WGS Statistics
Organism WGS Record. Vs Total IGHV IGLV IGKV TRAV TRBV TRGV TRDV
Chrysemys picta bellii AHGY00000000.2 (AHGY02) 525 228 52 94 83 10 45 13
Chrysemys picta bellii AHGY00000000.1 (AHGY01) 702 342 83 109 113 19 25 11
Vgene Table
Organism Vgene Locus contig Contig Pos. AA sequence
Chrysemys picta bellii V23 ighv AHGY02093757.1 7898 AFSQLNLVQSGSAMVKPSEPLKLTCAVSGNSISSSNWWSWFRRTHGQGLEWMGLITSNGNTIYAPSLQTRVAITRDAARNEYYLQVHSAAPADTGTYYCARDIYLF
Chrysemys picta bellii V22 ighv AHGY02093754.1 14625 LVESGGDVKKPGESLRLSCKASGFTFSSAYMNWVRQAPGKGLEWVAQIYPGGSTTNYLDSVKGRFTISRDDSKSELYLQMSGLKPEDTARYYCAR
Chrysemys picta bellii V21 ighv AHGY02093748.1 2121 TVQLVESKGGIQTPGGSLRLSCKASGFTFSSYRMDWVRQAPGKGLEWVAEILEPANNLAAYYSDAVKGRFTISRDESSSSVYLQMNSLRAEDTTRYYCAR
Chrysemys picta bellii V20 ighv AHGY02093746.1 1505 ARSQGALTQSGTAVKKPGESHTVKCAVSGFNVMGYNMFWIRQAPGKGMEWIIHYYSPSRNNYSPAIQGRFTASKDSSNFYLQMTSLKPEDTAVYYCAR
Chrysemys picta bellii V19 ighv AHGY02093732.1 20706 VQSQVQLVESGGGIQTPGGSLRLSCKASGFTFSSYHMNWVRQAPGKGLEWVAQILNPAYSSAAYYSDAAKERFTISRDESRSSVYLQMTSLRAEDTARYYCVRR
Chrysemys picta bellii V18 ighv AHGY02093732.1 13991 ARSQVALTQSGPALKKPRESHKLQCATSGFTLSSTWMSWVRQEPGKGLEWLAYYYGESNTKHYASSVQGRFTASKDSTNFYLQMTSLRAEDTAVYYCAR
Chrysemys picta bellii V17 ighv AHGY02093732.1 5294 QLRETGPGVVKPGESLTLTCTISGDSVSSTSATWNWIRQPVGKGLEWMGWIYYRSSGWHTEYPSSLQSRVTITQDTSKNQFSLQLRSLTAADTATYYCAR
Chrysemys picta bellii V16 ighv AHGY02093727.1 16622 VRSQVLLVESGGGIQKPGGSLRLSCKASGFTLSSYFMGWVRQAPGKGLEWVSLIYNPAYSLSTFYSDAVKGRFTISRDDSNSLVYLQMNSLKAEDTARYYCAR
Chrysemys picta bellii V15 ighv AHGY02093727.1 12080 VLSEVVLTQSGPEVRKPGEATILKCAVTGADHSTSIMTWIRQAPGKGLEWLVYYYSQASIFYSPAIQGRFTASMDSSSLYLQMYSLKEEDTAVYYCVRLGV
Chrysemys picta bellii V14 trbv AHGY02067856.1 9572 QTDAKIMQTPSLVLERGQTAYLRCEQTYGHDSMFWYRQDPGQGLQLLFNFYYKEEREKGTNSSHFQADQLQDDLFRLNISSVQPEHSAVYFCASSS
Chrysemys picta bellii V13 trbv AHGY02067852.1 5606 IHSATIVQSPQSVVEELGRQISLECSLEGTSNPYIYWYRQLPGGQIYMLAYSVSIGQVDNTGPSHFSTSRTKDKEFLLSINGLLANDTGVYYCAW
Chrysemys picta bellii V12 trbv AHGY02067850.1 5294 QTDAKITQTPSLVLERGQTAYLRCQQTYGHNSMFWYRQDPGQGLQLLFNFYYKEEREKGTNSSHFQADQPQDDLFRLNISSVQPEHSAVYFCASSL
Chrysemys picta bellii V11 trbv AHGY02067847.1 24058 TRSATIVQSPQSVVEQLGRQASLECSLEGTSNPNIYWYRQLPAGQIHMLTYSVSTGEVDNTGLSSHFNASRPKDEEFLLSINGLLANDTGVYYCAWS
Chrysemys picta bellii V10 trbv AHGY02067847.1 9694 HTDAKITQTPSLVLKRGQTAQLTCRQTDSHSYMYWYQQQQGKGLQLIYYSVTVDNKEEGDIKAGFTASRPQINVFDLNITSVKMEHSAEYFCASSL
Chrysemys picta bellii V9 trbv AHGY02067845.1 45119 GRSQTLHQTPRFISLPPGSKVQLDCYLQGYNAEPWMYWYWQPPQGGALHMLFLSRVKGSIDDSLEKHFIAARPAQQNFTLSTDSLFPNDTGLYYCAWS
Chrysemys picta bellii V8 iglv AHGY02017577.1 16590 SSSQPVLTQPPLVSVSSGNTVKLSCTMSSGTSISDYYVNWYQQKPGNSPRYLLRYKSDSDKGQGSGVPARFSGSKDTASNTGYLTISWTLVEDEADYYCAV
Chrysemys picta bellii V7 iglv AHGY02017577.1 2679 SISQPVLTQPPSVSVSPGNTVKLSCTMSSGTSISDYVVFWYQQKPGNSPRYLLYYYSESVKGQGSGVPARFSGSKDTASNAGYLTISGALAEDEADYYCAV
Chrysemys picta bellii V6 iglv AHGY02017575.1 29827 SLAQYVLTQLPAVSVSLGQNAQLTCTGEKVDKQYVYWVQQKPGRAPVLVIYKDSERPSGIPERFSGASSGKTATLTITGVQAQDEADYHCQSGFKDSS
Chrysemys picta bellii V5 iglv AHGY02017575.1 15688 SSSQPVVTQPPSVSVSPGNTVKLSCTTSSGTSISDYSVYWYQQKPGNTPRYLLYYYTESEKHQGSGVPARFSGSKDTSSNAGYLTISGALVEDDADYYCAV
Chrysemys picta bellii V4 iglv AHGY02017574.1 623 SLAQYVLTQPPAVSVSPGQSAQLTCTGEKFDKYYVHWYQQKPGRAPVLVIYKDSERPSGIPERFSGASSGNTATLTITGVQAQDEADYYCQVWDDDNKT
Chrysemys picta bellii V3 iglv AHGY02017567.1 14604 RADSAALSVCVSRAKCSAHLLREQHWELLCAMVPAETWQRPPTLIYQNSNRPSGIPERFSGANSGNTATLTITGVQAQDEADYYCQVWDSSSAQ
Chrysemys picta bellii V2 iglv AHGY02017567.1 1749 SLAQYVLTQPPSVSVSPGQNAQLTCSGNNIGSKYVHWYQQKPGSAPLRVIYDSSSRASGIPDRFSGASSGNTATLTITGVQAQDEADYYCRVWDSNA
Chrysemys picta bellii V0 iglv AHGY02017560.1 265 SSSQLLLTQPPSVSVSPGNTMKLSCTMSSGTSISGYAVSWYQQKPGNSPQYLLYYYMDTNKGQGSGVPARFSGSKDTASNAGYLTIAGALTKDDADYYCVVWSGSA
Chrysemys picta bellii V60 igkv AHGY02101539.1 325 AKGQIVLTQTPESLAGFLGDKVTINCKASSSVGSYMAWYQQKSGQAPKLLIHSTSTRPSGIPDWFSGSGSGTDFTFTISQVEPDDARNYYCLQSNNFP
Chrysemys picta bellii V59 igkv AHGY02101529.1 3831 ASGQIVLTQTPESLAVFPGDRVTINCKASSSASSWMSWYQQKSGQAPKILIHSASTRPSGVPDRFSGSGSGTDFTFTISRVESDDAGDYYCLQTNSWP
Chrysemys picta bellii V58 trav AHGY02095345.1 2097 ANGESVTQPDDRVTVSQGEPVLLKCIYDYDTSYGTPTLWWYEQHPNEAPRLLLTQYEASDEEARRSRRGFFATPDNQGKTFHLKKSSSELRDSAVYYCAMS
Chrysemys picta bellii V57 trav AHGY02095336.1 4339 SYGADSVTQTEGSVIISQGDPVRLNCTYQFSVPAYPFWYVQFPSQPPRLFLRDLGREDSDEGIRKGFDATHDKQHKSFHLWKPASELSDSGTYYCAAR
Chrysemys picta bellii V56 trav AHGY02095335.1 174 QSNGELVTQTKGSVLISQGESVLVNCTYEAASPSLFWYVQFPSQPPRLFLRDVGWEASDEGTRKGFDATYEKKDKSFHLWKPASELSDSATYYCAAR
Chrysemys picta bellii V55 trav AHGY02095333.1 3247 APGRAKIQQPGSADGLEGGELNLTCSHPSIKTNENVVWYRQFPNQGPQYIVSGFRETTHSTDPEGALHVSGDRKSSALALRRVRLADAAVYYCALS
Chrysemys picta bellii V54 trav AHGY02095323.1 2503 ETHGLSVTQTQGSIPLSEGASLLLDCTYQSSVPVCTFWYVQYPTEAPRLFLRDSEEQDKEGDRKGFKVKHDKNSYPLRKNSTQLSDSAVYCCAMS
Chrysemys picta bellii V53 trav AHGY02095322.1 1376 GVNGESVTQPDDRVTVSQGEPVLVKCTYDTSYGTPTLWWYEQHPNEAPRLLLTQYEASDEEARRSRRGFSATPDNQGKTFHLKKSSSELRDSAVYYCSMSDTVI
Chrysemys picta bellii V52 trav AHGY02095320.1 865 RAKIQQPVSAEALEGAELNLTCSHPSARADNILWYRQFPNRGPEFIVTGFSGTAHSPDPEGTLHISKDKENSTFALRRVRLADSAVYYCARSLEV
Chrysemys picta bellii V51 trav AHGY02095319.1 329 APGRAEIQQPGSAEALEGAELNLTCSQPSTEAGDSTVWYRQIPNPGPQFAVTGYKETVNSPEPAGALHISAEREPSPLALSPVRRGDAAVYFCARR
Chrysemys picta bellii V50 trav AHGY02095318.1 3903 GATGVSVTQTKGPVSVSEGEGLRLNCSYDAAVYAVFWYVHLPSQPPRLLLRDVGRDDSDEGIRKGFDATHDKKDKSFHLWKPSSEQSDSATYYCAASDTV
Chrysemys picta bellii V49 trav AHGY02095313.1 840 SSMEDAVTQTQPAVSGVEHESVSLGCTYETVASSYIFYWYKRPPGESLIFLSWQHSGGEKRNDAGERFFFSLEKSKSSISLRITALELGDTAMYFCAFSRD
Chrysemys picta bellii V48 ighv AHGY02094452.1 4650 VQAQVRFVESGGDVRKPGDSLQLSCRGSGFSFGDHWLSWLRLSPSKGLEWVATISFWAGDTKRYAASVTGRFSISRSNGQNMLYLQMNNLKPEDTGIYFCSQ
Chrysemys picta bellii V47 ighv AHGY02094448.1 5322 VKAQIQLVQSGAEVKKLGESVKMSCKGSGYTFTSYAISWVRQAPGKGLVYIGWTNTNTGEPTYADSFKGKVTMTLDTSLSTAFLQVNSLKAEDTAVYYCAR
Chrysemys picta bellii V46 trav AHGY02094435.1 7764 LTQGQTVIQPVGETKVKEGEFVTLDCSYNSGFPTLLWYRQESGGSPQFILHEGSRHEDLEERFRNRFKAKINKTSRVFPLDISSVQLSDSATYYCALR
Chrysemys picta bellii V45 trav AHGY02094433.1 8596 AALGDSVLSREPEKSRSEGDTVTLSCSYTTSDSYVFLYWYRHYPNQAPQYILYRGAKSYSHLSDTASFAQERFSSQADGGSTVLTIAALELADTAVYLCALRL
Chrysemys picta bellii V44 trav AHGY02094432.1 1894 AALGDSVQSREPHLSGREGDAVTLTCSYDTSSTGYVYLYWYRQFPGQAPQYILFRGVKSASEFSDTAGFAQERFSSQADDSSTVLNFTALELADTAVYLCALSV
Chrysemys picta bellii V43 trav AHGY02094419.1 11384 AALGDSVQSREPHLSGREGDSVTLTCSYDTSSTGYVYLFWYRQFPGRAPQYILFRGVKQARGQSNTAEFAQKRFSSQADDSSTVLNITALELTDTAVYLCALQR
Chrysemys picta bellii V42 trav AHGY02094419.1 8700 AALGDSVHSKDPQVSGIKGDSVTLSCSYTTSYTGSLSLYWYRQYPNQAPQYILQKGAKGSRYQHTASFAQQRFSSQADDSSTVLTIRALELADTAVYLCALQRSQ
Chrysemys picta bellii V41 trav AHGY02094419.1 5861 AVLSDSVQSEETQVSGAEGDAVTLRCSYTTSYTGSVYLHWYRQDPNQGLQYILWRGAQDARAFSDTADFAQERFSSQVDDSSTGLNITALEVADGAVYYCALGL
Chrysemys picta bellii V40 trav AHGY02094418.1 1485 AALGDSVQSNEPEVSGPVGVSVTLSCSYTTSSAYAYLFWYRQYPNQAPQYILWKGAKSASGTSDTADFAQQRFSSQATDSSTVLSITALELADSAVYYCALQRAQ
Chrysemys picta bellii V39 trdv AHGY02094417.1 6512 SVTQAQGQLAKLGGQTVTLECTFSTGYQYFYLFWYRQHRSGAMDFLFQIDESNAQKNGAGRRFSAEFRKSSKFVSLTIKELEPTDSAVYFCALWE
Chrysemys picta bellii V38 trav AHGY02094409.1 11139 LAQSDSVDQFPPEVRVSEGQSVTLHCNFTTLGTNPYLFWYRQYPNRPPQHILTKTKFDAPDQTLVQGKFSASLYMANETVPFKIEAVSHQESAVYYCALR
Chrysemys picta bellii V37 trav AHGY02094409.1 10130 RTCANTIMQPERITTIHEGKPVLLHCTYNSSVVQSLFWYEQCPQEAPRLLLTQYEASDEEEKRRRRGFSATLEKDSKSFHLEKNSSEVRDSVVYYCALR
Chrysemys picta bellii V36 trav AHGY02094409.1 7556 ANGNSVTQTEGSVTICEGEPVLLNCTYETTGYPTLFWYVRYGSQAPRLFLREGSADPEEGNRKDFSAHHKDRTYHLRKLSSQLSDSGVYYCAMS
Chrysemys picta bellii V35 trav AHGY02094409.1 4927 QTYGNSVTQTEGTITVREGKPVLLNCTYKTSRSPVPFWYVQYPHAAPRLLLAAYEATDEEERKRRRGFSAKHERNPISFHLNKNSSEVSDSAVYFCALG
Chrysemys picta bellii V34 trav AHGY02094408.1 5533 TYGDSVSQTEGSIVISQGDPVLLNCSYETSFTAFPFWYVQYPSDSPTPRLFLRDTEREKGDLGIVKGFNATHDEQKKSFHLWKPSSELSDSGTYYCAASDTV
Chrysemys picta bellii V33 trav AHGY02094406.1 987 SCCEAQVDQSPQSLVTGEGKVSTMSCAFTSKYQTFHWYQQLPGQGLTHLLAVSPQGNTTEQRFVGQPLEDGKRSSLHITDSQLGDSGSYLCAVDAQ
Chrysemys picta bellii V32 trav AHGY02094395.1 996 FVQGDSVFQSLPEVTVSEGHDVLLPCNFTTISNTPNLFWYRQYPNHPPQHILTAYKSAAEKNTFTAGKFSTVLIDDNKTVPLKIGAVSLQDRAVYYCALR
