWIRQPTGKSLEWMGYISYSGSTGYNPSLKSRTSITRDTSKNQFSLQLSSVTDEDTGVYYCAR
Galeopterus variegatus V385 trdv JMZW01196669.1 6935 VSLDIILEPDTKTLTVLVGEAATFRCSITRGDLKNYQMSWYKKNEDNSLILVYKQSNNSNDNLRNHLKGKIDTLKRQFILGIPKATTKDVGTYYCGLD
Galeopterus variegatus V386 trdv JMZW01196685.1 4126 VMSAVVLVPQEQAVTVPVGGSATLRCSMEGETITNFYMNWYRQTQHSALTFIYREGNIYGLGFEGRFQGDIDIPNNQAVLKILKASESDEGSYYCAS
Galeopterus variegatus V394 ighv JMZW01202407.1 38987 VLSEVQLQESGPGLVKPSQTLSLTCAVSGFSITNSGYGWSWIRQPPGKALEWMGRISSSGGTAYNPSLKSRTSITRDTSKNQFSLQLSSVTAEDTGMYYCAR
Galeopterus variegatus V395 ighv JMZW01202408.1 35147 VLSELTLQESGTGLVKPSQTLSLTCTISGGSVTSASWNWIRQPTGKALEWMGYINSGGSTGYNPSIKSCTSITRDTSKNQVFLQLSSVTDEDTGVYYCA
Galeopterus variegatus V398 trav JMZW01204699.1 5436 VNGQQVKQIPQFLHIQEGENFTTYCNSSGTFTTVQWYKQKPGGSPVLLMILTKVGEAKKQERLTAQFGESRKDSSLHIMAAQTADMGTYFCAVV
Galeopterus variegatus V400 trav JMZW01204702.1 6903 GTGAQSVTQPDRHLTVSEGALLELKCNYSYSSTPYLFWYVQHPSQSLQFLLKYVTEPTLVKGIKGFTAEFRKSESSFHLRKASAHWSDTAEYFCALS
Galeopterus variegatus V401 trav JMZW01204711.1 508 IVGDAKTTQPNSMESTEEEPVHLPCNHSTISGSEYIYWYRQTPHQGPEYVIHGLKTNVTNRLASLAIPADRKSSTLILPHVTLRDTAVYYCIVR
Galeopterus variegatus V406 ighv JMZW01207091.1 854 VLSEVQLQESGPELVKPSQTLSLTCTISGDSITNDYGWSWIRQPPGKSLEWMGYLYSSGSTAYKPSLKSHISITIDTTKNQFSLQLNSVTSEDTGVYYCAR
Galeopterus variegatus V407 ighv JMZW01207095.1 22854 VLSQVQLQESGPGLVKPSQTLSLTCSVSGFSLTSYAVNWIRQPPGKGLEWVGAIWSDGSTKYNTNLKSQVTITRDTSKSQAYLTLSSLIVGDTAVYYCAR
Galeopterus variegatus V408 ighv JMZW01207099.1 5915 VLSEMQLQESGPGLVKPSQTLSLTCTVSGDSITTSGYSWHWIRQLSEKGLEWIAAISSSGDTAYNPSLKSRTSITRDTSKNQFSLQLSSVTTEDTGLYYCAR
Galeopterus variegatus V415 ighv JMZW01217740.1 39785 ACAQVQLVQSGAEVKRPGESLRISCKTSGYSFTIYWISWVRQAPGQGLEWVGAIYPGDSDTRYGPSFQGHVTISTDNSASTAYLQWSSLKSSDTAVYYCAR
Galeopterus variegatus V416 ighv JMZW01217741.1 9811 VLSQVQLQESGPGLVKPAQTLSLTCSVSGISLTSYNVHWIRQPPGKGLEWVGAIWSGGGTNYNTDLKSQVSITRDTSKSQVYLTLSSLIVEDTAVYYCSR
Galeopterus variegatus V421 trdv JMZW01225515.1 74222 KGMLCNKVTQSSLDQTVASGSEVTLLCTYNIEYSDPDLYWYRIRPDHSFQFILYRDNTKSRDADFTQGRFSVKHSQTQKTFHLVISPVGTEDSATYYCAVVVS
Galeopterus variegatus V424 trav JMZW01226105.1 2043 VSSILNVEQSPRSLHVQEGETTNFTCSFPSSSFYALHWYRWEHAKSPKILFVMNSDGDEKEEGRVRVTLHTKEGYSYLYINGPQLEDSATYLCAL
Galeopterus variegatus V425 trav JMZW01226106.1 4848 VNGQQVKQIPQFLHIQEGENFTTYCNSSGTSNSLQWYKQRPGGSPVALMILMKGGEVKKQERLTARFGETRKDSSLHITAAQTADVGTYFCAVE
Galeopterus variegatus V426 trav JMZW01226106.1 11167 SSVAQTVTQSQPEMSVQEAGTVTLDCTYDTRDSDYYLFWYKQPPSGQMILIIRQEAYKQQNATENRFSVIFQKAAKIFSLKISDSQLGDAAMYFCALGS
Galeopterus variegatus V427 trav JMZW01226108.1 3465 VNSQKVEQNPRALSIQEGEKATLTCNYTSFSPEALQWYRQDPGRGLVFLLLIRANEGEKQEGRLRVTFDKTSKQSSFHITASRPVDSATYLCAT
Galeopterus variegatus V428 trav JMZW01226110.1 5299 RTNGDSVTQTEGPVTLPEGAALTLNCTYQTSYSVLFSWYVQYLNKAPQLLLKSSTENQRTENQGFQATLVKSDSSFHLKKPSVRMSDSAVYYCALE
Galeopterus variegatus V429 trav JMZW01226110.1 14685 DAAAQSVTQPDVHITISEEASLELRCNYSYSGTPYLFWYVHNPHEGLQVLLRYFSGDTLVKGIKGFEAEFRKSDSSFHLRKRRVHLSDAAEYFCALS
Galeopterus variegatus V430 trav JMZW01226113.1 36 QSNGDSVTQTEGQVTLSQGAFLTINCTYKYTGYPDLFWYVQDPREGPQLLLKASSANENGSNKGFKATYNRETTSFHLKKSSVQESDSAMYYCALS
Galeopterus variegatus V435 trgv JMZW01229691.1 2112 GLGRLEQPEMSISRAKGESVQIPCKVSVQSFKTVVIYWYRQKPNQGLEYLIYISTTPAQGHLGGKTNKLEASKNSRTSTATLKISFLEKEDEATYYCARWD
Galeopterus variegatus V437 trgv JMZW01230389.1 3521 SQMSSSLEGRTMPVTRPAGSFVVITCDLPEPGTKYMHWYLVQERKAPQRLLHCAFLTTTVVLDSETSPGKYHVYEDAGKTCKVVVRNLEESDSGVYYCAMWD
Galeopterus variegatus V438 trgv JMZW01230390.1 10884 HLEQPQASSTKTRSKTARLECVVSGVTISATSIHWYQERPDQAMQRLAYVSSDNAVKIESGIMPGKYEVDKISETSTSTLTIHNVEEQDSATYYCALWD
Galeopterus variegatus V441 trdv JMZW01235427.1 7194 MHTQVVQVNDSMYGFIGTDVVLHCSFANPLPSVKITQVTWQKATNGSKQNVAIYNPVMGVSVLTPYRERVEFLRRSFTDGTIRLSRLELEDEGVYICEF