Chrysemys picta bellii V31 trav AHGY02094391.1 5836 LAQSDSVDQSPPEVRVSEGQSVTLHCNFTTADSSPYLFWYRQFPNRPPQHILTKTKFDAPDQTLVQGKFSASLYMANKTVPFKIEAVSHQESAVYYCALR
Chrysemys picta bellii V29 trav AHGY02094389.1 13527 ALGRAEIQQPVSAEAVEGEKLTLSCNHPNVTTEKIMWYRHVPSQAPRLLAGGFRGETPGTEAGGTLYIAQDKASSVFEFRRVRLADAAVYYCALS
Chrysemys picta bellii V28 trav AHGY02094389.1 10928 DSVTQTDGSVFISQGDPVLLNCTYQISGFPYLFWYVQFPNQPPRLFLRDPGREDSDEGIIKGFDAIHDKEQKSFQLWKLSSEVSDSATYYCAGT
Chrysemys picta bellii V27 trav AHGY02094389.1 2714 QSNGEPVTQTKGSVLISQGESVVVNCTYEAVSPYLFWYVQFPSQPPRLFLRDLGRENSDEGIRKGFDATHDKNHKSFHLWKPSSELSDSATYYCALRDTV
Chrysemys picta bellii V26 trav AHGY02094386.1 543 APGRAKIQQPVSAEGLEGAELNLTCSHPSASTDNIFWYRQFPNRGPEFIVTGFSGTAHSPDPEGTLHISKDKENSTFALRRVRLADAAVYYCARR
Chrysemys picta bellii V25 ighv AHGY02093768.1 17093 ARSQVVLTQSGPEVKKPGESTQLKCAVSGFVPNDRWMDWVRQLPGKGLEWLVHYRQSSVTNYYSPSIQGRFTASKDSSNFYLQMTSLKAEDTAVYYCAR
Chrysemys picta bellii V24 ighv AHGY02093767.1 1276 ALSEVKLVQSSPGTVKPSESLHLTCTTSGFSIASSGYTCHWIRRTPGKGLEWLGYINMYYSTSGSIPPLQSRISITQDPSKNELYLRLRSLTAADTAAYYCA
Chrysemys picta bellii V98 trav AHGY02109992.1 1208 SALGDSVKSNEPEVSGSVGGSVTLSCSYTTTDSYVYLYWYRLYPNQAPQYILYRGAKSYSGQSHTANFAQQRFSSQADDSSTVLNITALELADSAVYYCALQR
Chrysemys picta bellii V97 trav AHGY02109991.1 3866 FVQGDSVFQSPLEVTVSEGHDVLLHCNFTTTSSGPYLFWYRQYPNQPPQHILTAYKSPAEKNTFTSGKFSTVLFDHNKTVPLKIEAVSLQDRAVYYCALR
Chrysemys picta bellii V96 trav AHGY02109988.1 248 ANGESVTQPDDRVTVSQGEPVLLKCTYDNTPIPTLWWYEQHPNEAPRLLLTQYEALDEEDRKSRRGFSATPEKQESFHLKKNSSELSDSAVYYCGMSDTVI
Chrysemys picta bellii V95 trav AHGY02109982.1 3024 SCCEAQVDQSPESLVTGEGKVSTMSCSFTSAFKIFQWYQQLPGQGPTHLLTASSNENVTVGRFIGERLESGKRSSLHITDSQLGDSGPYLCAVDAQ
Chrysemys picta bellii V94 ighv AHGY02108394.1 5963 QLVESGGDVKRPGDSLRLSCKASGFTLSSNWMHWVRQAPGKGLEWIARIHGSSINYSDSVKGRFTISRDDSKSELYLQMTGLKPEDTARYHCAK
Chrysemys picta bellii V93 ighv AHGY02108394.1 1355 ARSQIVLTQSGPEMKKPGESTQLKCAVSGFTVSGYYMAWFRQEPGKELEWLVSYYTPSSTNYYSDSIKGRFTASKDSSNFYLQMTSLKAEDTAMYYCAR
Chrysemys picta bellii V92 ighv AHGY02108390.1 5953 CGAAVTLTQPSSAQAEPGSSLSLDCVVSGYNINDHHLSWIRQAPGKGPVWLAAFRTGYTTYITDEFKGRVTPRTSGATARLNINSLTAADTATYYCARN
Chrysemys picta bellii V91 trav AHGY02107856.1 1363 KCFLCHKISQSPSVLTVKMGNKTTLCCNYDTPQMDPGLYWYRLVSNKALQLILYRDNSRSFDAHFVKERFSVRHDHARKAFHLLISAVLSEDSASYYCAMR
Chrysemys picta bellii V90 iglv AHGY02107681.1 4355 SLAQFVLTQPPSVSASPGQTVTISCTRSSGSISANYNSWYQQSPGRAPVLIIYEDSKRPSGIPSRFSGASDSSANAATLTISGVQADDEADYYCSAG
Chrysemys picta bellii V89 trgv AHGY02107677.1 1160 WSSQSALNQTSSVAVKPGETAELHCTLQGVEYISKSNPSWYQQRSGMVPRLLIYKSRSRASGIPERFSGETNGNRASLTITGAQAEDDADYYCAVWTGSA
Chrysemys picta bellii V88 trav AHGY02107324.1 9722 AALGDSVQSREPEVSKSEGNTVSLSCSYDTSSSNVYLYWYRQYPHQAPQYILWRGAKSYRDLSDTAGFAQERFSSQANDSSTVLNITALELADTAVYLCALRLAQ
Chrysemys picta bellii V87 trav AHGY02107324.1 5891 AALGDSVQSREPHFSGREGDAVTLTCSYDTSSTGYVYLYWYRQFPNQAPQYILFRGVKQARDESNTADFAQKRFSSQADDSSTVLSIKALELADTAVYLCALDV
Chrysemys picta bellii V86 trav AHGY02107321.1 1496 SIYGADSVTQTQGSVTISQGEPVRLNCTYQFSVTPYPLWYVQFPSQALTLFLRDVGRDESDEGIRKGFDATHDKKHKSFHLWKPSSDMSDSGTYYCAAS
Chrysemys picta bellii V85 trav AHGY02107316.1 847 SSMEDAVTQTQPAVSGVERESVSLDCTYETAASSYYLYWYKQPPGESLNFLFRQYSGGTKRNEAGERFSVNLEKSKSSVSLRITALEFGDAAMYFCAFSR
Chrysemys picta bellii V84 iglv AHGY02106922.1 2910 SSSQTVVTQPPSVSVSPGNTVKLSCALSSGTSIGDYYVSWYQQKSGNSPRYLLYYYTDSSKGQGSGVPARFSGSKDTSSNAGYLTISGALAEDEADYYCSVIKS
Chrysemys picta bellii V83 iglv AHGY02106919.1 1937 QYVLTQPPSVSVSPGQNAKLTCSGNNIGSNIVHWYQQKPGSAPVLVIYSDSNRPSGIPDRFSGANSGNTATLTITGVQAQDEADYYCQVYDSNA
Chrysemys picta bellii V82 ighv AHGY02106699.1 9815 FVASGGEVKMLRDSLRIACKTSGFSFGDYRMTWYRITPGKGLEWGSTISYWARNKKNYAASVKGRFTVSRDNPNILLYLHLTNLRPEDASEYYCMLDTI
Chrysemys picta bellii V80 iglv AHGY02105958.1 1866 CYAQVTQPPSEFVSPGGNVQLPCTLEGSYTVSANRVIWIQQRPGSVPRYLMYFYTESNKGLGSGVPSRFAGSRSGSDKIGYLTITGAQAEDDAVYYCVTWTGSA
Chrysemys picta bellii V79 trav AHGY02104137.1 2825 SVAGNSLTQIPASLQGTEGQRVEIRCQYSTSYTSYALDWYQELPGKQPRFLVGKFSYDLERKSDSVAPRFSAQLDKGAKSLTLSIDGAQRADSAVYFCALWD
Chrysemys picta bellii V78 ighv AHGY02104131.1 1594 VQSEVQLVQSGAEIKKPGESVKISCKTSGFTLTDYYMSWIRQTPGKGLVWLGRIDPEDGATSYADSVKDSVTISTDNSISTVYLQLRSLRTEDTAVYYCAR
Chrysemys picta bellii V77 trdv AHGY02104126.1 1842 SVAGNSLTQIPASLPATEGQRVEIRCQYSTSYTSYTLDWYQELPGKQPLFLMRRYSGGSERKSGSVAPRFSSQLDKGVKSFKLTVDGAQRADSAVYFCALWD
Chrysemys picta bellii V76 ighv AHGY02103890.1 2374 VQSQVQLVESGGDVKKPGDSLRLSCKASGFTFSSYYMSWVRQAPGKGLEWVAYLNSAGGDIQYLGSVKGRFTISRDNSKSEPYLQMTGLKPEDTARYYCAR
Chrysemys picta bellii V75 ighv AHGY02102687.1 20966 ILSQVQLVPSGPGAVKPGETLALTCAVSGVSITESSYAWDWVRQPPRKGLEWVASIYPPDGGKWFATSLQSRTTISSDTSKNQFSLQLASLTAADTAMYYCVRDT
Chrysemys picta bellii V74 ighv AHGY02102687.1 15785 PILGFTMTQSGLGEVTVSGSLSLTCAVSDSALSTGGDWWHWLRQPPGKGLVWLALIDRYGNTHYLPDIQNRTTITVNPSKDEFYLRVDSLSPQDTATYYCAR
Chrysemys picta bellii V73 ighv AHGY02102686.1 31172 LVESGGDVKKPGDSLRLSCKASGFTFSSYYMNWVRQAPGKGLEWVADIYTGGSSTAYLDSVKGRFTISRDDSKSELYLQMTGLKPEDTARYYCAAG
Chrysemys picta bellii V72 ighv AHGY02102686.1 21669 VSSQVTLVQSGQGLLKPSESLKLTCTVSGVSITDGCCWWHWIRQRPGRAWEWLGLIKNDGSVVYSQSFQSRLTVSRDTAKNAYYLQISSMTNEDTATYYCMR
Chrysemys picta bellii V71 ighv AHGY02102686.1 19690 VKAQIQLVQSGAEVKKPGGSVKVSCKGSGYTFTSYGTSWVQQIPGKGLFDIGWISTDTGAPAYRENLKGKVTMTLDKPLSTACLLVSSLRAEDTAVYCCARD
Chrysemys picta bellii V70 ighv AHGY02102686.1 16421 VWSQIQLIQSGAEVKKPGDSAKLSCKVSGYTYTSYGMHWARRAPGEGLEWVSSITHGAGDTTYYTDSVKGRFTISRDNTQNLLFLQMTGLKPEDTAVYYCARWG
Chrysemys picta bellii V69 ighv AHGY02102686.1 12521 VRSQIQFVQSGAEMKKPGESIKLTCKASGYTFTDYSMSWVRQAPGKGLEWVATIRTDNFNTFYPETLKGRTTISVDTSISTTYLQMNSLKSEDSAVYYCA
Chrysemys picta bellii V68 ighv AHGY02102686.1 10131 VRSQIQFVQSGAEIKKPGESMKLTCKASGYTFNEYRMNWVRQAPGKGLEWVASIRTDTFETSYPQNLKGRVTISVDVPRSTAYLQMNGLKSEDTAVYYCAR
Chrysemys picta bellii V67 igkv AHGY02101558.1 105 SSGDIVVTQTPESLAVSPGEKVTINCKASSSLTYEGKEYLAWYQQKSGEKPKRLIYLASTRPSGIPDRFSGSGSGTDFTLTISRVEADDAGDYYCQQYRSYP
Chrysemys picta bellii V66 igkv AHGY02101555.1 1046 SNGQIVMTQTPESLAVSPGDTVTIRCKASSSLTSGSYHYLAWYQQKSGQAPKLLIYAGSSLQSGVPARFSGSGSGTDFTLTISKVEAEDAGDYYCQQYSS
Chrysemys picta bellii V65 igkv AHGY02101552.1 304 SSGQIVLTQTPESLAVSPGDTVTIRCKASSSVTSGSTHYLAWHQQKSGQAPKLLIYAGSSLQSGVPARFSGSGSGTDFTLTISKVEAEDAGDYYCQQYHSSP
Chrysemys picta bellii V64 igkv AHGY02101549.1 7178 SSGQIVLTQTPESLAVFPGDRVSINCKASSNLTSSSSGKELLSWHQQKLGQAPKRLIYYADTLQSGVPARFSGSRSGSDYTLTISSVEAEDAGDYYCQ
Chrysemys picta bellii V63 igkv AHGY02101547.1 5614 SSGQIVLTQTPESLAVSPGDTVTIRCKASSSVSIGSTHFLAWYQQKSGQAPKLLIYAGSSLQSGVPDRFSGSGSGTDFTLTISKVEAEDAGDYYCQQSLSSP
Chrysemys picta bellii V62 igkv AHGY02101542.1 4035 SSGDIVMTQTPESLAVSPGDTVTIRCKASSSLTGGSNHYLAWYQQKSGQAPKLLIYLASTLQSGVPARFSGSGSGTDYTLTINKVEAEDAAVYYCQQTYDTP
Chrysemys picta bellii V135 ighv AHGY02131956.1 266 AWSQSLVESGGDVKKPGDSLRLSCKASGFTFSTYGMSWVRQAPAKGLEWVAYIYSSSIHYSDSVKGRFTISRDNPNSLLYLQMNSLKPEDTARYYCTG
Chrysemys picta bellii V134 iglv AHGY02130988.1 1289 VSSQPVVTQEPSMSVTPGGAVTLSCSLSPGAITTGSYPAWFQQKPGSALRQLIYETNKRPSGIPARFSGSISGNNAALTITGVQAEDEADYYCVVYTGSSSNT
Chrysemys picta bellii V133 iglv AHGY02130441.1 1263 VSSQPVVTQEPSMSVTPGGAVTLSCSLSPGAITTGSYPAWFQQKPGSAPRTLIYNTNTRPSGIPARFSGSISGNNAALTITGVQAEDEADYYCILWTGSV
Chrysemys picta bellii V132 iglv AHGY02120812.1 1269 SSYQFTLTQPLSMSVTPGESVQLACVLSSGDSISSRYIYWYQQKQGEKPRYLLYYKDDSTQGKGSGVPDRFTASKDTSRNTCFLTISRAQVEDEADYYCSDWD
Chrysemys picta bellii V131 trgv AHGY02120753.1 380 FVASGREVKMLRDSLQISCKTSGFSSGDYRMTWYGNTPGKALEWVSTISYWARDTKHYAASVKGRFTISRDNPNNLLYLHRTNLRPEDAAEYYCGWTQCAE
Chrysemys picta bellii V130 iglv AHGY02120668.1 4532 VSSQPVVTQEPSMSVTPGGAVTLSCSLSTGAITTSNYPAWYQQKPGSAPRLLIYNTNNRPSGIPARFSGSISGNNAALTITGVQAEDEADYYCAVYIGSSSSW
Chrysemys picta bellii V129 trav AHGY02119744.1 942 SIYGADSVTQTEGSVTISQGEPVRLNCTYQFSVTPYPLWYVQFPSQALTLFLRDVGREDSDERIRKGFDATHDKKNKYFHLWKPSSELSDSGTYYCAASSTV
Chrysemys picta bellii V128 igkv AHGY02119399.1 773 STGQKVLTQTPESLSVSPRDTVTIKCRASESVSSYLAWYQQKSGQAPKLLIYGATTRPSGIPDRFTGSGSGTYFTLTISRVEAEDAGDYYCQQGYIP
Chrysemys picta bellii V127 iglv AHGY02118998.1 633 SSYQFTLTQPLSMSVTPGETGKLACVLSSGDSISSRYIYWYQQKQGEKPRYLLYYKDDSTQGKGSGVPDRFTASKDTSRNTCFLTISRAEAEDDADYYCTGWD
Chrysemys picta bellii V126 ighv AHGY02118520.1 1529 VLSQVQLVQTGPGTVKPGETLSITCKVSGVSVSDYYWSWVRQPPGKGLEWMGRIQSTADGGNTAYNSAFSSRITITRDTSKDEVYLQLRSLTAADTSTYYCAR
Chrysemys picta bellii V125 ighv AHGY02118519.1 1528 VLSQVQLVESGPGVVKPRQTLTLTCAVSGVSITSSSYVWNWVRQPPGKGLEWVARIYPHDGRKWFVVSLQSWTPISSDTSKNQFSLQLASLAAADTATCYCA
Chrysemys picta bellii V124 trgv AHGY02118446.1 3507 SEPLTLTCAVSGFSINTQYYYCYWLRQPPGEGLESMGWVYPYTGGTRYAPSLQGRVTISADTAKNQFSLQLRSLTATDTATYYCAWRDTV
Chrysemys picta bellii V123 ighv AHGY02116891.1 1383 VLSQVQLVQSGPGAVKPRETLSITCKISGVSISSYHWSWARQPAGKGLQWMGIIRSSAAGGTTEYNSDFKPCVTMTRDTLKDEVYLQLGSLTAADTGTYYCARYTV
Chrysemys picta bellii V122 trdv AHGY02116648.1 2041 SVAGNSLTQIPASLPATEGERVEIRCQYSTSYTSYALDWYQELPGKQPLFLLGRYSGGSERKSSSVAPRFSSQLDKGAKSFKLTVDGAQRADSAVYFCALWD
Chrysemys picta bellii V121 ighv AHGY02116212.1 472 AWAQVVLTQSSPEIKKPGESTKLTCAVSGFALSSTSMYWIRQAPGKGLEWLIYYYSSSSNSYSPTIQGRFTASKDSSNFYLHMTSLRAEDTAVYYCAR
Chrysemys picta bellii V120 ighv AHGY02115899.1 8274 ARSQIVLTQSGPEMKKPGESTQLKCAVSGFTVSDYYMAWVRQEPGKELEWLVSYHTPSSTNYYSDSIQGRFTASKDSSNFYLQMTSLKAEDTAVYYCAR
Chrysemys picta bellii V119 ighv AHGY02115752.1 2373 PILGFTMTQSGLGEVTVSGSLSLTCAVSDSALSTGGDWWHWLRQPPGKGLVWLALIDRYGNTRYLPDIQNRTTITVNPSKDEFYLRVDSLSPQDTATYYCAR
Chrysemys picta bellii V118 ighv AHGY02115751.1 4297 VRSQVKLLQTRAAQVKPSQTLRLTCSVSGFSLTSSGNRVSWIRQPPGKSLEWLCLVDWEDDKYYQESLKNQLTICRDTSKSEGYLEMRGMEAGDSGTYYCTT
Chrysemys picta bellii V117 ighv AHGY02115383.1 900 VLCQVKLVQSGPGAVKPGETLTLSCAVSGVSITTQHYYWSWIRQFPGKGLEWMGYVYPYSSGSTSYAPSLQGRITISADTAKSQFSLQLRSLTAADTATYYCAG
Chrysemys picta bellii V116 trgv AHGY02115353.1 1468 GEAQVLVQSQLSITRAENKTARIDCHVSGITLSSAYIHWYRQRPDAALERILYFLSGKPDFDRDSEKAKFEAEKQLSESICVLTVKKISKNDAATYYCAAW
Chrysemys picta bellii V115 trav AHGY02115135.1 7904 AALGDSVQSREPHLSGREGDAVTLTCSYDTSSTGYVYLYWYRQFPGQAPQYILYRGAKFASELSDTAGFAQERFSSQADDSSTALNITALELTDTAVYLCALRL
Chrysemys picta bellii V114 ighv AHGY02114768.1 500 VLSQLQLVQSGPGAVKPGETLTLTCAVSGFSVSSSSYAWHWIWQPPGKGLEWMGYVYPYNSGETGYTPSLQARITISADTAKNQFSLQLRSLTAADTATYYCARDTV
Chrysemys picta bellii V113 trav AHGY02114485.1 2539 FVQGDSVFQSPLEVTVSEGHDVLLQCNFTTDFTSPNLFWYRQYPNQPPQHILTAYKSPAEKNTFTSGKFSTVLFDANKTVLLKIEAVSLQDRAVYHCALR
Chrysemys picta bellii V112 trav AHGY02113584.1 10709 QSNGEPVTQTKGSVLISQGESVVVNCTYEAVSPSLFWYVQFPSQPPRLFLRDLGRENSEEGIRKGFDATHDKQHKSFHLRKPSSELSDSATYYCALSDTV
Chrysemys picta bellii V111 igkv AHGY02113084.1 227 SSGQIVLTQTPESLSVSPGERVTINCKAGTSISNYLGWYQQKPGQAPKLLISDSTNRVSGIPDRFSGSGSGTDFTLTISSVEAEDAGDYYCQQRQSYP
Chrysemys picta bellii V110 igkv AHGY02113080.1 655 SSGQIVMTQTPESLSVSVGETATIKCKASTSISNEIAWYQQKPGQAPKLLIYYASSRPTGIPDRFSGSGSGTDFTFTISRVESDDAGDYYCQQHY
Chrysemys picta bellii V109 ighv AHGY02112775.1 4586 VLSQVQLVQSGPGAAKPGETLTLTCAVSGVSISAQNSVWHWNRQPPRKGMEWMGYVYPYNGVTGYASSLQGRATISGDTSKNQVSLQLRSLTAADTATYYCTRE
Chrysemys picta bellii V108 ighv AHGY02112426.1 6042 ARSQVVLTQSGPALKKPGESHKLQCATSGFTFSSTWMGWVSQEPGKGLEWLTLYYSEGSKYYASSVQGRFTASKDSTNFYLQMTSLRAEDTAVYYCAR
Chrysemys picta bellii V107 ighv AHGY02112426.1 3643 GIQTPGGSLRLSCKASGFTFSSYWMDWVCQAPGKGLEWVAEILEPVNNLAAYYSDAVKGRFTISRDESSSSVYLQMNSLKAEDTARYYCAR
Chrysemys picta bellii V105 trdv AHGY02111976.1 110 SVAGNSLTQIPASLSATEGERVEIRCQYSTSYSNYALDWYQELPGKQPLFLLRRYSDGSEHKSDSLARRFSSQLDTGAKSFKLTIDGAQRADSAVYFCALWD
Chrysemys picta bellii V104 iglv AHGY02111653.1 1593 SGAQHVVTQPPSMSGSPGQTVKLSCSVSGGYSISSYGIGWYQQTPGNPPRYLLYYLSDSNTGRGTGVPDRFSGSASGSVGYLTISGLQAEDDADYYCLTWDNSAKM
Chrysemys picta bellii V103 igkv AHGY02110644.1 5598 VSSQAVVTQEPSVFITPGGAVTLSCSLSTGAITTSNYPSWYQQKPGSAPRMLIYETSKRPSGIPARFSGSISSNDAALTITGGQVEDDAVYYCAVYTGSSD
Chrysemys picta bellii V102 iglv AHGY02110352.1 3713 VSSQPVVTQEPSMSVTPGGAVTLSCSLSTGAITSSNYPSWYQQKPGSAPQMLIYNTNSRPSGIPDRFSGSISGNNAALTITGVQAEDEADYYCAVWASSV
Chrysemys picta bellii V101 iglv AHGY02110352.1 769 SLSQYTLTQPPAESVSIGNTVKLSCALSGGYTFVSVVWYQQKNGNIPRYLLSYKTDSDKHQGSGVPSRFSGSKDASNTTGYLTITSVQAEDEADYYCTAGT
Chrysemys picta bellii V100 igkv AHGY02110153.1 485 SSGQIVMTQTPESLSVSVGETVTIKCKASTSISNYIAWYQQKPGQVPKLLIYYASTRPTGIPDWFSGSGSGTDFTFTISRVEADDAGDYYCQQRNSYPLIQ
Chrysemys picta bellii V173 igkv AHGY02214928.1 2951 SSGQILLTQTPESLAVSLGDRVTINCKASTSIVSAIAWYQQKTGQAPKLLIYNASTRPSGIPDRFSGSGSGTDFTFTISRVEAEDAGDYYCQQGFPP
Chrysemys picta bellii V172 igkv AHGY02214927.1 6911 SSGQIVMTQTPESLTVSPGASVTINCKSSSSIGNAVAWYQQKSGQAPKLLVYGPSTRPAGIPDRFSGTGNGNTDYSLTIRSVEVDDTGDYYCQQYTSYP
Chrysemys picta bellii V171 igkv AHGY02214927.1 541 SSGQMVMTQTPESLAVSPGDRVAINCKASSNTNNHVAWYQQKAGQAPKLLIYAAFPRYTGVPDRFSGSSAVSGTDYTLTISSVEAEDAGDYYCQ
Chrysemys picta bellii V170 igkv AHGY02214918.1 613 SYGQVTMTQSPEFLSVSPGEKVTIRCTASSSLDRDYVSWYQQKSGQAPKLLIYRASTLASGVPARFSGSGSGTDYTLSISSVEANDAADYYCFQRDSSP
Chrysemys picta bellii V169 igkv AHGY02214915.1 495 SSGQIVLTQTPESLVVSPGDRVTINCKASSSVSYMAWYQQKSGQAPKLLIYNASNRPSGIPDRFSGSGSGKDFTFTISRVEADDAGDYYCQQYTS
Chrysemys picta bellii V168 igkv AHGY02214912.1 13525 SYGQVTMTQSPESLSVTPGEKITIRCTASSRLGSSTVSWYQEKPRKAPKLHIYGDTDSASGVPARFSGSQSGTIYTLTISSIKADDAADYYCLQSQS
Chrysemys picta bellii V166 igkv AHGY02214908.1 9564 SYGQVTMTQSPESLSVSLGQKVTIRCTASSSRDSHYVSWYQQKPGQAPKLLIYWGSTLESGVPARFSSSESGTEYTLTISSVEADDAADYYCLQTES
Chrysemys picta bellii V165 igkv AHGY02214908.1 1402 SSGQMVMTQTPESLAVSPGDRVAINCKASSSTGNYVAWYQQKSGQAPKLLIHSASTRPSGIPDRFSGSGSGSGYTDYTLTISSVEAEDAGDYYCQQGNSSP
Chrysemys picta bellii V164 igkv AHGY02214907.1 272 SIGQIVLTQTPESLSVSPGDTVTIRCKASSSLTSSSSGKDLLAWHQQKSGQAPKLLIYHATTLQSGVPARFRGSGSGTDFTLTISRVEAEDAGDYYCQQEYIP
Chrysemys picta bellii V163 igkv AHGY02214904.1 5061 SSGQIVMTQTPESLSVSVGETVTIKCQASSSIGTYAHWYQQKSGQSPKLLIYSASSRPSGIPARFSGSGSGTDFTLTISGVEADDAGDYYCQQSGYSAP
Chrysemys picta bellii V162 igkv AHGY02214904.1 2677 SCGQTVLTQTPESLAVSPGQRVTISCKASTSISNNLDWYQQKPGQAPKLLIYDSTNRVSGTPARFSGSGSGADFTLTISSVEVQDAGDYYCQQRNSYP
Chrysemys picta bellii V161 igkv AHGY02214903.1 1762 SYGQIVLTQTPESLSVSLGQRVTINCKAGTSISNYLGWYQQKPGQAPKLLISDSTNRVSGIPDRFSGSGSGTDFTLTISSVEAEDAGDYYCQQRQSF
Chrysemys picta bellii V160 igkv AHGY02214901.1 3304 SSGQIVMTQTPESLAVSVGETVTIKCKASTSISNNVAWYQQKSGQAPKLLIYYASNRPTGIPDRFSGSGSGTDFTFTISRVEADDAGDYYCQKHYSTP
Chrysemys picta bellii V159 igkv AHGY02195040.1 854 SSGQIVLTQTPESLAVSPGDRVTINCKASSSVGGAIAWYQQKSGQAPKLLIYGASTRPSGIPDRFSSSGSGTDFTFTISRVEADDAGDYYCQQRSSIP
Chrysemys picta bellii V158 igkv AHGY02194903.1 1259 SSGQIVLTQTPESLAVFPGDRVTINCKASSSVNEWVAWYQQKSGQAPKLLIYSALHRPPGIPDRFSGSELGTGYTLTISRVEADDAGDYYCQYHYSSP
Chrysemys picta bellii V157 trav AHGY02193026.1 880 AVLGDSVQPREPQMSGAEGGSVTLSCSYESSYTAGVYLYWYRQFPNRAPQYILRRGTKEVRSGSVTADFAQKRFSSQADGNSTALSIAALELADTTVYLCALQR
Chrysemys picta bellii V156 igkv AHGY02186647.1 1896 SNGQIVMTQTPESLAVSPGDTVTIRCKASSSLTSGSYHYLAWYQQKSGQAPKLLIYRASTLQSGVPARFSGSGSGTDYTLTISKVEAEDAGDYYCQQYRSDP
Chrysemys picta bellii V155 trdv AHGY02182516.1 871 LSQGQGSVTQTQGQLAKLGGQTVTLECTFSTGYQNYYLFWYRQHRSGAMDFLFRISQSNAQKNGAGRRFSAEFRKSSKFVSLTIKELEPTDSALYFCALRE
Chrysemys picta bellii V154 ighv AHGY02181359.1 102 VLSQVQLIQSGPGAVKPRETLSITCKFSGVSISSYHWSWARQPAGKGLQWMGIIRSSAAGGTTEYNLVFKPCVTMTRDTLKDEVYLQLGSLTAADTGTYYCAR
Chrysemys picta bellii V153 iglv AHGY02180391.1 2312 VSSQPVVTQEPSMSVTPGGAVTLSCSLSSGAITTSNAPGWFQQKPGSAPRTLIYSTNSRPSGIPARFSGSISGNNAALTITGVQAVDEADYYCIVWTGSV
Chrysemys picta bellii V152 ighv AHGY02176681.1 1945 VLSQVQLVQTGPGAVKPGATLSITCKVSGLSVSSYYWGWARQPPGKGLEWMGRIQSTADGGNTAYNSAFSSRITITRDTSKDEVYLQLRSLTAADTGTYYCA
Chrysemys picta bellii V151 igkv AHGY02173320.1 212 SSGQTVMTQSPESLAVPVGGRVSINCKASTSISNYLHWYQQKPGQAPKLLIAYASTLQSGVPARFSGSGSGSDFTFTISSVEAEDAGDYYCQQSNSWP
Chrysemys picta bellii V150 trav AHGY02164384.1 286 ASGQLSVEQSPEWRGVSEGQNVTVTCTYSEVITSLHWYRQAPGERPLFLLMLHGKGSETQEPNFTADHDPGQKRSSLHIRGCRLGDTARYLCAVE
Chrysemys picta bellii V149 trav AHGY02157176.1 99 VDTKVSQPAALSFLAGGRADLPCNHSVAGYDKIIWYYQSPGAAPRAVISGYNSAETSGRFELSIDPSSRSAPLRITEVAVQDSGVYYCAVR
Chrysemys picta bellii V148 trav AHGY02150474.1 433 SCYEAQVDQSPEWLITGEGEVSTMSCSFTSTYRTFQWYQQLPGQGPTHLLTVTSNENVTLGRFIGERLESGKRSSLHITDSQLGDSGSYLCAVDAQ
Chrysemys picta bellii V147 iglv AHGY02149499.1 540 SSYQFTLTQPLSMSVTPGESVQLACVLSSGVSISGSYIRWYQQKQGEKPRYLLYYKDDSTQGKGSGVPDRFTASKDTSRNTCFLTISRAEVEDDADYYCLDWD
Chrysemys picta bellii V146 ighv AHGY02148077.1 343 ARSQVVLTQSGPALKKPRESHTLQCATSGFTLRSTWMDWVRQELGKGLEWLVSYYDPSYKSYTSSVQGRFTASKDSTNFYLQMTSLRAEDTAVYYCAS
Chrysemys picta bellii V145 ighv AHGY02148039.1 251 ARSQVALTQSGPALKKPGESHTLQCATSGFTLSSTWMDWVRQELGKGLEWLVSYYDPSYKSYASSVQGRFTASKDSTNFYLQMTSLRAEDTAVYYCAR
Chrysemys picta bellii V144 trav AHGY02146502.1 487 SSMEDAVTQTQPAVSGVERESVSLDCTYETAASSYYLYWYKQPSGESLNFLFQQYSGGTKRNEAGERFSVSLEKSKSSVSLRITALEFGDAAMYFCAFSR
Chrysemys picta bellii V143 trav AHGY02145703.1 165 VDTKVSQPAALSFLAGGGADLPCNHSVAGYDKIIWYYQSPGSAPRAVISGYNSAETSGRFELSIDSPSRSAPLRITRVAVQDSGVYYCAVR
Chrysemys picta bellii V142 trav AHGY02143674.1 533 APGRAEIRQPRSAEALAGAELNLTCSHGSLTTETIFWYRQFASRGPQYIVSGYQGIVNSIDPEGALHIPEDRKSSTLSLRRARLADAAVYYCALR