Galeopterus variegatus V442 trdv JMZW01235427.1 13745 MHTQVVQVNDSMYGFIGTDVVLHCSFANPLPSVKITQVTWQKATNGSKQNVAIYNPVMGVSVLTPYRERVEFLRRSFTDGTIRLSRLELEDEGVYICEF
Galeopterus variegatus V444 ighv JMZW01237774.1 1340 VLSELTLRESGPGLVKPSQTLPLTCTVSGGSVTSSYFWNWICQRPGKALEWMGYWSGGTYYNSGFQGRISITADTSNNQFSLQLSSVTADDTAMYYCAR
Galeopterus variegatus V445 ighv JMZW01237775.1 6751 VLCEIQLVESGGDMRQPGGSLSLSCKASGFTFTNYSMQWVRQAPGQGLEWVARVSQPSGSKQWYSPSVQGRFTISRDNPTSTVSLKMTNLKVEDTAVYYCVR
Galeopterus variegatus V446 ighv JMZW01237776.1 13551 VLSDVQLQESGPGLVKPSQTLSLTCTVSGFSITTSGYGWGWIRQPTGKSLEWMGYTSYGGSTYYNPSLKSHTSITRDTSKNQFSLQLSSVTDEDTGVYYCAR
Galeopterus variegatus V451 ighv JMZW01244033.1 2610 VLSEVQLQESGPGLVKPSQALSLTCAVSGFSITTSYYYWSWIRQPTGKSLEWMGYISYDGSTYYNPSLKSRTSITRDTSKNQFFLQLSSVTDEDTGVYYCAR
Galeopterus variegatus V453 igkv JMZW01245097.1 2438 SSGDAVMTQTPLSLSVISGEPASISCKASQSLLHSNGNTYLKWFLQKPGQAPQLLIYLVSHRASGVPDRFSGSGSGTDFTLKISRVEAEDIGVYYCLQH
Galeopterus variegatus V460 ighv JMZW01246968.1 310 VLSELTLRESGPGLVKPSQTLSLTCTVSGGSVTSSDWWHWIPQRPGKALEWMGYWTGGTYYNPAFQGRISITANTPNNQFSLQLNSVTADDTAVYFCAR
Galeopterus variegatus V461 ighv JMZW01246968.1 10712 VHSQIQLVQSGAEVKKPGESVKVSCKASGYTFTSYPMNWVRQEPGKGLQWMGWINTNTGKPTYAEGFTGRFVFSMDTSVSTAYLQISSLKMEDTAVYYCAR
Galeopterus variegatus V462 ighv JMZW01246969.1 26454 VLSQVQLQESGPGLVKPSQTLSLTCSVSGFSLTSYGVNWIRQRPGKGLEWVGAIWSGGGTDYNTDLKSRVSITRDTSKSQAYLTLNSLIVEDTAVYYCAR
Galeopterus variegatus V465 trav JMZW01250058.1 720 VIRGENVEQSPSTLSAQEGDRAVINCTYSDSASSYFPWYKQELGKGPQFIIDIRSNMDKKLDRRLAVLLNKKDKHLSLHISATQPGDSAIYFCAA
Galeopterus variegatus V466 trav JMZW01250059.1 2652 SSIAQEVTQAQPAMLVQEKEAVTLECTYDTTESSYSLFWYKQPSSGEMIFLIRQDSYNQQNATEGRYSLNFQKARKSISLVILASKLGDSAVYFCALRE
Galeopterus variegatus V474 igkv JMZW01254301.1 6821 TRAETTLTQSPTFISAALGDKVTITCKASTDIDDDMSWYYLKPGEAPMLIIKGASTLHSGVLSRFSGSGYGTDFTLTINGIKSEDAAYYFCGQDDN
Galeopterus variegatus V478 igkv JMZW01258944.1 11046 ACGDIVMTQSPDTLAVSVGERVTISCKSSQSLLYSYNNKNLLAWYQQKAGQAPKLLIYWASTRASGVPDRFSGSGSGTDFTLTISSLQAEDAAVYYCQQYY
Galeopterus variegatus V479 igkv JMZW01259144.1 1262 SRGDIVLTQSPDSLSGTPGEKVTITCRASQSISSSLHWYQQKPNQPPKLLIKYASQSISGIPSRFSGSGSGTDFTLTISSLEAEDAATYYCQQSSSN
Galeopterus variegatus V484 ighv JMZW01262645.1 5778 VQCEVQLLESGGGLVQPGGSLRLSCVGSGFTFSDYYMNWVRQAPGKGLEWVGVIRNKANSYSTTYAESVKGRFTISREDSKSTVYLQMDSLKSEDTAVYYCVR
Galeopterus variegatus V485 ighv JMZW01262645.1 23581 VLSEVQLQESGSGLVKPSQTLSLTCTVSGFSITTSGYYWSWIHQPTGKSLEWMGYIHSGGSTGYNPSLKSRISITRDTSKNQFSLQLSSVTDEDTGVYYCAR
Galeopterus variegatus V486 ighv JMZW01265238.1 983 VQCEVQLVESGGGLVQPGGSLRFSCVASGFTISEYYMDWVHQAPGKGLEFVSFIRNKANSHSTEYAASVKGRFTISIEDSKSTVYLQMDSVKSEDTAVYYCAR
Galeopterus variegatus V487 ighv JMZW01265695.1 265 VQCEVQLVESGGGLVKPRGSLRLTCVASGFTFGDYAMSWVRQAPGKGLEWVSAISWNGGSTYYADSVKGRFTISRENAKNTVYLQTENARAEDTATYYCAR
Galeopterus variegatus V493 igkv JMZW01273283.1 10192 ARCDIQMTQSPSSLSASLGDTVTIACQASQSVSSDLNWYQQKPGKAPTLLIYAASKLQSGVSSRFSGSGSGTDFTLTISILEADDVGSYYCQQDSSKS
Galeopterus variegatus V497 igkv JMZW01277938.1 715 ARCDIQMTQSPSSLSTSLGDTVTITCQANQGISKWLAWYQQKPGKAPKLLIYDASSLESGVPSRFSGSGSGTDFTLTISSLESDDFGTYYCQQYKSNP
Galeopterus variegatus V498 igkv JMZW01278612.1 690 ARCDIQLTQSPSSLSASVGDRVTITCQASQNIYSNLHWYQQKPGKVSTLLIYTASNLQSGVPTRFSGSGSGTDYSLIISSLEADDVGTYYCQQGYSDP
Galeopterus variegatus V499 igkv JMZW01278664.1 969 VTCDIQMTQSPESLSASVGDSVAIACQASQSIGSSLSWYQQKPGKAPKLLIYAASSLYTGVSSRFSGSRSGTEFTLTISSLEAEDIATYYCQQYNNNP
Galeopterus variegatus V502 igkv JMZW01280108.1 284 ARCDVQITQSPSYLSASVGDKVTITCHASQDISDDLNWYQAKPGKAHKLLINDATYLYTGIPSRFSGSQSGTDFTLTISSLESEDFATYFCGQDNSYP
Galeopterus variegatus V505 igkv JMZW01286229.1 12258 ACGDIVMTQSPDNLAVSVGEKVTISCKSSQSLLSSSDNKNYLAWYQQKRGQAPKLLIYLASTRASGVPDRFSGSGSGTDFTLTISSLQAEDAAVYYCGQLYKSP
Galeopterus variegatus V506 igkv JMZW01286229.1 14209 ACGDIVMTQSPDNLAVSVRERVTVSCKSSQSLLSSSDNKNYLAWYQQKPGQAPKLLIYLASTRASGVPDRFSGSGSGTDFTLTISSLQAEDAAVYYCDQHYSHP