Chrysemys picta bellii V141 trav AHGY02141754.1 571 GIYGADSVTQTEGTIMISQWDPVRLNCTYQFSASVTVYPFWYVQFPNQPPRLLLRDLGREASDEGIRKGFDATHDKKNKSFHLWKPSSELSDSATYYCAARDTV
Chrysemys picta bellii V140 ighv AHGY02141196.1 455 VLSTTQLVQSGPGAVKPGDTLTLTCAVSGTSISSDTAWHWIRQPPGTGLEWMGRVYPYGGSTGYNSSLQGRTTISADTAKNQFSLQLRSLTAADTATYYCA
Chrysemys picta bellii V139 trav AHGY02139651.1 654 ASGQLSVEQSPEWRGVSEGQNVTVTCTYSSAIQSLHWYRQAPGERPLFLLMLHGKGSETQEPNFTADHDPGQKRSSLHIRGCRLGDTARYLCAVE
Chrysemys picta bellii V138 igkv AHGY02134728.1 410 SYGQITMTQSPESLSVTPGEKVTIRCTGSSSLDSDYVSWYQQKSGQAPKLLIYQASTLESGVPARFSGSGSGTVYTLSISSVEADDAADYYCLQTDSSP
Chrysemys picta bellii V137 ighv AHGY02133472.1 963 VLPATQLVQSGPGVVKPGDTLTLTCAVSGTSISSDTAWHWIRQPPGTGLEWMGWVYPYGGSTGYASSLQGRATISADTAKNQFSLQLRSLTGADTATYYCARQ
Chrysemys picta bellii V210 trgv AHGY02026036.1 5008 GCAQIHLRQTQLSITRANDKTARIDCEALGIQNFGSAVIHWYRHRSGEAPEWILYFKTQSDQLSMDRKKFIVEKTTEKSTCTLRVDKLTYNDMATYYCAYWD
Chrysemys picta bellii V209 trgv AHGY02026035.1 1582 GYAQIHLRQSQLSITRAKDKTARIDCEASGIQDFESAVIHWYRHRPGEAPEWILYFKTQSDQSSIDRKKFRVEKTTEKSTCTLRVDKLTYNDMATYYCAYWD
Chrysemys picta bellii V208 trgv AHGY02026035.1 18243 GYSQITLIQTPLSVTRAVSKSAYMWCRISGENFNFNNDYIHWYRQSPGAAPKRILYIRSELVSTDEGFDSEKFKADNYVSASTSKLTVHRLTSEDAAIYYCATWV
Chrysemys picta bellii V207 trgv AHGY02026031.1 3942 GYSQITLTQTPLSVTRAVSKSAYMWCRISGESFNFNSAYIHWYRQSPGAAPKRILYIQSQSVTTDPGFDGKKFIAENYVSASTCKFTVHQLTSEDAAIYYCATWD
Chrysemys picta bellii V206 trgv AHGY02026029.1 83 GEAQVLVQSQLSITRPEDMTVNLCSSVTGIIFNSAYIHWYRQMQLWNGFSIFHQENRSFDQDSEKAKFEAEKQLSESICVPIVKKLAKSDVAAYYCAAW
Chrysemys picta bellii V205 trgv AHGY02026028.1 6209 GYTQITLIQTPLSVTRAVTKTARMACRISGQGFNLNSAYIHWYRQRPGEAPKRILYIGSGTISKDEGFNSEKFTASNDVSASTANLRVDQLTLEDAATYYCATWD
Chrysemys picta bellii V204 trgv AHGY02026028.1 10589 GAAQVQLTQDQLSITRNLMKTVRIDCKVSGINVGDAYIHWYRQRPGEAPEWILYFKSHAQNEQSNFDKDKFSVDKTTEKSTCTLRVDKLTYNDMATYYCAYWD
Chrysemys picta bellii V191 igkv AHGY02214960.1 1421 SSGQLVLTQTPESLAVSPGDRVTINCKTSSSATSGSTHYMAWYQQKSGEAPKLLIYGASNRATGIPDRFTGSGSGTDFTLTISNVQTEDAGDYYCQQGYTAEV
Chrysemys picta bellii V190 igkv AHGY02214958.1 6806 SSGQIVMTQTPESLAVFPGDRVTINCKASSSVNNYIAWYQQKSGQAPKLLIYSASTRPSGIPDRFSGSGSGTDYTFTISRVEAEDAGDYYCQQGWS
Chrysemys picta bellii V189 igkv AHGY02214956.1 4907 SNGQIVLTQTPESLAVSPGDTVTIRCKASSSVTIGSLHLLGWYQQKSGQAPKPLIYDASTRASGIPDRFTGSGSGTDFTLTISNVQAEDAGDYYCQQYRSSP
Chrysemys picta bellii V188 igkv AHGY02214955.1 6616 SNGQIVLTQTPESLAVSPGDTATIRCKASSSVTLGSLHLLGWYQQKSGQAPKLLIYRASTRPSGIPDRFSGSGSGTDFTLTISNIQAEDAGDYYCQQRYSSP
Chrysemys picta bellii V187 igkv AHGY02214955.1 3433 ASGQIVMTQTPESLAVSPGDRITINCKASSSATNKMSWYQQKSGQAPKLLIYRASTRPSGIPDRFSGSGSGTDFTFTISQVEVDDAGDYYCQQGKSSP
Chrysemys picta bellii V186 igkv AHGY02214954.1 41027 SEGQIVMTQTPEFLAVSPGGRVTINCKASSSVGSYMAWYQQKSGQAPKRLIHSASTRPSGIPDRFSGSGSGTDFTFTISRVEADDAGDYYCQQGQSFP
Chrysemys picta bellii V185 igkv AHGY02214954.1 37148 SNGQIVLTQTPESLAVSPGDTVTIRCKASSSLYSSGFEKLAWYQQKSGQAPKLFIYHASNRDSGIPARFSGSGSGTDFTLTISRVEAEDAGDYYCQQYRSYP
Chrysemys picta bellii V184 igkv AHGY02214954.1 19897 AKGQIVLTQTPESLAVSPGDRVTINCKASSNANRNIQWYHQKSGQAPKLLVYTTSTRPSGVPDQFSGSGSGTDYTFTISRVEADDAGDYYCQQSQSWP
Chrysemys picta bellii V183 igkv AHGY02214954.1 12025 SSGQLVLTQTPESLAVSPGDRVTINCKASTSVGSYMSWYQQKSGQAPKLLIYSASTRPSGIPDRFSGSGSGTDFTFTISRVEVDDAGDYYCQSST
Chrysemys picta bellii V182 igkv AHGY02214954.1 5130 TNAQIVLTQTPESLAVSPGDTVTIRCKASSSLTSGSYQVLAWYQQKPGQAPKMLIYYATSRPSGIPTRFSGSGSGTDFTLTISRVETEDAGDYYCQQGKSLP
Chrysemys picta bellii V181 igkv AHGY02214950.1 1521 SSGQIVLTQTPESLAVSPGDRVTINCKASSSAGGWMAWYQKKSGQSPRLLIHSASTRPSGIPDRFSGSGSGTDYTFTISRVEADDAGDYYCQQHS
Chrysemys picta bellii V180 igkv AHGY02214946.1 1071 SSGQIVLTQTPESLAVSPGDRVTINCKASSSASGWVAWYQQKSGQAPKLLIYLASTRPSGIPDRFSGSGSGTDYTFTISRVEADDAGDYYCQYHYSSP
Chrysemys picta bellii V179 igkv AHGY02214943.1 549 SYGQVTMTQSPEFLSVSPGQKVTIRCTASSSLDSDYVSWYQQKPGQAPKLLINYGSTLASGVPARFSGSGFGTVYTLSISRVEADDAADYYCLQTESSP
Chrysemys picta bellii V178 igkv AHGY02214939.1 319 SYGQIVLTQTPESLSVSPGERVTINCKAGTSISNYLGWFQQKSGQAPKLLIYDSTNRASGIPARFSGSGSGTDFTLTISSVEAEDAGDYYCQQRNSFP
Chrysemys picta bellii V177 igkv AHGY02214937.1 3812 SYGQIVLTQTPESLSVSPGERVTINCKAGTSISNYLAWFQQKSGQAPKLLIYDSTNRASGIPDRFSGSGSGTDFTLTISSIETEDAGDYYCQQRNSFP
Chrysemys picta bellii V176 igkv AHGY02214935.1 6869 SSGQIVMTQTPESLSVSVGETATIKCKASTSINSYIAWYQQKPGQAPKLLIYYASSRPTGIPDRFSGSGSGTDFTFTISRVEADDAGDYYCLQYNNFP
Chrysemys picta bellii V175 igkv AHGY02214935.1 3319 TSGQTVMTQSPESLAVPVGGRVSINCKASTSVGSRVHWYQQKPGQTPKLLIYGASNLQSGVPARFSGSGSGTDFTFTISNIEAEDAGDYYCQQGNSFP
Chrysemys picta bellii V203 trgv AHGY02026028.1 12267 GCAQIHLKQAQLSITRAQDKTARIDCEASGIENFGSAIIHWYRHRPGEAPERILYISSAQPVFDKDSDKKKFNCDKKLNQLISTLTVNGIAPNDGATYYCAYWD
Chrysemys picta bellii V202 trgv AHGY02026028.1 15135 GSSQVRLTQPQLSITREENKTLRIDCHVSLSEDFGKTPIHWYRQRPGAAPERILPISTQLVFDGVSDKGKFNAEKKIGQSTCTLTINKITSSDIATYYCAYW
Chrysemys picta bellii V201 trgv AHGY02026010.1 3292 VLWAIHLEQVPISITKEPHVGTTAEFTCKVSGGLDSTYIHWYRAPTGGAPQRLLYLSFSDSNPRWDASFSNEKLTAYFQSRSICRLMVYKLEKADSGYYYCAAWDY
Chrysemys picta bellii V200 trgv AHGY02026009.1 12877 VLWAIHLEQEQISVTKQPLQGSSAKFTCKVFGGSDSTYIHWYRARAGEAPQRLLYLTLSGSDLKREAGFSSEKLFAYGTQSISNLLVHRLEKTDSGRYYCATWDF
Chrysemys picta bellii V199 trgv AHGY02026005.1 1834 HLTQPQPSITREESNAIRIDCRVSVSGDFDKAYIHWYIQRPNTAPKWILFISTQSVLDRDSDKGKFNNEKTVQLTCTLTINKITSIDIATYYCAYWGV
Chrysemys picta bellii V198 trgv AHGY02026005.1 6028 GEALELIQSQLSITKANDRTARIDCHVSGITLSSAYIHWYRQRPDAALERILYFSSGKPEFDQDSEKGKFEADKQLSKSTCTLTVKKTTKSDSATYYCAAW
Chrysemys picta bellii V197 trgv AHGY02026004.1 3344 GYAQIYLRQAQLSVTRAETKTARIVCEASGIQNFRSAIIHWYRHRPGEAPERILYISAVKVEFDKGFDKKFDCEKKPDQPISTLRVNGINITDSAIYYCAYWD
Chrysemys picta bellii V196 trgv AHGY02026002.1 2326 VLWAIHLEQVPISITKEPQEDSIAEFTCKLSGMSDSTNIHWYRAPTGGAPQRLLYLSYSKPDPSWDAGFSSKKLTAHFQGRSFCKLLVHKLEKADSGHYYCAAWDY
Chrysemys picta bellii V195 trgv AHGY02026000.1 499 VLWAIHLEQEQISVTKQPLQGSSATFTCKVFGGSDSTYIHWYRARAGEAPQRLLYLTLSGSELKREAGFSNDKFVAYARQSTCILMVYKLEETDSGRYFCATWDI
Chrysemys picta bellii V194 trgv AHGY02025996.1 5414 GAAQLTQDQLSITRKEKKTVRIDCKVSGINVGDAYIHWYRQRPGEAPEWILYFKSHAQNEQSNFDKDKFSVDKTTEKSTCTLTVDKLIYNDTATYYCAYW
Chrysemys picta bellii V193 trgv AHGY02025996.1 7003 GYAQIYLRQAQLSLTRAKTKTARINCEASGIQNFRSAVIHWYRHRRGEAPERILYISSAQPVFDKVSNENKFNCEKKPDQPISTLVVNEIAPNDEATYYCAYWD
Chrysemys picta bellii V192 iglv AHGY02017569.1 897 SLAQYVLTQPPAVSVSLGQNAQLTCTGEKVDKQYVHWVQQKPGHAPVLIIYKDSERPSGIPERFSGAISGKTATLTITGVQAQDEADCYCQVWDNES
Chrysemys picta bellii V247 trbv AHGY02067864.1 20197 CSGAQINQPPSLVLEKGHRAQLVCNQTYGHNNMFWYRQDPGQGFQLLFLFVHKQQTDKGNVTDRFQAERPQTELFHLDISPVKPEDSAVYFCASSSDTVLQ
Chrysemys picta bellii V246 trdv AHGY02067859.1 26431 GEQVVLSQVPRWVTQKTETMAKLHCYQNNTDHGWMYWYRQPVAQWGLDLIGVLIKGTPEPTFEEHFRDNRFSMVRDNDRHCTLQIDLLKTRDSALYFCAT
Chrysemys picta bellii V245 trdv AHGY02067859.1 26431 GEQVVLSQVPRWVTQKTETMAKLHCYQNNTDHGWMYWYRQPVAQWGLDLIGVLIKGTPEPTFEEHFRDNRFSMVRDNDRHCTLQIDLLKTRDSALYFCAT
Chrysemys picta bellii V244 ighv AHGY02029168.1 1842 VRSQIQLVPSAPGVVKPGESLTVTCTVSGDSIATRAWWNWVRELPGRGLQWVGRIHFSGSTNYAPDLQTRANIAKDDAKNEFYLQLRSLTAADTATYYCTRWD
Chrysemys picta bellii V243 ighv AHGY02029167.1 11686 VLSQVQLVESGPGVVKPGETLTLTCAVSGFSISSSGYSWDWVRQPPGKGLEWMGYVYPQAGTTGSAPSLQGRITISADTAKNQFSLQLRSLTAADTATYYCSR
Chrysemys picta bellii V242 ighv AHGY02029167.1 14785 VLCQVQLVQSGPGTAKPGETLTLTCAVSGFSITTQYYTWNWIRQPPGKGLEWMGYVYPYSSGSTGYAPSLQGRITISADTAKNQVSLQLRSLTAADTATYYCAR
Chrysemys picta bellii V241 ighv AHGY02029167.1 19902 VISQVQLVQSGPGAVKPGETLALTCVVSGVSITSSSYAWSWVRQPPGKGLEWVARIYPHDGRKWFATSLQSRTTISSDTSKNQFSLQLASLAAADTAMYYCAG
Chrysemys picta bellii V240 igkv AHGY02026761.1 1747 ASGQIVMTQTPESLAVSPGDRITINCKASSSLTYQGNKYLAWYQQKMGQAPKPLIYLASTRASGIPDRFSGSGSGTDFTLTISRVEAEDAGDYYCYQ
Chrysemys picta bellii V239 igkv AHGY02026760.1 1427 SSGQIVMTQTPESLAVSPGDRVTINCKASSSADGWVAWYQKKTGQAPKRLIYDASSRVSGIPDRFSGSGSGTDFTFTISRVEAEDAGDYYCHQYNS
Chrysemys picta bellii V238 igkv AHGY02026760.1 1427 SSGQIVMTQTPESLAVSPGDRVTINCKASSSADGWVAWYQKKTGQAPKRLIYDASSRVSGIPDRFSGSGSGTDFTFTISRVEAEDAGDYYCHQYNS
Chrysemys picta bellii V237 igkv AHGY02026760.1 7602 SQGQIVLTQTPESLAVSPGDRVTINCKASSSLTDEDFGSDTLAWYQQKTGQAPKLLIYEASTLQTGVPARFSGSGSGTDFTLTISSVEAEDAGDYYCQQGSQTP
Chrysemys picta bellii V236 igkv AHGY02026760.1 11441 ASGDTVLTQTPESLAVFPGESVTIKCKASKSLSYQGKEYLAWYQEKMGQAPKCLIYQASTRTSGIPDRFSGSESGTDFILTISRLEAEDAGNYYCLQSYDAP
Chrysemys picta bellii V235 igkv AHGY02026760.1 17683 SSGQIALTQTPDSLTVSLGDRVTIKCKASSSLTHSSTGKELLAWYQQKSGQAPKLLIYYATTLQSGVPARFSGSGSGTDFTLTISRVEAEDAGDYFCQQGKSDA
Chrysemys picta bellii V234 igkv AHGY02026760.1 23993 SSGQIVMTQTPESLAVSPGDTVTIRCKASSSLTHNSYHYMAWYQQKSGQAPKLLIYAGSSLQTGVPARFSGSGSGTDFSLTINRVEAEDAGDYYCQEVWSSP
Chrysemys picta bellii V233 igkv AHGY02026760.1 29095 SSGQIVMTQTPESLAVFPGDRVTINCKASANITGTYTYLAWYQQKSRQAPQLLIYHASTRPSGIPDRFIGSGSGTDFTLTINSVQAEDAGDYYCQQGYGWT
Chrysemys picta bellii V232 igkv AHGY02026760.1 32755 AKGQIVLTQTPESLAVSPGDRVTINCKASSSVSNSYMHWYQQKSGHAPKLLIYSTSTRPSGIPDRFSGSGSGTDFTFTISRVEADDAGDYYCQQAHSLP
Chrysemys picta bellii V231 igkv AHGY02026760.1 36718 AKGQIVLTQTPGDTARDSGDRVTINCKASSSVSNSYMHWYQQKSGHTPKLLIYSTSTRPSGIPDRFSGSGSGTDFTFTISRVEADDAGDYYCQQAHSLP
Chrysemys picta bellii V230 trgv AHGY02026072.1 2259 VLWAIHLEQVPISITKEPRASSTAEFTCEVTGGSESTYIHWYRAPTGGALQRLLYLSYSKPDPSWDAGFSREKLAAYFQGRSICKLLVHKLEKADSGHYYCAAWDY
Chrysemys picta bellii V229 trgv AHGY02026072.1 10580 GCAQIHLRQTQLSVTRAENKTARIVCEASGIQNFRSAVIHWYRHRSGEAPERILYISTIKVEFDKDTDKKKFDCEKKSDQSISTLVVNTITPNDRAIYYCAFWV
Chrysemys picta bellii V227 trgv AHGY02026071.1 8160 GCAQIHLRSTQLSITKAENKTARIVCEASGIQNFGSAVIHWYRHRPGEAPERILYISPEKLEFDKDSDENKFNCEKKPDQPISTLTVHEIAPNDGATYYCAYWG
Chrysemys picta bellii V226 trgv AHGY02026071.1 10768 GSSQVRLTQPQLSITREENKTLRIDCHVSLSEDFGKAPIHWYRQRPGAAPERILLISTQSESKGKFNAEKKIGQSTCTLTINKITSSDVATYYCAYW
Chrysemys picta bellii V225 trgv AHGY02026071.1 19150 VLWAIHLEQEQISVTKQPLQGSSAKFTCRVFGGSDSTYIHWYRARAGEAPHRLLHLTLSGSKLNREAGFSNDKFSAYGTQNISNLLVHKLEKTDNGHYYCATWDF
Chrysemys picta bellii V224 trgv AHGY02026069.1 3126 GYTQITLMQTSLSVTTAKNRSAYIWCKIYGENFNFNSAYIHWYRQRPGEAPKRILYIRSESAVKDEGFDSKKFEAEKIGSTSTSNLRVHQLTQEDAAIYYCATWD
Chrysemys picta bellii V223 trgv AHGY02026068.1 2876 VLRAIHLEQVPISITKGPPAGSTAEFICKVSGGSESTYIHWYRAPTGGAPQRLLYLSYSKPNPSWEAGLSSKKLSAYFQVPSICKLLVYKLEKADSGYYYCAAWDY
Chrysemys picta bellii V222 trgv AHGY02026062.1 3306 VLWAIYLEQVPISITKEPHVGSTAVFTCKVSGMSESTYIHWYRAPTRGAPQRLLYLSYSKPDPSWDAGFSSKKLTAHFQDRDICKLLVYKLEKADSGHYYCAAWDY
Chrysemys picta bellii V221 trgv AHGY02026062.1 3306 VLWAIYLEQVPISITKEPHVGSTAVFTCKVSGMSESTYIHWYRAPTRGAPQRLLYLSYSKPDPSWDAGFSSKKLTAHFQDRDICKLLVYKLEKADSGHYYCAAWDY
Chrysemys picta bellii V220 trgv AHGY02026061.1 3133 ALWAIHLEQEQISVTKQPLQGSSATFTCKVFDGSDSTYIHWYRARAGEAPHRLLYLTLSGSELKREAGFSGDKFLAYARQSTCSLVVYKLEETDSGCYYCATWDF
Chrysemys picta bellii V219 trgv AHGY02026059.1 316 GCAQIHLTQAQLSITRAENKTARIVCEASGIQNFGSAVIHWYRHRPGEAPERILYISPEKLKFDKDSDENKFNCEKKPDQPISTLTVNEIDPNDGATYYFAYWD
Chrysemys picta bellii V218 trgv AHGY02026056.1 75 GFTEITLIQTPLSATSAGTRSAYMWCKISGEGFNLNSAYIHWYRQRPGEALKRVLYIQSGSAITDEGFDSKKFKAINDVSESTSNLRVDKLTQEDAAIYYCATWD
Chrysemys picta bellii V217 trgv AHGY02026050.1 5714 ALWAIHLEQEQISVTKQPLQGSSAKFTCKVFDGSDSTYIHWYRARAGEAPQRVLYLTLSGSDLKREAAFPLEKFSAYGTKSISNLLVHKLEKTDSGRYYCATWDF
Chrysemys picta bellii V216 trgv AHGY02026050.1 9666 VLRAIHLEQVPISITKEPHRSSTAEFTCKLSGISASTYIHWYRAPTGGAPQRLLYLSYSEPDPSWDTGFSSEKLAAYFQGRSICKLLVHKLEKPDSGHYYCAAWDY
Chrysemys picta bellii V215 trgv AHGY02026049.1 2158 GYSQITLTQTPLSATRAGTRSAYMWCKISGQGFNLNSAYIHWYRQRPGEAPKRILYIQSGSAIMDEGFDSKKFKASNDVSASTSNLRVDKLTQEDVAIYYCATWD
Chrysemys picta bellii V214 trgv AHGY02026049.1 11334 GCAQIHLRQAQLSITRAENKTARIVCEASGIQNFGSAVIHWYRHRPGEAPERILYISPEKLKFDKDSDENKFNCEKKPDQPISTLTVNEIAPNDGATYYCAYWD
Chrysemys picta bellii V213 trgv AHGY02026044.1 892 GEAQVLVQSQLSITRAENKTARIDCHVSGITLSSAYIHWYRRRPDAALERILYFLSGKPDFDRDSEKAKFEAEKQLSESICVLTVKKISKNDAATYYCAAW
Chrysemys picta bellii V212 trgv AHGY02026042.1 1082 GCAQIHLRQTQLSITRANDKTARIDCEASGIQNFESAVIHWYRHRPGEALEWILYFKTQADKSSFDKKFSVDKTIEKSTCILRVIKLSYNDMATYYCAYW
Chrysemys picta bellii V284 ighv AHGY02091652.1 141 GQSQVQLVQSGAEIKKPGDSLKISCKTSGFPLSHYYMSWLRQAPGKGLVWVGRIDPANGATIYSQSFKDRLTITTDNSISTMYLQLSNLRAEDTAVYYCA
Chrysemys picta bellii V283 trdv AHGY02091652.1 26436 CVAAITLTQPSSAQAEPGSSLTLDCVVSGYNINDHHLSWIRQAPGKSLVWLAAFRTGYTTYITDEFKGRVTPRTSGSTGKLKINSLTAADTATYYCATD
Chrysemys picta bellii V282 igkv AHGY02091652.1 32332 SVAAVSLTQPSSAIAKAGSSVTLECVASGYNINDHHMHWTRQSPGKGLVWIAAFKTGATTYISNDFKGRVTPSTSGSTGKLKIDGLTAADTATYYCS
Chrysemys picta bellii V281 ighv AHGY02091651.1 575 VQSEVQLVQSGAEIKKPGESVKISCKTSGFTLTDYYMSWIRQTPGKGLVWLGRIDPEDGDTSYDDSVKNSVTISTDNSISTVYLQLRSLRTEDTAVYYCAR
Chrysemys picta bellii V280 ighv AHGY02091651.1 4656 VQSEVQLVQSGAEIKKPGESVKLSCKTSGFTFTSVFMHWIRQAPGKGLDWVGRIDPADSETKYSESFKGRFTITTDNSISTAYLQLRSLRLEDTAVYYCAR
Chrysemys picta bellii V279 ighv AHGY02091651.1 6808 VQSEVQLVQSGAEIKKPGESVKISCKTSGFTLTDYYMSWIRQTPGKGLVWLGRIDPEDGATIYDDSVKNSVTISTDNSISTVYLQLHSLRTEDTAVYYCAR
Chrysemys picta bellii V278 ighv AHGY02091645.1 5540 AFSQAQLVESGGGVKKPGDSLPLSCQASGFTFTDYWMQWIRQAPGKGLEWIGEIHPTSTTINYAQPFKGRFTISRDNPNNLLYLQMTGLKPEDTARYYCSRI
Chrysemys picta bellii V277 ighv AHGY02091645.1 16071 ARSQVVLTQSGPALKKPGESHKLQCATSGFTLSSTWMSWVRQEPGKGLEWLVSYYDPSNKHYASSVQGRFTASKDSTNFYLQMTSLRAEDTAVYYCAR
Chrysemys picta bellii V276 ighv AHGY02091644.1 1264 VRSQVLVESGGDVKKPGDSLRLSCKASGFTFSSYYMSWVRQAPGKGLEWVSGIYTDGSQQFYADSVKGRFTISRDNSNNLLYLQMTGLKPEDTARYYCA
Chrysemys picta bellii V275 ighv AHGY02091640.1 2028 ASSQIQLTQSGAQIKKPGESEKLTCKTAGYTFTSYYIQWLRHVPGKGLQWIGLISPNNGGTHYAQAFQGRFTITRDTSISTAYLQLGSLRTDDTATYYCAR
Chrysemys picta bellii V274 ighv AHGY02091637.1 9650 VSSQIQLTQSGAEIKKPGESVKVTCKTSGYTFTSYDISWVRQAPGKALEWIGYINPSTGSTGYAQAFQGRFTITRDTSISTAYLQLGSQRTDDTATYYCAR
Chrysemys picta bellii V273 ighv AHGY02091636.1 2910 VSSQIQLTQSGAEIKKPGESVKVTCKTSGYTFTSYYIHWVRQAPGKGLEWVGYIDPSDGETGYAQAFQGRFTITRDTSISTAYLQLGSLRTDDTATYYCAR
Chrysemys picta bellii V272 ighv AHGY02091636.1 11378 AWSQVQLVESGGDVKKPGDSLRLSCKASGFTFSSYGMHWVRQAPGKGLEWIAYIYSTSIYYSDSVKGRFTVSRDDPNSLLYLQMTGLKPEDTARYYCAR
Chrysemys picta bellii V271 ighv AHGY02091635.1 6340 VSSQIQLTQSGAEIKKPGESVKVTCKTSGYNFASYNIHWVRQAPGKGPEWIGYISAYSGSTGYAQAFQGRFTITRDTSISTAYLQLGSLRTDDTATYYCA
Chrysemys picta bellii V270 ighv AHGY02091635.1 14464 ARSQVQLVESGGDVKKPGDSLRLSCKASGFTFSSYWMGWVRQAPGKGLEWIASIYSTSIYYSDSVKGRFTVSRDDPNSLLYLQMTGLKPEDTARYYCAR
Chrysemys picta bellii V269 ighv AHGY02091634.1 4479 VSSQIQLTQSGAEIKKPGESVRVTCKTSGYTFTSYDISWVRQAPGKALEWIGYIYTSSGGTGYAQAFQGRFTITRDTSISTAYLQLGSLRTDDTATYYCA
Chrysemys picta bellii V268 ighv AHGY02091634.1 8242 NVVLVESAGRLKKPGESLKLSCKASGFTFSSSWMDWVRQAPGNVLQWVASIRQDGGDSYYPDWVKGRFTISRDNPNNPLYLQLTDLKTEDTTRYYCAR
Chrysemys picta bellii V267 ighv AHGY02091634.1 9585 VKAQIQLVQSGAEVKKPGESVKESCKGSGYTFTSYGISWVQQIPGKGLFDIGWINTDTGAPAYRENLKGKVTMTLDKPLSTAFLLVSSLRAEDTAVYYCA
Chrysemys picta bellii V266 ighv AHGY02091633.1 2006 VSSQIQLTQSGAEIKKPGESVKLTCKTSGYTFTDYYINWVRQAPGKGLEWIGYIYPSSGSTSYAQAFQGRFTITRDTSISTAYLQLGSLRTDDTATYYCAR
Chrysemys picta bellii V265 ighv AHGY02091632.1 9239 VQSQIQLVQSGAEIKKPGESVKLTCKASGYTFTDYSMSWVRQAPGKGLEWVARIRTDNFNTFYPETLKGRTTISVDTSISTTYLQMNSLKSEDTAVYYCAR
Chrysemys picta bellii V264 ighv AHGY02091632.1 25507 VSSQIQLTQSGAEIKKPGESVKLTCKTSGYTFTSYNINWVRQAPGKALEWIGYITPSTGGTGYAQAFQGRFTITRDTSISTAYLQLGSLRTDDTATYYCAR
Chrysemys picta bellii V263 ighv AHGY02091632.1 29000 VSSQIQLTQSGAEVKKPGESVRVTCKTSGYTFTDYIMHWVRQAPGKALEWIGYINPRSGDTSYAQAFQGRVTITRDTSITMAYLQLGSLRTDDTATYYCV
Chrysemys picta bellii V262 ighv AHGY02091631.1 3488 VSSQIQLTQSGAEIKKPGESVKVTCKTSGYTFTSYYIHWVRQAPGKGLEWIGYISAYSGGTSYAQAFQGRFTITRDTSISTAYLQLGSLRTDDTATYYCAR
Chrysemys picta bellii V261 ighv AHGY02091628.1 2422 VRSQALVESGGDVKKPGDSLRLSCKASGFTFSSYYMSWTRQAPGKGLEWIGEIHPTSTTINYAQSFKGRVTISRDNPNNLLYLQMTGLKPEDTARYYCA
Chrysemys picta bellii V260 ighv AHGY02091628.1 4424 TVQLVESGGGIQTPGGSLRLACKASGFTFSSYHMNWVRQAPGKGLEWVAQILTPVNNLTAYYSDSVKGRFTISRDESSSSAYLQMNSLRAEDTAWYYCVR
Chrysemys picta bellii V259 ighv AHGY02091626.1 2039 ARSQVVLTQSGTAVKKPRESHRLQCAVSGVSSMGNMHWIRQDPGKGLEGLIYYHSLSDNSYYPTNQGRFTASKDSSNFYLQMTSLKAEDTVVYYCAR
Chrysemys picta bellii V258 ighv AHGY02091620.1 5595 VLSQVQLVQSGLGTVKPGETLTLTCAVSGVSITDSSYAWNWVRQPPGKGLEWMGYVYPYSSGSTSYAPSLQGRITISGDTAKNQFSLQLRSLTAADTATYYCARQ
Chrysemys picta bellii V257 ighv AHGY02091618.1 3204 VRSQVQLVESGGDVKKPGDSLRLSCKASGFTFSSAYMNWVRQAPSKGLEWVAYINPGGSTIYYLDSVKGRFTISRDDSKSELYLQMTGLKPEDTARYYCAR
Chrysemys picta bellii V256 ighv AHGY02077270.1 1429 AVKPGETLTLTYAVSGVSISTQYYFWHQICGPQGLEWMGWLYPCSGGTNYAPSLQSRVTISGDTTKNQISLQLRSLTAADTAAYYCARDS
Chrysemys picta bellii V255 trav AHGY02067877.1 7436 VGSAYVEQLPFLTGVAGESQTLQCTLKETSHYWMYWYWQKEAEELGQLFYSSGDGSGTNFTAEPMSAWRKNNNWHLQWKDLSWSDSAVYYCACST