Galeopterus variegatus V507 ighv JMZW01286388.1 2661 VLSELTLQESGPGLVKPSQTLSLTCTISGGSVTSASWNWIRQPPGKSLEWMGYINSAGITGYNPSLKSRTSITRDTSKNQVFLQLTSVTDEDTGVYYCAR
Galeopterus variegatus V510 ighv JMZW01287898.1 1307 VQCEVQLVESGGGLVQPGESLRLSCVASGFTFSDYYMHWVCQAPGKGLECVGVIRNKANSHSTDYAASVKGRFTISIEDSKSTVYLQMDSLKSEDTAVYYCAR
Galeopterus variegatus V511 iglv JMZW01289552.1 5493 SWAQSVLTQPPSASGALGQRVTISCTGSSSNIGGGNYVNWYQQLSGKAPKLLIYGNSNRALGIPDRFSGSKSGSSASLTITGLQPEDEADYYCQSYDSNLGA
Galeopterus variegatus V513 iglv JMZW01291903.1 6315 SWSQSVLTQPPSASGALGQRVTISCTGSSSNIGKYFVNWYQQLSGKAPKLLIYGNSNRASGIPDRFSDSQSGSSASLTITGLQPEDEADYYCQSYDSSLV
Galeopterus variegatus V515 ighv JMZW01292674.1 3320 VLSEVQLQESGPGLVKPSQTLSFTCTVSGDSITTSGYGWNWIRQPSGKGLEWMGYITSGGSTSYNPSLKSRTSITRDTSKNQFSLQLSSVNTEDTGVYFCAR
Galeopterus variegatus V517 igkv JMZW01295738.1 291 ARCDIQMTQSPSSLSASLGDTVTITCQASQSVSSSLNWYQQKPGKPPTLLIYAASKLQSGVSSRFSGSGSRTDFTLTISSLEADDVGTYYCQQSNSNP
Galeopterus variegatus V518 trav JMZW01296034.1 1654 GTGAQSVTQPDRHLTVSEEAPLELRCNYPSSVLPSLFWYVQYPNQGLQLVLKYVSGNTLVKGIKGFEAEYFKSETFFHLKKPSAHWSDSAEYFCALS
Galeopterus variegatus V521 trav JMZW01302654.1 12380 GLRAQSVTQLEDQVTVTEGDPLTVKCTYSSSGNPYLFWYVQYPNQGLEFLLKYITGDNLVKGSYGFEAEFNKSQNSFHLKKPSALGSDSAVYFCAVR
Galeopterus variegatus V522 iglv JMZW01309735.1 1243 SWSQSVLTQPSSASGALGQRVTISCTGSSSNFRNYYVHWYQHLSGKAPKLLIYGNSNRASGIPDRFSGSKSGSSASLTITGLQPEDEGDYYCQSYDSSLG
Galeopterus variegatus V523 trbv JMZW01310980.1 1718 SVHAGVIQSPRHLIKGEGGLAILKCHPISGHNTVYWYQQAPGQGLQFLISYYEKMQRDKGNFPSRFSAQQFSDYHSELNMSSLELGDSALYLCASSL
Galeopterus variegatus V524 ighv JMZW01314062.1 4670 VLSELTLQESGPGLVKPSQTLSLTCTISGGSVTSAYWSWICQPPGKALEWMGRISSSGGTTYNPSLKSRTSITRDTSKNQFSLQLSSVTAEDTGVYYCAR
Galeopterus variegatus V526 igkv JMZW01318551.1 102 ARCDIQMTQSPSSLSAFLGDTVTITCQASQGISKWLAWYQQKPGKAPKLLIYDASSLESGVPSRFSGSGSGTDFTLTISSLESDDFGTYYCQQYNSNP
Galeopterus variegatus V527 igkv JMZW01321300.1 8228 TSGDILLTQSPSSLSGASGEKITITCTASQSVKHTGGKTYLSWFQQKSGQVKQLIYQVSNLQTGVPSRFSGSGSDRDFSLTISSLEAEDAAVYYCWQGSYSP
Galeopterus variegatus V528 igkv JMZW01324347.1 1031 VRCDIQMSQSPPYLSAFVGNRVTITCQASESISDDLGWYQQKPGKAPSLLIYEATSLHAGVSSRFSGSQSGTDFTLTISSLEPEDFATYYCGQDNSYP
Galeopterus variegatus V530 igkv JMZW01330368.1 724 VRCDIRMTQSPPYLSAFVGNRVTITCRASQRISDDLGWYQQKPGKAPRLLINEATSLQTGVPSRFSGSQSGTDFTLTISSLEPEDFATYYCGQYNSYP
Galeopterus variegatus V536 igkv JMZW01338390.1 679 VRCDIQMTQSPPYLSAFVGNRVTITCQASESISDDLGWYQQKPGKAPRLLINEATSLQTGVPSWFSGSQSGTDFTLTISSLEPEDFATYYCGQYNSYP
Galeopterus variegatus V540 ighv JMZW01369546.1 3381 VLSQVQLQESGPGLVKPTQTLSLTCSVSGFSLTSYDMHWIRQRPGKGLEWVGAIWSGGGTNYNTDLKSRVSITRDTSKSQAYLTLSSVIVEDTAVYYCAR
Galeopterus variegatus V545 igkv JMZW01394882.1 1002 ARCDIQMTQSPSSLSASVGDSVTITCQASQYINNELSWYQQKPGKAPKLLIYDASSLQSGVSSRFSGSGSGTDYTLTISSLEPEDIANYYCLQDYSRP
Galeopterus variegatus V546 ighv JMZW01397540.1 1412 VLSEVQLQESGPGLVKPSQALSLTCAVSGFSITTSYYYWSWIRQPTGKSLEWMGYISYDGSTYYNPSLKSRTSITRDTSKNQFFLQLSSVTDEDTGVYYCAR
Galeopterus variegatus V547 igkv JMZW01399908.1 715 ARCDIQMTQSPSSLSAFLGDTVTITCQASQGISKWLAWYQQKPGKAPKLLIYDASSLESGVPSRFSGSGSGTDFTLTISSLESDDFGTYYCQQYNSNP
Galeopterus variegatus V553 trav JMZW01421848.1 450 SSIAQKVTQAQPAMLVREKEVVTLECTYDTSAESYGLFWYKQPSSGEMIFLIRQESYNQQNATEDHYSLNFQKARKSINLVILASQLGDSAMYFCALRE
Galeopterus variegatus V555 igkv JMZW01424642.1 493 ARCDIQMTQSPSSLSASLGDTVTITCKASQGISNYLAWYQQKPGKAPKPLIYYASRLQSGVSSRFSGSGSGTDYSLTISGLEADDFGTYYCQQHGAYP
Galeopterus variegatus V557 igkv JMZW01471526.1 201 ARCDIQMTQSPSSLSASLGDTVTITCKAIQGISNCLAWYQQKPEKAPKPLIYYASRLQSGVSSRFSGSGSGRDYSLTISGLEADDFGTYYCQQHSGAYP
Galeopterus variegatus V643 trbv JMZW01024563.1 823 IIDGGVTQTPKYLSRREGQSVTLKCEQNLNYDVMYWYRQDPGQGLRLIYYSQTVMDVQKGDIAEGYGASQEEKAFFPLTVTSARKNQTALYLCASSL
Galeopterus variegatus V644 trbv JMZW01024569.1 11588 HMGAMVIQNPRYQVTRMGKPVNLSCSQDLNHDVMYWYQQQRSQAPKLLFYYYDKEFNKETDTSDNFQSSRPNTSFCSLGIRSPSVEDSAVYLCASSK