Chrysemys picta bellii V254 trav AHGY02067869.1 9246 MGSAYVEQPPFLTGARENPKTLQCTLKQSSCSWMYWYRQREGKELEGLFNSVGDGPGTNFTAEPMTALRNNTKWDLIWRSLSLSDSAVYYCACSTAQ
Chrysemys picta bellii V253 trav AHGY02067869.1 13413 SHFLPGVGSAYVEQLPFLTGRHGRSLALQCTLTQSNCDRMFWYRQRGGRELEGLFYSYGDQLVNFTAELLTAQRSNKNWNLKWKSLSQSDSAVYYCACSTAQ
Chrysemys picta bellii V252 trbv AHGY02067866.1 972 LCSGVTVTQKEKFIAIQNGSKGSIPCEHDDNSYYTVLWYQQKNGAERQLQLVATSLDVNSAEMEKEFKTRFNVTRPATLNTSLTINPGMVEDTAVYFCAASK
Chrysemys picta bellii V250 trav AHGY02067865.1 7384 AGVGDLISQWPTSAIQKPGEAVTMNCYQNGTVRTNMLWYQQPQGEGLKLIAITYTGSRPSYEKDFNESKFVISREQQRLSDMTVKKVTARDAATYFCAAS
Chrysemys picta bellii V249 trav AHGY02067865.1 12068 SGLGVLISQLPRTVTQRPGETMKITCVQNETSYTYMYWYKQLQGEGPRLIAQSVDGFNATYEERYNATKFPITRLNTRISSMSVVDLRTQDSASYFCAAS
Chrysemys picta bellii V321 ighv AHGY02100084.1 215 VYSQISLVESGGGIKNPGETLRLTCTVSGFSLTSDGVCWAHQAAGKGLEWMGGIWAGGGNNYNDGLKSRLPITRDTPKNRVFLQLTGLRPADTSVYYCAG
Chrysemys picta bellii V320 ighv AHGY02100082.1 2408 VRSQVLVESGGDVKKPGDSLRLSCKASGFTFSSYHMNWVRQAPGKGLEWVAVIYTGGSTYYLDSVKGRFTISRDDSKSELYLQMTGLKPEDTARYYCAG
Chrysemys picta bellii V319 ighv AHGY02100081.1 1141 VLSQLWLQESGPGVVKPGEMLTLTCAVTGGTVTSSYWWNWICQAPGQGLEWMGRWSGGTSYALSLQGRITITVDSSNTKNYLRLNSLTAADTGTYYCARG
Chrysemys picta bellii V318 ighv AHGY02100081.1 5017 VLSQVQLVQTGPGVVKPGETLTLTCAVSGYSITSGYSWSWIRQPPGTGLEWLGRGYYSGSTWNTNYASSFQSRITISTDSSKNQFSLQLRSLTAADTSTYYCA
Chrysemys picta bellii V317 ighv AHGY02100081.1 7785 VLSQVQLVESGPGVVKPGQTLTLTCAVSGVSITSSSYVWNWVRQAPGKGLEWVAHIYPHDGRKWFAASLQSRTPISLDTSKNQFSLQLASLAAADTATYYCA
Chrysemys picta bellii V316 ighv AHGY02100076.1 4116 VRCQVQLVESGGDVKKPGDSLRLSCKASGFTFSSYRMYWIRQAPGKGLEWVAYISGSRVIIRYLDSVKGRFTISKDNSKSELYLQMTGLKPEDTARYYCA
Chrysemys picta bellii V315 ighv AHGY02100075.1 282 VRSQMQLVESGGDVKKPGDSLRLSCKASGFTFSSYNMKWVRQAPGKGLEWVAHINPNLSIVYLDSVKGRFTISRDDSKSELYLQMTGLKPEDTARYYCARDTV
Chrysemys picta bellii V314 ighv AHGY02100074.1 29478 NHRSNCSFTGDVKKPGDSLRLSCKASGFTFTSYWMGWVRQAPGKGLEWLALIHGSSIYYSDSIKGRFTISRDDPNSLLYLQMTGLKPEDTARYYCAR
Chrysemys picta bellii V313 ighv AHGY02100071.1 891 VLSQVQLVESGPGTVKPSETLSLTCSISGASSDTLGSSCCWWHWIRQSPGKGLEWMGDIEQGGRKYYASSLQSRITISENPSKNQFSLELRSLTAADTGTYYCARS
Chrysemys picta bellii V312 ighv AHGY02100069.1 1693 VFSQVQLVLSGPEAAKPRETLTLSCAVSVVSISTQYNYWEWIRQSPGKRLEWMGGVYPYDGTMSFIPSIKSRATISADTAKNQFSLQLRSLTAADTATYYCARN
Chrysemys picta bellii V311 igkv AHGY02099921.1 2047 SSGQIVMTQSPESLTVTPGDKITINCKASSDPLTYVAWYQQKSGQPPKLLIYAVSTRPSGVPERFSGSRSGNDFILTVNRVDVDDTGDYYCEQSRNFQS
Chrysemys picta bellii V310 igkv AHGY02099920.1 12998 TVMTQSPASLSVSAGESVSISCKASSGITNDIAWYQQKSGKAPKLLIYEASSRDTGIPTRFSGSGSGTDFTFTISSVEVDDAGDYYCQQYNSWP
Chrysemys picta bellii V309 igkv AHGY02099920.1 21009 TSGQVVLTQSPESLSILPGETVTIKCQSDTDIDDDMNWYQQKSGAAPKLLLSEGSSRQTGVPARFSSSGYGTDFTFTISSVENDDAGDYYCQQSDRTP
Chrysemys picta bellii V308 igkv AHGY02099919.1 8598 SNGQIVLTQTPESLAVSPGDRVTINCKASSSAGGWMAWYQQKSGQAPKLLIHSASTRPSGIPDRFSGSGSGTDYTFTISRVEADDAGDYYCQHGANLP
Chrysemys picta bellii V307 igkv AHGY02099918.1 1841 SSGQIVMTQTPESLAVSPGDRVTINCKASSSVSGWVSWYQQKSGQAPKLLIYLASTRSSGIPDRFSGSGSGTDYTFTISRIEADDAGDYYCLQKTASFP
Chrysemys picta bellii V306 igkv AHGY02099916.1 3770 SYGQTVLTQTPESLSVSPGERVTINCKVSTSINNYLDWHQQKSGQSPKLLISDSTNNYSGIPARFSGSGSGADFTLTISRVEVQDAGDYYCQQCNSYP
Chrysemys picta bellii V305 igkv AHGY02099915.1 1750 GTLLTQTPESVAVSPGDTIIINCKASSSMMGLLTWYQQNPGQAPKVLLYSASTLLPGVPAQFHGSQAGSSVTDYSLSGSTIQTEDEGDYYCQPFYGPPF
Chrysemys picta bellii V304 igkv AHGY02099915.1 8204 SSGQIVMTQTPESLAVSPGDRVTINCKASSSTGNHLTWYQQKSGQAPKLLIYHGSTLASGVPARFSGSQSGSGYTDYTLTISSAEIEDAGDYYCQQGYSSP
Chrysemys picta bellii V303 igkv AHGY02099915.1 13158 ASGDIVMTQTPESLAVSPGDRVTINCKASTSIGSDIAWYQQKSGQAPKLLFYGSSSRPSGIPDRFSGSGSGTDFTLTITSFQADDAGSYYCQQDYDWP
Chrysemys picta bellii V302 igkv AHGY02099911.1 3627 SSGQTVMTQTPESLAVSPGDRVTINCKASTSISGAIGWYQQKSGQAPKLLIYGPSTRPSGIPDRFSGSGSGTDYTFTISRVEADDAGDYYCMQAASFP
Chrysemys picta bellii V301 igkv AHGY02099910.1 2023 ASGQIVLTQTPESLLVSAGDRVTINCKASTSISSNIAWYQQKSGQAPKLLFYGTSSRPSGVPDRFSGSGSGTDFTFTISRVEADDAGDYYCQQYYSTP
Chrysemys picta bellii V300 igkv AHGY02099910.1 9097 SYGQIVLTQTPESLAVSPGERVTINCKASTSISNYLGWYQQKPGQAPKLLISDSTNRVSGIPDRFSGSGSGTDFALTISSIEAEDAGDYYCHQRLSYP
Chrysemys picta bellii V299 ighv AHGY02099583.1 1490 VWSQVLMESGGDVKKPGDSLRLSCKASGFTFSSYYMSWVRQAPGKGLEWVAIIYPGGSSTDYLDSVKGRFTISRDDSKSELYLQMTGLKPEDTARYYCAG
Chrysemys picta bellii V298 ighv AHGY02099581.1 283 VRSQVKLLQTGAAQVKPSQTLRLTCSVSGFSLTSSGYGVSWVRQPPGKGLEWLSIVYWDEDKYYQESLKNRLTISRDTSKSEVYLEMRGMEAGDSGTYYCTR
Chrysemys picta bellii V297 ighv AHGY02099575.1 1935 ARSQVVLTQSGPALKKPGESHKLQCATSGFTLSSTWMGWIRQEPGKGLEWLTLYYSEGGKYYASSVQGRFTASKDSTNFYLQMTSLRAEDTAVYYCAK
Chrysemys picta bellii V296 ighv AHGY02099575.1 12454 VRSQALVESGGDVKKPGDSLRLSCKASGFTFSSYHMHWVRQAPGKGLEWVAYIRYDGSSTDYLDSVKGRFTISRDDSKSELYLQMTGLKPEDTARYYCAG
Chrysemys picta bellii V295 ighv AHGY02099574.1 3598 VLSQPQLVESGPGVVTPSASLTLRCTIAGDSVTNPYWEWVRQPPGKEPEWLGQGHFSGSSWATQYNPAVQGRVTVSGDSSQNLFYLHLGSLTAADTATYYCAKMG
Chrysemys picta bellii V294 ighv AHGY02099570.1 411 RLVESREDIKKPGQSLRLTCKGSGFDFSQAGMHWLRQDPGKGLERVSVFFFSGSKEYYVASVKGRFTTSRNNSPNLAYLDISGLKPEDTARYYCAA
Chrysemys picta bellii V293 ighv AHGY02099570.1 2012 ARSQVQLVESGGDVKKPGDSLRLSCKASGFPFSSYLMDWIRLAPGKGLEWLARAAAQGSTYYADSVQGRFTISRDNANSLVHLQISSLRAEDTALYYCVR
Chrysemys picta bellii V292 ighv AHGY02099569.1 3072 VWSQVLVESGGDVKKPGDSLRLSCKASRFTFSSYYMSWVTQAPGKGLEWVGYISDGGGTAYLDSVKGRFTISRDNSKSELYLQLTGLKPEDTARYYCA
Chrysemys picta bellii V291 ighv AHGY02099568.1 3536 VLSQVQLVQSGPGAVKPGETLALTCAVSGFSVSSSGYDWHWIRQPPGKGLEWMGRVYPYSSGTTNYAPSLQARITISADTAKNQVSLQLRSLTAADTAAYYCAR
Chrysemys picta bellii V290 ighv AHGY02099568.1 7894 ARSQVVLTQSGTAVKKPGESHTVKCAVSGFNIMSYNMHWIRQAPGKGLEWLIYYYSSSDNSYFPTIQGQFTASKDSSNFYLQMTSLKPEDTTVYYCA
Chrysemys picta bellii V289 ighv AHGY02099566.1 2627 IQSQALVESGGDVKKPGDSLRLSCKASGFTFSSYPMNWVRQAPGKGLEWVAYISSGGGTIHYLDSVKGRFTISRDNSKSELYLQMTGLKPEDTARYYCAR
Chrysemys picta bellii V288 ighv AHGY02099562.1 4635 VRSQALVESGGDVKKPGDSLRLSCKASGLDFTGYRMHWIRQAPGKGLEWVTSISSGGVSIYYPHSVKGRFTISRDNSKSELYLQMTGLKPEDTARYYCA
Chrysemys picta bellii V287 ighv AHGY02099561.1 1105 VLSQVQLVQSGPGAAKPGETLTLTCAVSGFSITTRYYYWNWIRQPPGKGLEWMGYVYPYSSGSTSYAPSLQGRITISGDPAKNQFSLQLRSLTAADTATYYCARS
Chrysemys picta bellii V286 ighv AHGY02099558.1 3755 VWSQVQLVESGGDVKKPGDSLRLSCKASGFTFSSYYVGWVRQAPGKGLEWLTWIHGSSIYYSDSIKGRFTVSRDDPNSLLYLQMTGLKPEDTARYYCAR
Chrysemys picta bellii V358 trgv AHGY02107859.1 1536 IQSKLEFVASGGEIKMLGDSLQISCKTSGFTFGDYGMAWYRIMPGKGLEWVSTISYGAGNTKNYASSVQGRFTISRDNSRSLLYLHMTNLRREDAAEYYCMW
Chrysemys picta bellii V357 trav AHGY02107051.1 4707 PVAGNSVTQIRASASVREGRPVKLNCQYSTTYTYYALGWYQQLPGQQPLFLLYRDERGNEHKPRSVAARFSSELSTDVKSFTLSIDGAQRADSAVYFCGLGA
Chrysemys picta bellii V356 trdv AHGY02107051.1 6411 VGSDVVLEQGAQALSVREGEEVTFQCSVKGGEMSSYWMYWYRKGQRGPLTWIYREGDHYGEGFQGRFVGKVDSSNNRFTLRILSAELRDRAVYYCASS
Chrysemys picta bellii V355 ighv AHGY02107049.1 1299 ALSQLQLVASGPGVGKVSEPLTLTCAVSGFSINTQYYYWYWLRQPPGEGLESMGWVYPYDGDSDYAPSLQGRVTISADAAKNQFSLTLRSLTAADTATYYCARR
Chrysemys picta bellii V354 trgv AHGY02106965.1 346 IQSKLDFVASGGKVKMLGDSLRISCKTSGFTFGDYGMTWYRHTPGKGLQWVAYISKSSGDTKSYADSVQGRFTISRDNSRSLLYLHMTNLRREDAAEYYCGW
Chrysemys picta bellii V353 ighv AHGY02106956.1 2132 SVAVVTLTHPGSARAEPGSSITLDCVVSGYNINDHHLHWVRQAPGNRLVWVTAFRTGYTTITANEFKGRVTPSTSGSTARLKIDRLTAADTATYYCAR
Chrysemys picta bellii V352 iglv AHGY02106250.1 2333 SLSQFTLTQPPSVSVSIGNTVKLSCTISSGYTFGPVFWYQQKDGNSPRFLLRYNTDSDKHQGSGVPSRFSGSKDASKTTGYLTVTGVQAEDEADYYCAAGVSGA
Chrysemys picta bellii V351 iglv AHGY02106249.1 426 VSSQPVVTQEPSMSVTPGGAITLSCSLSPGAITTGSYPAWFQQKPGSAPRTLIYSTNSRPSGIPARFSGSISGNNAALTITGVQAEDEADYYCILWTGRV
Chrysemys picta bellii V350 iglv AHGY02106249.1 3216 SLSQYTLTQPPAESVSIGNTVKLSCALSSGYTFGSVVWYQQKNGNIPRYLLRYKTDSDKHQGSGIPSRFAGSKDASNTIGYLTITSVQAEDEADYYCATGT
Chrysemys picta bellii V349 iglv AHGY02106231.1 1266 VSSQPVVTQEPSVSVTPGGAVTLSCSLSSGAITSSNAPGWFQQKPGSAPRTLIYSTNSRPSGIPARFSGSISGNNAALTITGVQAEDEADYYCIVWASSV
Chrysemys picta bellii V348 igkv AHGY02105966.1 248 SRAQPVLTQPASILVLPGQTVKLSCALNPGYNIREFGVSWYQQRPGSPPRYLLYYNSEVDKDKPSGIPDRFSASKDPASNACVLTIAAVQAEDHADYYCS
Chrysemys picta bellii V347 ighv AHGY02105554.1 2557 ARSQVVLTQSGPELKKPGESTQLKCTVSGFAVSGDYMDWVRQEPGKGLEWLVHYWKPGSEYYSPTIKGRFTASKDSSNFYLQMNSLKAKDTAVYYCTR
Chrysemys picta bellii V346 ighv AHGY02105553.1 1470 ARSQVQLVESGGDVKKPGDSLRLSCKASGFDFSSYYMSWVRQAPGKGLEWVGYISDDGSDIDYLDSVKGRFTISRDNSKNELYLQMTGLKPEDTARYYCAR