Galeopterus variegatus V645 trbv JMZW01024569.1 7300 FLDEKVTQIPGHLVKGKGQKVKMYCVPVKGHSYVFWYQQILAKEFKFLISFQNKNIFDKTGMPKERFSAECLPNSPCSLEIQPTEPQDSAVYLCASSQ
Galeopterus variegatus V647 trbv JMZW01024570.1 13818 HTDAQVTQTPRHEVREMGQAVILRCEPIAGHYDLFWYRQTVVQGLELLIYFSYQTPMNNAGMPKERFSAQMPNASVSTLKIQPAEPGDSAMYLCASSS
Galeopterus variegatus V648 trbv JMZW01024570.1 8890 PMDAEVIQTPRHEVTETGQAVTLRCQPISGHTALFWYRQTVVQGLELLIYFSNQAPIDDKGMPKERFSAQMPNASVSTLKIQPTEPRDSALYLCASSS
Galeopterus variegatus V649 trbv JMZW01024575.1 551 HIDAGVTQNPRNKVTRTGKEVTLRCHQSDNHDHMYWYRQDPGLGLRLIHYSVGSLNTEKGDVPDGYSVSRPNIENFPLSLKSATPSQTSVYFCASSE
Galeopterus variegatus V650 trbv JMZW01024584.1 10311 CMNAGVTQNPRHKVTRIGKEVTLRCHQTNNHDYMCWYRQDPGLGLRLIHYSTVAGFTEKGDIPDGYSVSRSSKEDFPLTLKSATPSQTSVYFCASSE
Galeopterus variegatus V651 trbv JMZW01024584.1 8849 CMNAGVTQNPRHKVTRTGKEVTLRCHQTDNHDYMCWYRQDPGLGLRLIHYSTVAGITEKGDIPDGYSVSRSSKEDFPLTLKSATPSQTSVYFCASSE
Galeopterus variegatus V652 trbv JMZW01024584.1 6400 ITKAEVVQSPRYKIEERRQVVSFWCDPMSDHITLYWYRQPPGQGLELLIRFQNEAISDDSQLPKDRFSVERPKGADSTLKIQPAELGDSAVYLCASSL
Galeopterus variegatus V653 trbv JMZW01024590.1 9075 SVHAGVIQSPRHLIKGEGGLAILKCHPISGHNTVYWYQQAPGQGLQFLISYYEKMQRDKGNFPSRFSAQQFSDYHSELNMSSLELGDSALYLCASSL
Galeopterus variegatus V654 trbv JMZW01024590.1 3586 HMDAGVAQNPRHKVTRIGMEVTLRCHQTDNHNYMYWYRHDPGLGLRLIHYSIATDITEKGDVPDGYSVSRSSKEDFLLTLESATPSQTSVYFCASSE
Galeopterus variegatus V655 trbv JMZW01024594.1 12592 YTDAGVTQTPRHKVTEMGQAVTLRCEPISGHNCFYWYRQTVVQGLELLIYFRNQAPIDDTGMPKERFSAQMPDASVSTLKIQPTEPRDSAMYLCAS
Galeopterus variegatus V656 trbv JMZW01024598.1 3566 HMEAGVTQSPGHKVLRTGKEVTLRCHQTDDHYYMYWYRQDPGLGLRLIHYSTDAGITEKGDIPDGYSVSRSSKEDFLLMLESATPSQTSVYFCASSY
Galeopterus variegatus V657 trbv JMZW01024606.1 5047 CMNAGVTQNPRYKVTRTGKEVTLRCHQTDNHYYMYWYRQDHGLGLRLIYYSSDPGNTEKGEVPDGYSVSRSSKEDFPLTLKSATPLQTSVYFCASSE
Galeopterus variegatus V658 trbv JMZW01024607.1 5699 SVHAGVIQSPRHLIKREGGQAILKCHPVTGHDTVYWYQQALGQGLQFLISYYEKMQRDKGNIPYRFSAQQFSDYHSELNMSSLELKDSALYLCASSL
Galeopterus variegatus V659 trbv JMZW01024611.1 20119 PVEAGVTQTPRHLIKTRGQGVTLRCSPVSGHLSVFWYQQAPGQGPQFLFQHYSEEQRAKGNFPDRFSAHQFPDYRSELNVSSLELGDSALYLCASSL
Galeopterus variegatus V660 trbv JMZW01024611.1 15705 RVNADITQNPRFQVLETGQSVTLSCTQDMNHDNMYWYRQDPGLGLRLIYYSYGVDSTDKGDVPDGYSVSRSSTENFPLTLASATPSQTSVYFCASSY
Galeopterus variegatus V661 trbv JMZW01024611.1 13455 LTGAGVLQSPRHRVTERGQNVALRCDPISGHTALYWYRQNPTQGPEFLIYFLREKETDKSGALSDRFSAERPKGSFSTLRIQPAEQGDSAVYLCASSSAIV
Galeopterus variegatus V662 trbv JMZW01024611.1 7632 SVEAGVTQMPRYLIKTRGQEVTLRCTPISGHLSVFWYQHVLGQGPQFLFEYYSEGQRAKGNFPDRFSAHQFPDYRSELNVSSLELGDSALYLCASSL
Galeopterus variegatus V663 trbv JMZW01024611.1 2746 HTGAGVLQSPRHRVTDRGQNVTLRCDPISGHTALYWYRQTPGHGPEFLTYFQGTNTPDKSGMPGDRFSAERPDGSFSTLKIQLTEQGDSAVYLCASSS
Galeopterus variegatus V664 trbv JMZW01024612.1 14235 PVEAGVTQTPRHLIKTRGQGVTLRCSPVSGHLSVFWYQQAPGQGPQFLFQHYSEEQRAKGNFPDRFSAHQFPDYRSELNVSSLELGDSALYLCASSL
Galeopterus variegatus V665 trbv JMZW01024612.1 9400 RVNADITQNPRFQVLETGQSVTLSCTQDMNHDNMYWYRQDPGLGLRLIYYSYGVDSTDKGDVPDGYSVSRSSTENFPLTLASATPSQTSVYFCASSE
Galeopterus variegatus V666 trbv JMZW01024612.1 8295 HSGAGVLQSPRYRVTERGQNVALRCDPVSGHATLYWYRQTLKQGPEFLIYFQNKDTPDKSGMPGDQFSAERPDGLFSTLKIQPAEQGDSAVYLCASSSAPV
Galeopterus variegatus V667 trbv JMZW01024612.1 1899 SVEAGVTQMPRYLIKTRGQEVTLRCTPISGHLSVFWYQHVLGQGPQFLFEYYSEGQRAKGNFPDRFSAHQFPDYRSELNVSSLELGDSALYLCASSL
Galeopterus variegatus V668 trbv JMZW01024615.1 527 HMEPGVHQTPRHYVIEMGQDATLRCKPISGHLYLYWYRQTPEKGVEFLISFTDKAVSDKADFFNDRFSAEPPDGSSSTLKIRTAQLGDSAIYLCASSS
Galeopterus variegatus V669 trbv JMZW01024616.1 640 SMDTGITQIPKFLVMGMTNKKSLRCEQRLGHNYMCWYRQKAKEPPELMFSYNYQELVENKTVPNRFTPDYPGGSHLYLHVDSLEPEDSAMYLCASSR
Galeopterus variegatus V671 trbv JMZW01024618.1 10501 HTEPGVTQTPSHQILEMGQGVILRCDPISGHLYFYWYRQILGQKVEFLVSFYNDNISEKSEIFQDRFSVRRPDGSYFTLKIQPTELGDSAMYLCASSL
Galeopterus variegatus V672 trbv JMZW01024618.1 3262 PSDTAISQSPKYLITWMGNKESLKCEQNLGHDAMYWYKQDSKRLLEIMFTYNNQELILNETVPSRFSPEAPDKAHLNLHINSPEPDDSAVYLCASSQ
Galeopterus variegatus V673 trbv JMZW01024618.1 2231 PLDTAISQSPKYLITWMGNKESLKCEQNLGHDAMYWYKQDSKRLLEIMFTYNNKELILNETVPSRFSPEAPDKAHLNLHINSPEPDDSAVYLCASSQ
Galeopterus variegatus V674 trbv JMZW01024619.1 1199 SVHAGVIQSPRHLIKREGGQAILKCHPVSGHDTVYWYQQALGQGLQFLISYYEKKQNEKGNFPSRFSAQQFSDYHSELNMSSLELKDSASYLCASIS
Galeopterus variegatus V694 trgv JMZW01038371.1 5139 GLGQLEQPEMSISRATGQSVQIPCKVSVQNFKNVVVYWYRQKPNQGLEFLIYISTTPAQGHLGGKRNKLEASKNSRTSTATLKIRFLEKEDEATYYCACWV
Galeopterus variegatus V911 trav JMZW01161353.1 7061 KIHGDSVTQTEGQVTLSQGAFLTINCTYTATGYPSLFWYVQYPGEGPQILLKAMAANEKGSNKDFEATYHRETTSFHLKKASVQMSDSAMYYCALS
Galeopterus variegatus V912 trav JMZW01161355.1 5178 SSIAQKVTQAQPAMLVREKEVVTLECTYDTSAESYGLFWYKQPSSGEMIFLIRQDSYNQQNATESRYLLNFQKARKSINLVILASQLGDSAMYFCALRE
Galeopterus variegatus V913 trav JMZW01161357.1 8044 GVRGVQVEQSPSALSLQEGTSPTLRCNFSASVNNVQWFRQNPGGGLISLFFMALGTKQSGRLKSTMNSKELYSTLHITASQLEDSGTYLCAVE
Galeopterus variegatus V914 trav JMZW01161357.1 681 LSQGEKVEQHPSTLSAQEGDRAVINCTYSDSVSNYFPWYKQEPGKSLQLIIDIRSNMDKKQDQRLTVLLDKTAKHLSLHIAAIQPGDSAVYFCAA
Galeopterus variegatus V915 trav JMZW01161360.1 596 DARAQSVTQPDVHVTVSEGASLELRCNYSHGGSLYLFWYVQYPRQGLQRLLKYSSGDPQVKGIKGFEDEFVKSESSFHLRKPSVHWSDTAEYFCAWV
Galeopterus variegatus V916 trav JMZW01161362.1 13300 DAGAQSVTQPDVHVTVSEGAFLELRCNYSYATTPYLFWYVQYPSQGLQLLLGYFSGETLVKGIKGFEAEFRKSDSSFHLRKPSVHLSDAAEYFCAVS
Galeopterus variegatus V917 trav JMZW01161362.1 5767 GSNGDSVMQTEGQVTLSEGASLTVNCSYETKQYPALFWYVQYPGEVLQLLFSVSKANEKGSNKGFEATYSKETTSFHLKKASVQESDSAMYYCALS
Galeopterus variegatus V918 trav JMZW01161363.1 15750 LSRGEEVEQRPSSLSVQEGDSTVVINCTYTDSTSTFFSWYKQEPGKSLQRIIDIRSNMDKKQDQRLTVLLDKTAKHLSLHIAAIQPGDSAVYFCAV
Galeopterus variegatus V919 trav JMZW01161363.1 4666 VNSQKVEQNPRALSIQEGEKATLTCNYTSFSPEALQWYRQDPGRGLVFLLLIRENEGEKQEGRLRVTFDKTSKQSSFHITASRPVDSATYLCAA
Galeopterus variegatus V920 trav JMZW01161364.1 6274 VNGQQVKQIPQFLHIQEGENFTTYCNSSGTFTTVQWYKQKPGGSPVLLMILTKFGEAKKQERLTAQFGESRKDSSLHIMAAQTADVGTYFCAVV
Galeopterus variegatus V921 trav JMZW01161365.1 13858 GTRAQTVTQPEDHVSVSEGFPVQLKCNYSYSGSPVLFWYVQYPKQGPQLLLKHISGESIKGFTAELNKGEASFHMRKSSAQEEDSATYYCALS
Galeopterus variegatus V922 trav JMZW01161365.1 12173 GTRAQTVTQPEDHVSVSEGFPVQLKCNYSYSGSPVLFWYVQYPKQGPQLLLKHISGESIKGFTAELNKGEASFHMRKSSAQEEDSATYYCALS
Galeopterus variegatus V923 trav JMZW01161365.1 6474 VNSQQEGNPQILSIQEGDNATMNCSYKMSTDNLQWYRQDSGRGPALLILIRSNEREKHSGRLRATLDISTKSSSLSIMASQVSDTAAYFCATN
Galeopterus variegatus V924 trav JMZW01161367.1 16383 GTGAQSVTQPDRHLTVSEEAPLELRCNYPSSVLPSLFWYVQYPNQGLQLVLKYVSGNTLVKGIKGFEAEYFKSETFFHLKKPSAHWSDSAEYFCALS
Galeopterus variegatus V938 igkv JMZW01170978.1 4051 TRCDIQMTQSPSSLSASVGDSVTINCQASQDIGNELSWYQQKPGKGPKLLIYYASILQSGVSSRFSGSGSGTDYTLTISILEPEDIATYYCLQDYSTP
Galeopterus variegatus V946 igkv JMZW01174395.1 592 SSRDVVLTQTPLSLPVTPGESASIFCKSSQSLLHSNGNTYLSWSLQKPGQAPLLLLYLVSNRASGVPDRFSGCGSGTGFTLKISRVEAEDLGVYYCQQD
Galeopterus variegatus V950 trbv JMZW01175283.1 14970 SVFGALLFQKPSRDICQRGTSMMIRCQVDSQVSSMFWYRQLLGQSLELIATANQGSEATYESGFTKDKFPISRPNLTFSTLTVSNLSPEDSSLYLCSAG
Galeopterus variegatus V951 trbv JMZW01175287.1 4760 PMEAQVTQTPRHFITGTRKKLTMTCSQNMNHEAMYWYRQDPGLGLKLIYYSINVQVVEEGEVPDGYTVSRKEKKNFLLTLDSTSINQTSLYLCASSL
Galeopterus variegatus V952 trbv JMZW01175287.1 698 LLDAKVTQTQRYLVKKMKDKVSLECLQDMNHERMFWYRQDPGLGLRLVYFSYDVDNNEKGDVSEGYSVSRKKREHFFLILESASTNQTSVYLCASSL
Galeopterus variegatus V953 trbv JMZW01175288.1 8296 PMDAGIIQIPRNIITKTGKSNILECSQTMGHNRMYWYRQDPGLGLRLIYYSLDVNDIYEGEVSNGYSVSRKEQPKFSLSLKVATPNQTALYFCASSE