Chrysemys picta bellii V345 ighv AHGY02105548.1 670 ARSQVVLTQSGPEVKKPGESTQLKCSVSGFVPNDWWMDWVRQLPGKGLEWLVHYRQSSVTNYYSPSIQGRFTASKDSANFYLQMTGLKPEDTAMYYCA
Chrysemys picta bellii V344 ighv AHGY02105545.1 2984 VRSQVQLVESGGDVKKPGDSLRLSCKASGFTYSSAYMNWVRQAPGKGLEWVAYINPGGGTIRYLDSVKGRFTISRDNSKSELYLQMTGLKPEDTARYYCAAR
Chrysemys picta bellii V343 ighv AHGY02105543.1 1508 RLVESGGDVKKPGQSLRLTCKGSGFDFSQAGMHWLRQAPGKGLEWVSVIFFDGSKEYYAASVKGRFTTSRDNSQNLAYLDMSSLKPEDTARYYCAA
Chrysemys picta bellii V342 ighv AHGY02105525.1 353 VLCQVQLVQSGPGAVKPGETLTLSCAVSGFSITSSGYGWNWVRLPPGEGLQWLGYIGASGGTGYTPSLQSRLSFSRDTAKNALSLQLRSLTATDTATYYCTR
Chrysemys picta bellii V341 ighv AHGY02105524.1 735 VLSQVQLVESGPGVMKPGQTLTLTCTVSGVSITDSSYLWCWVRQPPGKGLEWVARIYPHDGRKWFAASLQSRTTISSDTSKNQFSLQLASLAAADTTTYYCARDTQ
Chrysemys picta bellii V340 ighv AHGY02105523.1 942 VLSQVQLVQTGPGAVKPGATLSITCKVSGVSVSDHYWSWNRQPAGKGLEWMGFIRNTANGGTTEYNAALKPRVTITRDTSKDEVYLQLGSLTAADTSTYYCARDTV
Chrysemys picta bellii V339 ighv AHGY02105522.1 345 VRSQVQLVESGGDVKKPGDSLRLSCKASGFTFSDYSMNWIRQAPGKGLEWVSRIYYDGSQQFYADSVKGRFTISRDNSNNLLYLQMTGLKPEDTARYYCAR
Chrysemys picta bellii V338 ighv AHGY02105522.1 3551 VQSQVLLVESRGGIQKPGGSLRLSCKASEFTFTSYHMSWVRQAPGKGLEWVSRIYNPANSHSTFYSDADKGRFTISRDDSSSSVYLQMTILKAEDTARYYCAR
Chrysemys picta bellii V337 ighv AHGY02105522.1 11654 VNSQIQLTQSGAEIKKPGESVKVTCKTSGYTFTSYGINWFRQAPGKGLEWIGYISTNTGGTGYAQAFQGRFTITMDTSISTAYLQLGSLRTDDTATYYCA
Chrysemys picta bellii V336 ighv AHGY02105519.1 190 VWSQVQLVESGGDVKKPGDSLRLSCKGSGYTFSSHQMSWVRQAPGKGLEWIAFIDVTTIYYADSVKGRFTISRDNSNSLLYLEMTGLKPEDTARYHCA
Chrysemys picta bellii V335 ighv AHGY02105517.1 1928 VRSQVQLVESGGDVKKPGDSLRLSCKASRFIFSSYAMSWVRQAPGKGLEWVSYIYTDGSQQFYRDSVKGRFTISRDNPNNLLYLQMTGLKPEDTARYHCA
Chrysemys picta bellii V334 ighv AHGY02105517.1 4673 ESGGDVKKPGDSLRLSCKASRFTFSSCLMHWVRQAPGKGLEWVAEIRPDGSSQSYSPAVKGRFTISRDNSKSELYLQMTGLRAEDTARYYCG
Chrysemys picta bellii V333 ighv AHGY02105516.1 3063 VRSQALVESGGDVKKPGDSLRLSCKASGFTFSSYWMYWVRQAPGKGLEWVTAINPGGSSTYYLDSVKGRFTISRDDSKSELYLQMTGLKPEDTARYYCAG
Chrysemys picta bellii V332 ighv AHGY02105516.1 11371 ARSQVVLTQSGPEVKKPGESTQLKCAVSGFVPNDWWMDWVRQLPGKGLEWLVHYRQSSVTNYYSPSIQGRFTASKDSSNFYLQMTGLKPEDTAVYYCA
Chrysemys picta bellii V331 ighv AHGY02104450.1 1832 AWSQVVLTQSGPELKKPGESTRLKCAVSGFAVSSDYMAWVRQEPGKGLERLVRYHTPTATNYYSDSIQGRFTASKDSSNFYLQMTSLKPQDTAVYYCAR
Chrysemys picta bellii V329 ighv AHGY02104440.1 316 VLCQVQLVQSGPGAVKPGETPTLTCAVSGFSITSSGYGWNWVRLPPGEGLQWLGYIGASGGTGYTPSLQSRLSFSRDTAKNALSLQLRSLTATDTATYYCTR
Chrysemys picta bellii V328 ighv AHGY02104439.1 2193 VLCQVQLVQSGPGAVKPGETLTLTCAVSGFSITSSGYGWNWVRLPPGEGLQWLGYIGASGGTGYTPSLQSRLSFSRDTAKNALSLQLRSLTATDTATYYCAR
Chrysemys picta bellii V327 ighv AHGY02104433.1 1199 VRSQALVESGGDVKKPGDSLRLSCKASGFTFSSYSMNWVRQAPGKGLEWVAYISYDGSAIYYLDSVKGRFTISRDNSKSELYLQMTGLKPEDTARYYCAG
Chrysemys picta bellii V326 ighv AHGY02104427.1 3662 AGAQARLVESGGDVKKPGQSLRLTCKGSGFDFSQAGMHWFRQAPGKGLEWVSVIFFDGSKEYYAASVKGQFTTSRDNSQKLAYLDMSSLKPEDTARYYCAA
Chrysemys picta bellii V325 ighv AHGY02104427.1 5264 ARPQVQLVESGGDVKKPGDSLRLSCKASGFPFSSYLMDWIRLAPGRGLEWLARAAAQGSTYYADSVQGRFTISRDNANSLVHLQISSLRVEDTALYYCVR
Chrysemys picta bellii V324 ighv AHGY02100092.1 3404 VLCQVKLVQSGPGAAKPGETLTLSCAVSGVSITTQHYYWSWIRQFPGKGLEWMGYVYPYSSGSTSYAPSLQGRITISADTAKSQFSLQLRSLTAADTATYYCAR
Chrysemys picta bellii V323 ighv AHGY02100088.1 1007 CGAAVTLTQPSSAQADPGSSLSLDCVVSGYNINDHHLSWIRQAPGKGPVWLAAFRTGYTTYITDEFKGRVTPRTSGATARLNINSLTAADTATYYCARN
Chrysemys picta bellii V395 ighv AHGY02111957.1 553 VLSQVQLLESGGDVKKPGDSLRLTCTTSGFNIDSYWMSWVRQAPGQGLEWVSAINGATTQYGNSVKGRFTTSTDSSKKLIYLQMTGLKPEDTARYYCAR
Chrysemys picta bellii V394 ighv AHGY02111743.1 3012 AADPDRPGAVKAGETLSITCKVSGVSVSSYHWSWVRQPPGKGLEWMGFIRHTVNGGSTEYNSAFTPRVTITRDTSKDEVYLQLGSWTAADTGTYYCA
Chrysemys picta bellii V393 ighv AHGY02111742.1 291 VLSATQLVQSGPGAVKPGDTLTLTCAVSGTSISSDTAWHWIRQPPGTGLEWMGWVYPYGGSTGYDSSLQGRTTISADTAKNQFSLQLRSLTAADTATYYCARQ
Chrysemys picta bellii V392 ighv AHGY02111737.1 1863 VLSQVQLKETGPGAVKPGESLTLTCTISGDSVSSTSVTWTWVRQPAGKGLEWVGRIYYRPSQWYTNYASSLQSRTTITQDTSKNQFSLQLRSLTAADTAMYYCARE
Chrysemys picta bellii V391 ighv AHGY02111269.1 3034 VLSEVVLTQSGPEVRRPGEATILKCAVTGADHSTSIMTWIRQAPGKGLEWLVYYYSQASIFYSPAMQGRFTASMDSSSLYLQMHSLKEEDTAVYYCVRLGV
Chrysemys picta bellii V390 ighv AHGY02111269.1 11717 VRSQVQLVESGGDVKKPGDSLRLSCKASGFTFSSYYMSWVRQAPGKGLDWLAWIYGSSINYSDLVKGRFTISRDDSKSELYLQMTGLKSDDTARYYCAR
Chrysemys picta bellii V389 ighv AHGY02111269.1 19797 VYSQVSLVESGGGIKKPGETLRLTCTVSGFSITSYGVHWVRQSVGKGLEWMGVIWSGGNNNYNDALKSRLTITRDTSKSQVFLQLTGLQPADTSLYYCAR
Chrysemys picta bellii V388 iglv AHGY02110407.1 782 SSSQTVLTQPPSVSVSPGNTVKLSCTMSSGTSISGHRVSWYQQQPGNSPRYLLRHKSDSDKHQGSGVPARFSGSKDTSSNTGYLTISGALTEDEAEYYCAAWKGGSD
Chrysemys picta bellii V387 iglv AHGY02110406.1 1112 SSSQTVLTQPPSVSVSPGNTVKLSCTMSSGTSISGYHVSWYQQQPGNSPRYLLRHKSDSDKHQGSGVPARFSGSKDTSSNTGYLTISGALTEDEAEYYCAAWKGGSD
Chrysemys picta bellii V386 iglv AHGY02110405.1 12261 SLAQYLLTQPPSVSASPGKNAQLTCSGNNIGSYHVQWYQQKPGTAPLMLIYHSSNRRSGIPARFSGASSGNTATLTITGVRAEDEADYYCQAWDSGSDQ
Chrysemys picta bellii V385 ighv AHGY02109580.1 3288 VYSQVSLVESGGGIKKPGETLTLTCTVSRFCLTSDGVHWARQPALKGLEWMGGIWAGGGNNYNDALKSRLPITRDTSKSQVSLQAGDTVVYYCARD
Chrysemys picta bellii V384 ighv AHGY02109580.1 4790 ARSQVVLTQSGPEMKKPGESTQLKCAVSGFTVSDYYMAWVRQEPGKELEWLVSYYTPSSTNYYSDSIKGRFTASKDSSNFYLQMTSLKAEDTAVYYCAR
Chrysemys picta bellii V383 ighv AHGY02109580.1 10194 VRSQVLVESGGDVKKPGDSLRLSCKASGFTFSSYWMYWVRQAPGKGLEWVTAINTGGSSTYYLDSVKGRFTISRDNSKSELYLQMTGLKPEDTAHYYCAR
Chrysemys picta bellii V382 ighv AHGY02109579.1 24 VRSQVQLLESGGDVKKPGDSLRLSCKASGFTFSSYAMSWVRQAPGKGLEWVAYISSGGSTYYPDSVKGRFTISRDNSKSELYLQMTGLKPEDTARYYCAR
Chrysemys picta bellii V381 ighv AHGY02109578.1 998 AGAQARLVESGGDVKKPGQSLRLTCKGSGFDFSQAGMHWLRQAPGKGLEWVSVIFFDGSKEYYAASVKGRFTTSRDNSQNLAYLDMSSLKPEDTARYYCAA
Chrysemys picta bellii V380 ighv AHGY02109578.1 2600 ARPQVQLVESGGDVKKPGDSLRLSCKASGFPFSSYLMDWIRLAPGKGLEWLARAAAQGSTYYADSVQGRFTISRDNANSLVHLQISSLRVEDTALYYCVR
Chrysemys picta bellii V379 ighv AHGY02109577.1 2760 VRSQVKLLQTGAAQVKPSQTLRLTCSVSGFSLTSSGYRMSWVRQPPGKGLEWLSAVDWDEDKYYQESLKNRLTISRDTSKSEVYLEMRGMEAGDSGTYYCAGS
Chrysemys picta bellii V378 ighv AHGY02109577.1 5777 VRAQVQLVESGGDVKKPGDSLRLSCKASGFTFTSYNMDWVRQAPGKGLEWVAEIYTDGSSQWYSPAVQGRFTISRDNPNNLLYLQMTGLKPEDTARYHCA
Chrysemys picta bellii V377 igkv AHGY02109461.1 1638 SSGQIVLTQTPESLAVSPGDRVTINCKASSSVSYMAWYQQKSGQALKLLIYRASTRPSGIPDRFSGSGSGKDFTFTISRVEADDAGDYYCQQYTS
Chrysemys picta bellii V376 igkv AHGY02109457.1 2497 SSGQLVLTQTPESLAVSPGDRVTINCKAISSVTSNFMAWYQQKSGQVPKLLIYGASTRASGIPDRFSGSGSGTDFTFTISRVEADDAGDYYCQQHSSSL
Chrysemys picta bellii V375 igkv AHGY02109456.1 4664 SSGQIVLTQTPESLAVSPGDRVTINCKASSRVGSSYLSWYQQKSGQAPKLLIHSASTRPSGVPDRFSGSGSGTDFTFTISRVEADDAGDYYCQKGGSSP
Chrysemys picta bellii V374 igkv AHGY02109456.1 8738 SSGQIVMSQTPESLAVSPGDRVTINCKASSSVGSWMAWYQQKSGQAPKLLIYGASTRPSGIPDRFSGSGSGTDFTFTISRFEAGDAGDYYCQQYSSSTL
Chrysemys picta bellii V373 igkv AHGY02109456.1 12087 SSGQLVLNQTPESLEVSPGDRVTINCKVISSVNSHYMAWYQQKSGQAPKLLVYSASTRPSGIPDRFSSSESGMDYTFTINQVEADDAGDYYC
Chrysemys picta bellii V372 ighv AHGY02109394.1 2844 VRSQALVESGEDVKKPGDSLRLSCKASGFTFSSSSMHWIRQATGKGLEWVTAINPGGSSTYYLDSVKGRFTISRDNSKSELYLQMTGLKPEDTARYYCAG
Chrysemys picta bellii V371 ighv AHGY02109393.1 3366 ARSQVVLTQSGPEMKKPGESTQLKCAVSGFTVSGYYMVWLRQEPGKELEWLVSYHTPSSTNYYSDSIKGRFTASKDSSNFYLQMTSLRAEDTAVYYCAR
Chrysemys picta bellii V370 ighv AHGY02109390.1 2413 VWSQVQLVESGGDVKKPGDSLRLSCKASGLTFSSYYMHWVRQAPGKGLEWVAIIYTDGSTDYLDSVKGRFTISRDDSKSELYLQMTGLKPEDTARYYCVR
Chrysemys picta bellii V369 ighv AHGY02109388.1 1275 VRSQVQLVESGGDVKKPGDSLRLSCKASGFTFTSYWMGWVRQAPGKGLEWLTWIHGSSIYYSDSIKGRFTVSRDDPNSLLYLQMTGLKPEDTARYYCAR
Chrysemys picta bellii V368 ighv AHGY02108979.1 206 VWSQVQLVESGGDVKKPGDSLRLSCKASGFTFSDYQMEWVRQAPGKGLEWVALVSKPTGSTQHYSPAVQGRFTISRDNSVNMVYLQMTSLKPEDTARYYCA
Chrysemys picta bellii V367 ighv AHGY02108976.1 3172 VRSQVQLVESGGDVKKPGDSLRLSCKASGFTFSSYQMDWVRQAPGKGLEWVAFINTGGGTVYYPDSVKGRFTISRDNSKSELYLQLTGLKPEDTAHYYCAR
Chrysemys picta bellii V366 ighv AHGY02108976.1 3172 VRSQVQLVESGGDVKKPGDSLRLSCKASGFTFSSYQMDWVRQAPGKGLEWVAFINTGGGTVYYPDSVKGRFTISRDNSKSELYLQLTGLKPEDTAHYYCAR
Chrysemys picta bellii V365 ighv AHGY02108976.1 10491 ARPQVQLVESGGDVKKPGDSLRLSCKASGFPFSSYLMDWIRLAPGKGLEWLARAAAQGSTYYADSVQGRFTISRDNANSLVHLQISSLREEDTALYYCVR
Chrysemys picta bellii V364 ighv AHGY02108975.1 1375 ALSQVQLVESGGDVKRPGDSLRLSCKASGFTFSSNWMHWVRQAPGKGLEWIARIYSSSINYSDSVKGRFTISRDDSKSELYLQMTGLKPEDTARYYCA