Galeopterus variegatus V962 trdv JMZW01180728.1 13046 VSLDIILEPDTKTLTVLVGEAATFRCSITRGDLKNYQMSWYKKNEDNSLILVYKQSNNSNDNLRNHLKGKIDTLKRQFILGIPKATTKDVGTYYCGLD
Galeopterus variegatus V963 trav JMZW01180732.1 6789 ETSGNSVKWTDQITTLEGASVTMNCTYISTGYPALFWYVQYPNKALKFLQKETMENSKNFGARNIKEKNSPIVKYSVQVSDSAVYYCLLSDTVPR
Galeopterus variegatus V964 trav JMZW01180736.1 1197 SSVAQTVTQSQPEVSVWEAGTVTLDCTYDTRNSDYYLFWYKQPPSGQMILIIRQEAYKQQNATENRFSVIFQKAAKIFSLKISDSQLGDAAMYFCALGS
Galeopterus variegatus V965 ighv JMZW01181303.1 22070 CLCQVQLQESGPGLVKPSQTLSLSCSVSGYSITSGNCWGWICQLPGKELEWIGYICYDGSTYYSPSLKSRVTITRDTSKNQYSLHLSSVTAEDTAVYYCA
Galeopterus variegatus V966 ighv JMZW01181305.1 13951 VLSQVQLQESGPGLGKSSQTLSLTCTVAGFSISSSGYGWNWICQPQGKSLEWVGDISYSGCTGYNPSLKSQISITRETSNNKLSLQLSSVTTEDRAVYYCV
Galeopterus variegatus V967 ighv JMZW01181310.1 18677 VLSQVTMKESGPRLVKPTQTLTLTCTFSGFSLSMSGMGVGWIRQPTGKALEWLALIDWEDDKYYSPSLKNRLTISKDTSKNQVVLTMTSMDPADTATYYCAQR
Galeopterus variegatus V980 iglv JMZW01191542.1 2809 SQVQSTLTQPPSVSGALQQSVTISCAGPISDIGGYNYVSWYQQIPGKVLTYDVSTRQSGIPDHSSGSMSGNTASLTISGLQPEEEADYFCCSYSSSNI
Galeopterus variegatus V985 trav JMZW01194297.1 52217 TCLLIGSAGQSVEQPTELMAMEGASVQVNCMYQTSGFNGLSWYQQHDGGAPIFLSYSVLDGLERRGRFSSFLSQSDRYSYLILKELETQDSASYLCAVR
Galeopterus variegatus V986 trav JMZW01194297.1 34680 TCLLTGSAGQSIEQPTELMAMEGASVQVNCTYRTSGFNGLSWYQQLDGGAPIFLSYSVLDGLERRGRFSSFLSQSDRYSYLILKELETQDSASYLCAVR
Galeopterus variegatus V988 trgv JMZW01194396.1 2395 GETTMRLSQDQLSFTRRPNRTVHISCKLSGVPLKNAIVHWYQEKEGEPLKRIFYGSSKNYKHEKPNSRLETDKKNDGIFYLIINNVAQSDEATYYCACWD
Galeopterus variegatus V998 igkv JMZW01205900.1 9303 ARCDIQMTQSPSSLSASLGDTVTITCQASQGISKYLAWYQQKPGKAPTLLIYDASKLQSGVSSRFSGSGSGTDFTLTISSLEADDVGTYYCQQGSSNL
Galeopterus variegatus V999 igkv JMZW01205907.1 4880 ARCDIQMTQSPSSLSASLGDTVTITCQASQGISKYLAWYQQKPGKAPTLLIYYASSLPSGVSSRFSGSGSGTDYTLTISSLEADDVGTYYCQQGYNTP
Galeopterus variegatus V1011 igkv JMZW01218997.1 342 TTGEVVMTQSPASLSLSPGEKATLTCRASQGISSYLAWYQQKPGQAPKLLIYGASTRATGIPSRFSGSGSGTDFTLTINSLEPEDFAVYHCQQYSSGY
Galeopterus variegatus V1012 igkv JMZW01219006.1 2256 SSGDVVMTQTPLSLLITPGEPVSISCRASQSLLSDDGNTYLEWFLQKPGQSPRLLFYRPSKRASGVPDRFSGSGSGTDFTLKISRVEAEDVGIYYCVQA
Galeopterus variegatus V1013 igkv JMZW01219015.1 487 SSGDVVLTQTPLTLPVTPGEPASISCRASQSLLHSDGNTYLYWFLQKPGQAPQRLICLVSNRGSGVPDRFSGSGSGTDFTLKISRVEAEDIGVYYCMQG
Galeopterus variegatus V1014 igkv JMZW01220130.1 2795 ARCDIQMTQSSSSLSASLGDTVTITCQASQSVSSSLNWYQQKSGKHPTLLIYAASKLQSGVSSRFSGSGSGTDFTLTISSLEADDVGTYFCQQGYSN
Galeopterus variegatus V1016 ighv JMZW01220649.1 11446 VLSEVQLQESGLGLVKPSQTLSLTCTVSGDSITTSGYDWSWIRQPSGKGLEWIAAIGSSGGTAYNPSLKSRTSITRDTSKNQFFLQLSSVTAEDTGVYYCAR
Galeopterus variegatus V1017 ighv JMZW01220650.1 16183 VLSQVQLQESGPGLVKPSQMLSLTCTISGDFITTPSYGWSWIRQPSGKGLEWMGTFSYSGGTDYNPSLKSRTSITGDTSKNQFSLQLSSVTNEDTGVYYCAR
Galeopterus variegatus V1018 ighv JMZW01220650.1 10356 VQCEVQLVESGGGLVKPAGSLRLTCIASGFTFGHYGMHWVRQAPGKGLEWISAISWSGGSIYYADSVKGRFTISRENAKNTLYLQTDNLRAEDMAMYYCAR
Galeopterus variegatus V1019 ighv JMZW01220650.1 1919 VLSEVQLQESGPGLVKPSQTLSLTCTVSGFSITTSGYYWSWIRQLSEKRLEWIGVIAYDGSTGYNPSLKIRTSITRDTSKDQFSLQLSSVTAEDTGVYYCAR
Galeopterus variegatus V1032 iglv JMZW01230763.1 15081 ATSQVVVTQETSLSTTPGETVTFTCGSSAGAVTTSNYANWVQQKPNQVLGGLIGDTSNRLSGVPARFSGSLIGGKAALTITGAQPEDEAKYYCALWFS
Galeopterus variegatus V1033 ighv JMZW01231033.1 2731 TCAQVQLVQSGAEVKRPGESLRISCKTSGYTFTSYWISWVRQAPGQGLEWVGRIDPSDSETRYGPSFQGHVTLSADNSASTAYLQWSSLKASDTAVYYCAR
Galeopterus variegatus V1035 ighv JMZW01231035.1 11008 VLSQVQLQESGPGLVKPSQTLSLTCSVSGFSLTSYDMHWIRQRPGKGLQWVDAIWSDGSTNYNTDLKSRVSITRDTSKSQAYLTLSSLIVGDTAVYYCAR
Galeopterus variegatus V1046 igkv JMZW01241692.1 2448 SSGDVVMTQTPLSLPVTPGEPASISCTASQSLLHSDGNTYLSWYLQKPGQSPQLLIYKVSNRFSGVSDRFTGSGSGTDFTLKISRVEAEDVGVYYCMQGTKTP
Galeopterus variegatus V1052 igkv JMZW01251401.1 564 TRAETTLTQSPAFISAALGDKVTITCKASTDIDDDMSWYYLKPGEAPMLIIKGASTLHSGVPSRFSGSGYGTDFTLTINGIKSEDAAYYFCGQDDN
Galeopterus variegatus V1060 igkv JMZW01255922.1 9022 ARCDIQMTQSPSSLSASLGDTVTITCQASQGISKYLAWYQQKPGKAPTLLIYYASKLQSGVSSRFSGSGSGTDYTLTISSLEADDVGTYYCQQHSSSP
Galeopterus variegatus V1061 igkv JMZW01255925.1 2531 ARCDIQMTQSPSSLSASLGETVTITCQASQNIGKHLAWYQQKPGKAPKLLIYAASNLQSGVSSRFSGSGSGTDYSLTISSLEADDFGTYYCQQYTSSP
Galeopterus variegatus V1062 igkv JMZW01255927.1 2899 ARCDIQMTQSPSSLSASLGDTVTITCKASQGISNCLAWYQQKPGKAPKPLIYDASRLQSGVSSRFSGSGSGTDYSLTISGLEADDFGTYYCQQHGAYP
Galeopterus variegatus V1063 igkv JMZW01256018.1 24627 ARCDIQMTQSPSSLSTSLGDTVTITCQASQGISKWLAWYQQKPGKAPKLLIYGASSLESGVPSRFSGSGSGTDFTLTISSLESDDFGTYYCQQYKSNP
Galeopterus variegatus V1064 igkv JMZW01256018.1 17888 ARCDIQMTQSPSSLSASLGDTVTITCQASQDISNYLAWYQQKPGKAPKLLIYYASSLQIGIPSRFSGSGSGTDFTLTISSLEADDVGTYYCQQHDSKP
Galeopterus variegatus V1065 igkv JMZW01259153.1 3939 SRCDIQMTQSPSSLSASLGDTVTITCKASQGISKWLAWYQQKPGKSPTLLIYAASNLHTGVPSRFSGSGSGTDFTLTISSLEADDVGTYYCQQHDSNP
Galeopterus variegatus V1066 igkv JMZW01260578.1 11787 ARCDIQMTQSPSSLSASLGDTVTITCQASQGISNRLSWYQQKPGKAPELLIYFASSLQSGVSSRFSGSGSGTDFTLTISGLEADDVGTYYCQQGYNTP
Galeopterus variegatus V1068 igkv JMZW01261001.1 2825 SSGDVVMTQTPLSLPVTPGEPASISCTASQSLLHSDGNTYLNWYLQKPGQSPKLLIYKVSNRFSGVSDRFTGSGSGTDFTLKISRVEAEDVGVYYCMQGTKT
Galeopterus variegatus V1069 igkv JMZW01261008.1 840 ARCDIQMTQSPSSLSASIGDMVTITCQASQSVSSYLNWYQQKSGKAPKRLIYKASSLQNGIPSRFSGSGSGTDFTLTISSLEADDVGTYYCQQHDSRP
Galeopterus variegatus V1071 igkv JMZW01262486.1 2791 ARCDIQITQSPSSLSASVGDSVAIACQASQSIGSSLSWYQQKPGKAPKLLIYAASSLYTGVSSRFSDSRSGTDFTLTVSSLEAEDIATYYCQQFYNNP
Galeopterus variegatus V1072 igkv JMZW01262679.1 4634 ARCDIQMTQSPSSLSASLGDTVTITCQASQSVSSYLNWYQQKSGKAPTLLIYYASKLQSGVSSRFSGSGSGTDFTLTISSLEADDVGTYYCQQYTSTP
Galeopterus variegatus V1073 igkv JMZW01262952.1 5228 ARCDIQMTQSPSSLSASLGDTVTITCQASEGIGKYLAWYQQKPWKAPTLLIYAASTLQSGVSSRFSGSGSGTDFTLTISSLEADDVGTYYCHQSKSNP
Galeopterus variegatus V1074 ighv JMZW01269684.1 1834 VLSQVQLQESGPGLVKPAQTLSLTCSVSGFSLTSYDMHWIRQRPGKGLEWVGAIWSGGGTNYNTDLKSRVSITRDTSKSQAYLTLNSLIVEDTAVYYCAR
Galeopterus variegatus V1076 trgv JMZW01274765.1 1192 GLGRLEQPEMSISRATGESVQIPCKVSVQSFKNVVVYWYRQKPNQGLEYLIYISTTPAQGHLGGKRNKLEASKNSHTSTVTLKIHFLEKEDEATYYCACWV
Galeopterus variegatus V1077 ighv JMZW01274955.1 22961 VLSQVTLKESGPGLVKPTQTLRLTCTFSGFSLSTSGTIVSWIRQPPGKALEWLALIDWEDDKYYSPSLKSQLTISKDTSENQVVLTMTNMDPADTATYYCARR
Galeopterus variegatus V1078 ighv JMZW01274955.1 1512 VLSELTLQESGPGLVKPSQTLSLTCTVSGGSVTSIDWSWIRQPPGKSLEWMGYISSGGSTGYNPSLKSRTSITRDTSKNQFSLQLSSVTAEDTGVYYCAR
Galeopterus variegatus V1081 igkv JMZW01277249.1 10521 ARCGIQTTQSPSSLSASLGDTVTITCQASQGFSKWLAWYQQKPGKAPKLLIYKASSLQSGIPSRFSGSGSGTDFTLTISGLEADDVGTYYCQQGYSDP
Galeopterus variegatus V1082 igkv JMZW01277498.1 5030 ARCDIQMTQSPESLSASVGDSVTITCQASQNIGSLLNWYQQKPGKSPKLLVYAASNLDTGVSLRFSGSRSGTDFTLSISSLEPEDIATYYCQQYYNIP
Galeopterus variegatus V1083 igkv JMZW01279711.1 414 VRCDIQMTQSPSSLSASLGDTVTITCQASQSISSWLAWYQQKPGKAPKLLIYKASSLQSGISSRFSGSGSGTDFTLTISSLESEDVATYYCQQYSSYP
Galeopterus variegatus V1084 igkv JMZW01279916.1 1693 ARCDIQMTQSPESLSASVGDSVTITCQASQDIGNALSWYQQKPGKAPKLLVYAASSLYTGVSSRFSGSRSGTDFTLTITSLEAEDIATYYCQQYYNNP
Galeopterus variegatus V1088 igkv JMZW01282872.1 18897 ARCDIQMTQSPSSLSASLGDTVTITCQASQGISNYLAWYQQKPGKAPKLLIYYASSLQSGIPSRFSGSGSGTDFTLPISSLEADDVGTYYCQQHYSRP
Galeopterus variegatus V1089 trgv JMZW01285517.1 678 GETTMRLSQDQLSFTRRPNRTVHISCKLSGVPLKNAIVHWYQEKEGEPLKRIFYGSSKNYKHEKPNSRLETDNKDDGIFYLIINNVAQSDEATYYCACWD
Galeopterus variegatus V1092 igkv JMZW01289075.1 4102 ARCDIQMTQSPSSLSASLGDRVTITCQASEDIYGALAWYQQKPGKAPKLLIYGASNLHTGVSSRFSGSGSGTDYFLTISSLESEDVAIYYCQQYGSTP
Galeopterus variegatus V1093 igkv JMZW01290310.1 3592 TSGDIVLTQSPSSLSGAPGEKITITCIASQSVKYTDGKTYLNWFQQKSGRVKHLIYQVSNLRTGVPSRFSGSGSDRDFSLTISSLEAEDAAVYYCEQGSYSP
Galeopterus variegatus V1094 igkv JMZW01290311.1 358 TSGDIVLTQSPSSLSGAPGEKITITCTASQSVKYTDGKTYLNWFQQKSGRVKQLIYQVSNLRTGVPSRFSGSGSDRDFSLTISSLEAEDAAVYYCAQGSYTP
Galeopterus variegatus V1097 igkv JMZW01292261.1 937 ARCDIQMTQSPSSLSASLGDKVTITCQASQGISSNLHWYQQKPGKAPKLLIYYSSNLQSGVPSRISGSRSGTEFTLTISSLEREDIATYYCQHSNSYP
Galeopterus variegatus V1098 igkv JMZW01292924.1 1624 ARCDIEMTQSPSSLSASLGDTVTITCQASEGISKYLAWYQQKPGKAPTLLIYKASNLQSGVSSRFSGSGSGTDFTLTISSLEADDVGSYYCQQGSSTP
Galeopterus variegatus V1101 trav JMZW01296275.1 4701 RSNGDSVTQTGPVTVSEGAPVILNCTYQTTYSISVLLWYVQYLNKAPQLLLKSSTENQRTEGQGFQANHVKSDSFFYLKKPSAQMSDSAVYYCALI
Galeopterus variegatus V1102 ighv JMZW01297345.1 1552 VHSQVQLVQSGAEVKKPGESVKVSCKASGYTFTSYGMTWVRQEPGKGLQWMGWINTDTGKPTYAEGFSGRFVFSMDTSVSTAYLQISSLKMEDTAVYYCAR
Galeopterus variegatus V1103 trav JMZW01298288.1 4163 VNGQQVKQIPQFLHIQEGENFTTYCNSSGTSNSLQWYKQRPGGSPVALMILMKGGEVKKQERLAARFGETRKDSSLHITAAQTADVGTYFCAVE
Galeopterus variegatus V1104 igkv JMZW01298306.1 454 VRCDIQMTQSPESLSASVGDTVTITCQASESTGNYLAWYQQKPGKAPKLLIYDASSLQSGVSSQFSGSGFGTDFTLTISSLEPEDIATYYCQEYSSDL
Galeopterus variegatus V1107 igkv JMZW01302590.1 2177 ARCDIQMTQSPSSLSASVGDRVTITCQESQGISSNLHWYQQKPGKSPKLLIYYASNLQSGVPLRFSGSGSGTDFTLTISSLEPKNIATYYCQQSNSYP
Galeopterus variegatus V1109 trbv JMZW01307227.1 8684 PMDAEVIQTPRHEVTETGQAVTLRCQPISGHTALFWYRQTVVQGLELLIYFSNQAPIDDKGMPKERFSAQMPNASVSTLKIQPTEPRDSALYLCASSS
Galeopterus variegatus V1110 igkv JMZW01307766.1 390 ARCDIQMTQSPSSLSASLGDTVTITCQASQGISKYLAWYQQKPGKATKLLIYDASNLQSGVSSRFSGSGSGKDYSLTISGLEADDVGIYYCQHYYNNP
Galeopterus variegatus V1112 ighv JMZW01318114.1 5962 VLSEVQLQESGPGLVKPSQTLSLTCTVSGDSITTSGYGWNWIRRPSGKGLEWMGYITSGGSTSYNPSLKSRTSITRNTSKNQFSLQLRSVTDEDTGVYFCAR
Galeopterus variegatus V1113 igkv JMZW01318817.1 366 TSGDIVLTQSPSSLSGAPGEKITITCTASQSVKYTDGKTYLSWFQQKSGQVKQLIYQVSNLRTGVPSRFSGSGSESDFSLTISSLEAEDAAVYYCGQASYTP
Galeopterus variegatus V1115 ighv JMZW01328983.1 1474 VLSQVTLKESGPGLVKPTQMLTLTCTFSGFSLSTFDTGVGWIRQPPGKALEWLANIYGDDDKYYSPSLKNRLTISKDTSKSQVVLTMTNMDPADTATYYCAWR
Galeopterus variegatus V1116 igkv JMZW01329275.1 898 ARCDIQMTQSPSSLSASLGDTVTITCQASQSVSSYLNWYQQKPGKAPTLLIYAASTLQSGVSSRFSGSGSGTDFTLTISSLEADDVGTYYCQQGYNYP
Galeopterus variegatus V1118 trav JMZW01329708.1 2064 LSRGEEVEQRPSSLSVQEGDSTVVINCTYTDSTSTFFSWYKQEPGKSLQRIIDIRSNMDKKQDQRLTVLLDKTAKHLSLHIAATQPGDSAVYFCAV
Galeopterus variegatus V1119 trbv JMZW01334164.1 823 CMNAGVTQNPRYKVTRTGKEVTLRCHQTDNHYYMYWYRQDHGLGLRLIYYSSDPGNTEKGEVPDGYSVSRSSKEDFPLTLKSATPLQTSVYFCASSE
Galeopterus variegatus V1122 trav JMZW01361707.1 576 KTHGDSVNQMEGQMTLSEWTLLTINCTYTATGYPALFWYVQYPAEGPQLLLKATRDNEKGSNKGFEATYHRETTSFHLKKASVQMSDSAMYYCALG
Galeopterus variegatus V1124 igkv JMZW01364773.1 846 ARCDIQMTQSPESLSASVGDSVTITCQASQNIGSSLSWYQQKPGNAPKPLVYAASNLETGVSSRFSGSGAGTDFTLSISSLEPEDIATYYCQQYYNNP
Galeopterus variegatus V1127 igkv JMZW01367419.1 4344 TRCDIQMTQSPSSLSASVGDRVTITCQESQGISSNLHWYQQKPGKSPKLLIYYASNLQSGVPSRFSGSGSGTDFTLTISSLEPEITATYYCQQSNSYP
Galeopterus variegatus V1128 trgv JMZW01371519.1 1615 GLGRLEQPEMSISRATGESVQIPCKVSVQSFKSEAIYWYRQKPNQGLEFLIYIISTTPAQGHLDGKNNKLEASKNSRTSTATLKIRFLEKEDEATYYCACWV
Galeopterus variegatus V1129 igkv JMZW01382471.1 363 ARCDIQMTQSPSSLSASVGDRVTITCQASQGISSNLHWYQQKPGESPKLLIYYVSNLQSGVPSRFSGSGSGTDFTLTISSLEPEDIATYYCQQSNSYP
Galeopterus variegatus V1131 igkv JMZW01391711.1 604 ARCDIQMTQSPSSLSASLGETVTITCQASQNIGKHLAWYQQKPGKAPKLLIYAASNLQSGVSSRFSGSGSGTDYSLTISSLEADDFGTYYCQQYASTP
Galeopterus variegatus V1138 iglv JMZW01407710.1 722 SWAQSVLTQPPSASGALGQRVTISCTGSSSNIGGGYNVHWYQQLSGKAPKLLIYGNSNRASGIPDRFSGSKSGSSASLTITGLQPEDEADYYCQSYDSSLGA
Galeopterus variegatus V1141 igkv JMZW01439363.1 370 ARCDIQMTQSPSSLSASLGDTATISCQASQGISKWLAWYQQKPGKAPKLLIYDASTLQSGVPSRFSGSGSGTDFTLTISSLEPDDFGTYYCQQHNSYP
Galeopterus variegatus V1145 ighv JMZW01480677.1 384 VLSEMTLRESGPGLVKPSQTLSLTCTVSGGSVTSSYFWNWICQRPGKALEWMGYWSGGTYYNSAFQGRISITADTSNNQFSLQLSSVTADDTAMYYCAR