Chrysemys picta bellii V363 ighv AHGY02108975.1 4796 VLSQVQLVESGPGTVKPSETLSLTCSISGASSDTLGSNCCWWHWIRQSPGKGLEWIGDIAQGGSTNYAASLQSRITISVNPSKNQFSLQLRSLTAADTATYYCAR
Chrysemys picta bellii V362 ighv AHGY02108975.1 9943 VRSQSLVESGGDVKKPGDSLRLSCKASGFTFSSYGMIWVRQAPGKRLEWVAYTSNDGGTIYYLESVKGRFIISRDDSKSELYLQMTGLKPEDTARYYCA
Chrysemys picta bellii V361 trav AHGY02108935.1 11 GSCQAEVHQNLSAVTWEGQSGSISCHYTTSNFWSLQWFRQLPGGQPVSLLILVSDGKQTKEPNLTAELDKGKRLSSLHIRESQLGDAATYFCAVA
Chrysemys picta bellii V360 trav AHGY02108930.1 1939 NGEPVTQPDARVTVSQGEPVLLKCTYDPSQSPRLWWYEQYPNEAPRLLLGDYEAFSDEERRSRRGFSATPDKQGKTFHLKKSSSELRDSAVYYCAMSDTVI
Chrysemys picta bellii V432 igkv AHGY02117407.1 528 SYGQVTMTQSPESLSVTPGEKVTIRCTASSIISSSYVSWYQQKSGQAPKLLIYRASTLASGVPARFSSSGSGTAYTLSISSVEADDAADYYCLQTHSSP
Chrysemys picta bellii V431 trav AHGY02117243.1 959 SALGDSVKSNEPEVSGSVGGSVTLSCSYTTSDSYVYLYWYRQYPNQAPQYILWRGAKSYSGQSHTANFAQKRFSSQADDSSTVLSIAALELADSAVYYCALWR
Chrysemys picta bellii V430 ighv AHGY02117137.1 2552 ARSQVVLTQSGPELKKPGESTQLKCSVSGFTITDYYMDWVRQEPGKGLEWLVHYWKPGSEYYSPTIKGRFTASKDSSNFYLQMNSLKAEDTAVYYCAR
Chrysemys picta bellii V429 ighv AHGY02116992.1 2709 VRSQVHLVESGGDVKKPGDSLRLSCKASGFTFSSYYVGWVRQAPGKGLEWLTWIHGSSIYYSDSIKGRFTISRDDPNSLLYLQMTGLKPEDTARYYCAR
Chrysemys picta bellii V428 iglv AHGY02116987.1 604 SLSQVTLTQPPSVSVSIGNTVKLSCAFDNRYTFGSVLWYQQKDGNSPRYLLSYNSDSDKHQGSGVPSRFSGSKDASNTICYLTITSVQAEDEADYYCAAYASGA
Chrysemys picta bellii V427 iglv AHGY02116986.1 623 ASSQPTLTQPPADSVSLGNTVKLSCTLSSQHSSYTVEWYQQRDGQVPRFLWYGSSTKGDGVPDRFTVSSSGAIRYLTITSVQPEDEATYYCGAGYSDE
Chrysemys picta bellii V426 trav AHGY02116761.1 468 AVLSDSVRSNEPEVSGSEGDTVTLGCSYETSYTAGVYLFWYRQYPNRAPQYILRRGAKGITFSDTADFAQERFSSQADDSSTVLNITSLELADTAVYYCALQRAQ
Chrysemys picta bellii V425 trav AHGY02116760.1 5547 SALGDSVKSNEPEVSGSVGGSVTLSCSYTTSDSYVYLYWYRQYPNQAPQYILQRGAKSYSGQSHTANFAQKRFSSQADDSSTVLNITALELADSAVYLCALRL
Chrysemys picta bellii V424 trdv AHGY02116444.1 7037 PVAGNSVTQIRASASAREGRPVKLNCQYSTTYTYYALGWYQQLPGQQPLFLLYRNERGNEHKPRSVAARFSSELSTDVKSFTLSIDGAQRADSAMYFCALWD
Chrysemys picta bellii V423 ighv AHGY02116185.1 1358 VLSQVQLKETGPGAAKSGESLTLTCTISGDSVSSTRATWDWFRQPAGKRPEWMGCTWYRSGSWYTEYPSSLQSRMTITQDTSKNQFSLQLRSLTAADTATYYCSGR
Chrysemys picta bellii V422 ighv AHGY02115941.1 712 VLSQVQLVQSGLGTVKPGETLTLTCAVSGVSITDSSYAWHWIRQPPGKGLEWMGYVYPYSSGSTSYAPSLQGRITISGDTAKNQFSLQLRSLTAADTTTYYCARQ
Chrysemys picta bellii V421 igkv AHGY02115852.1 5029 SSGQIVLTQTPESLAVSPGDRVTINCKASSSVGSWMAWYQQKSGQAPKLLIHQASTRPSGIPDRFSGSGSGTDFTFTISRFEADDAGDYYCQQYSS
Chrysemys picta bellii V420 ighv AHGY02115839.1 2595 VLSQVQLKETGPGAVKPGGSLTLTCTISGDSVSSTSVTWDWIRQPVGKGLEWVGRIYYRPSQWYTNYASSLQSRTTIAQDTSKNQFSLQLRSLTAADTAMYYCARE
Chrysemys picta bellii V419 iglv AHGY02115681.1 1378 SLSQYTLTQPPSVSMSIGNTVKLSCAIDSGYTFGDVAWYQQKDGKSPRYLLRYNKETNKQQGSGVPSRFAGSKDASNTTCYLTITSVQAEDEADYYC
Chrysemys picta bellii V418 trav AHGY02115660.1 1188 DSVTQTDGSVIISRGEPVHLNCTYQFSASVTVAYPFWYVQSPNQPPKLFLRDLGREDSDEGIIKGFDATHDKKNKSFHLWKPSSELSDSATYYCAASDTV
Chrysemys picta bellii V417 iglv AHGY02115638.1 213 SLTQYVLTQPSSVSVSPGQNAQLTCSGNNIGSKDVRWFQQKPGSAPLLVMYENSKRPSGIPDRFSGANSGNTATLTITGVQAQDEADYYCQAWDSSSAQ
Chrysemys picta bellii V416 iglv AHGY02115638.1 5224 SSSQTVVTQPPSVSVSPGNTVKLSCTLSSGTGIGDYYVYWYQQKPGNSPRYLLYYYSDSDKHQGSGVPARFSGSKDTSSNAGYLTISGALAEDEADYYCAVRKS
Chrysemys picta bellii V415 iglv AHGY02115637.1 102 CLAQYVVTQPPSMSVSPGQNAKLTCSGNNIGSNIVHWYQQKPGSAPVLIIYDDSSRPSGIPDRFSGANSGNTATLTITGVQAQDEADYYCLVYDSSSDQ
Chrysemys picta bellii V414 ighv AHGY02115332.1 3023 AADPDRPGAVKAGETLSITCKVSGVSVSSYYWSWVRQPPGKGLEWMGIIRHTVNGGSTEYNSAFTPHVTITRDTSKDEVYLQLGSRTAADTSTYYCA
Chrysemys picta bellii V413 ighv AHGY02115332.1 6503 VLSQLHLQESGPGVVKPGETLTLTCTVTGGTITSSYWWNWIRQAPGQGLEWMGLWTGSTSYAPSLQGRITITVDSSNTKYYLRLSSLTATDTGTYYCARDTV
Chrysemys picta bellii V412 ighv AHGY02115081.1 4901 VLSQVQLKEIGPQAVKPGESLTLTCTISGDSVSSTRATWDWFRQPAGKRPEWMGCTWYRSGSWYTEYPSSLQSRMTITQDTSKNQFSLQLRSLTAADTATYYCSGR
Chrysemys picta bellii V411 ighv AHGY02115081.1 8383 ARSQVVLTQSGPEVKQPRESTQLKCTMSGFVPNDRWMAWVRQQPGKGLEWLVRYHQSSVTNYHSPSVQGRFTASKDSSNFYLQMTSLKAEDTAVYYCAR
Chrysemys picta bellii V410 ighv AHGY02114982.1 186 AWSQVQLVESGGDVKKPGDSLRLSCKGSGYTFSSHQMSWVRQAPGKGLEWIAFIDVTTIYYADSVKGRFTISRDNSNSLLYLEMTGLKPEDTARYHCA
Chrysemys picta bellii V409 ighv AHGY02114981.1 1014 VRSQVQLVESGGDEKKPGDSLRLSCKASGFTFSSAYMDWVRQAPGKGLEWVAEIRPDGSSQSYSPAVKGRFTISRDNSKSELYLQMTGLKPEDTARYYCG
Chrysemys picta bellii V408 ighv AHGY02114978.1 3059 VWSQALVESGGDVKKPGDSLLLSCKASGFTFSNYWMHWVRQAPGKGLEWVTAINTGGSSTYYLDSVKGRFTISRDNPKSELYLQMTGLKPEDTARYYCAR
Chrysemys picta bellii V407 ighv AHGY02114542.1 104 AWSQVHLVESGGDVKKPRDSLRLSCKASWFTFSSYTMSWVRQAPRKGLEWVSCIYSDGSQQYYADLVKVQFTISRDNPNNLLYLQMTGLKPEDTARYHCA
Chrysemys picta bellii V406 ighv AHGY02114541.1 2786 QLKETGPGAVKPGESLTLTCTISGDSVSSTSVTWTWIRQPVGKGLEWVGRIYYRPSQWYTNYASSLQSRTTITQDTSKNQFSLQLRSLTAADTATYYCARE
Chrysemys picta bellii V405 ighv AHGY02114540.1 371 ARAQVVLTQSSPEIKKPGESTKLTCAMSGFALSSTSMYWIRQAPGKGLQWLIYYYSSSNNNYSPAIQGRFTASKDSSNFYLHMTSLRAEDTAVYYCA
Chrysemys picta bellii V404 ighv AHGY02113623.1 4238 VWSQVQLVESGGDVKKPGDSLRLSCKGSGYTFSSHQMSWVRQAPGKGLEWIAFIDVTTIYYADSVKGRFTISRDNSNSLLYLEMTGLKPEDTARYHCA
Chrysemys picta bellii V403 ighv AHGY02112250.1 187 ARSQVLVESGGDVKKPGDSLRLSCKASGFTFSSAYMNWVHQAPGKGLEWVAHINPSLGIVYLDSVKGRFTISRDNSKSELYLQMTGLKPEDTARYYCAR
Chrysemys picta bellii V402 ighv AHGY02112246.1 2951 VQSQALVESGGDVKKPGDSLRLSCKASGFTFSSYDMSWVRQAPGKGLEWVAVIYTGGSSTYYLDSVKGRFTISRDDSKSELYLQMTGLKPEDTARYYCAR
Chrysemys picta bellii V401 ighv AHGY02112243.1 2046 ARSQVQLLESGGDVKKPGDSLRLSCKASGFTFGDYWMSWVRQAPGNGLEWVAAISYWAGSTIHYANAVKGRFTISRDNANSLLYLQMTGLKPEDTALYYCA
Chrysemys picta bellii V400 ighv AHGY02112214.1 673 ARSQVQLVESGGDVKKPGDSLRLSCKASGFTFSSTYMHWVRQAPGKGLEWVSAISSSGSTYYPDSVKGRFTVSRDNSKSELYLQMTGLKPEDTGRYYCAR
Chrysemys picta bellii V399 ighv AHGY02112214.1 4926 VRSQVQLVESGGDVKKPGDALRLSCKASGFTFSDYWMHWVRQAPGKGLEWVAGINSGTGTSTYYADTVKGRFTISRDNPNNLLYLQMTGLKPEDTARYHCAG
Chrysemys picta bellii V398 ighv AHGY02112212.1 2230 VRSQVQLVESGGDVKKPGDSLRLSCKASGFTFSSYYMDWVRQAPGKGLEWVAQIRPDASKQWYSPAVDGRFTISRDNPNNLLYLQMTGLKPEDTARYYCA
Chrysemys picta bellii V397 iglv AHGY02111999.1 1201 FSSQQLQSLKASEFVSPGGTVTLSCSLSSGALTDHNHPLWVQQRLGNVPRLIMHSTSTRPSGIPERFTGSRLGNTMSLTITGALAEDDADYYCSVWAVS
Chrysemys picta bellii V441 iglv AHGY02118999.1 827 SLSQFTLTQPPSVSVSIGNTVKLSCALSSGYTFGSVRWYQQKDGNSPRYLLRYNKESDKHQGSGVPSRFAGSKDASNTTGYLTITSVQAEDEADYYCTAWSGSA
Chrysemys picta bellii V440 trav AHGY02118812.1 467 FVQGDAVFQTLPEVTVSEGHDVLLPCNFTTISNTPKLFWYRQYPNQPPQHILTAYKSAAEKNTFTSGKFSTVLIDDNKTVPLKIGAVSLQDRAVYYCALR
Chrysemys picta bellii V439 ighv AHGY02118467.1 1033 VRSQVQLVESGGDVKKPGDSLRLSCKPIGFKVRDYWMMWVRHAPGKGLEWVSSIYWNRYYADSVKGRFTISRDDSNNLLHLDMTGLKPEDTARYYCERY
Chrysemys picta bellii V438 iglv AHGY02118179.1 135 SSYQFTLTQPLTMSVTPGETAQLACVLSSGDSISSRYIYWYQQKQGEKPRYLLYYKDDSTQGKGSGVPDRFTASKDTSRNTCFLTISRAEAEDDADYYCTGWD
Chrysemys picta bellii V437 igkv AHGY02118117.1 780 SSGQTVMTQSPESLAVPVGGRVSINCKASTSIGTCLNWYQQKPGQAPKLLIYRASSLQSGVPARFSGSGSGTDFSFTISSVEADDAGDYYCQQCGSYP
Chrysemys picta bellii V436 ighv AHGY02117782.1 200 VRSQVKLLQTGAAQVKPSQTLRLTCSVSGFSLTSSGYGVSWVRQPPGKGLEWLSIVYWDEDKYYQESLKNRLTISRDTSKSEVYLEMRGMEARDSGTYYCTR
Chrysemys picta bellii V435 ighv AHGY02117763.1 3026 AWSQVVLTQSGPELKKPGESTRLKCAVSGFAVSGDYMAWVRQEPGKGLEWLVSYWKPGQSDYYSPTIKGRFTASKDSSNFYLQMNSLKAEDTAVYYCAR
Chrysemys picta bellii V434 trav AHGY02117529.1 3489 APGRAKIQQPVSAEALEGAELNLTCSHPSARADNIFWYRQFPNRGPEFIVTGFSGTAHSPDPEGTLHISKDKENSTFALRRVRLADAAVYYCARS
Chrysemys picta bellii V470 ighv AHGY02136611.1 139 ALAQLQLVASGPGVGKSSESLSLTCAVSGESITTSGFTGHWYRQDPGKGPEWLGLIYWDGDTRYAPSLQDRTTISADTAKNQFSLQLRSLTAADTATYYCARS
Chrysemys picta bellii V469 ighv AHGY02135662.1 354 VLCQVQLVQSGPGAVKPGETLTLTCAVSGFSITSSGYGWNWVRLPPGEGLQWLGYIGASGGTGYTPSLHCRLSFSRDTAKNALSLQLRSLTATDTATYYCTR
Chrysemys picta bellii V468 iglv AHGY02135385.1 1011 SLAQYVLTQPPSVSVSLGQKAQLTCSGNNIGDKSVQWYQQKPGSAPVLVIYHDSNRPSGIPDRFSGANSGNTATLTITGVQAQDEADYYCQVYDSSSDQ
Chrysemys picta bellii V467 ighv AHGY02135126.1 976 VRSQVQLVESGGDVKKPGDSLRLSCKASGFTFSSYAMSWVRQAPGKGLEWVSYIYTDGSQQFYRDSVKGRFTISRDNPNNLLYLQMTGLKPEDTARYHCA
Chrysemys picta bellii V466 trav AHGY02134366.1 263 IYGADSVTQTDGSVIISRGEPVHLNCTYQFSASVTVAYPFWYVQSPNQPPKLFLRDLGREDSDEGIRKGFDATHDKKNKSFHLWKPSSELSDSGTYYCAASDTV
Chrysemys picta bellii V465 trav AHGY02134174.1 668 ETHGLLVTQTQGSIPLSEGASLLLDCTYQSSVPVCTFWYVQYPTEAPRLFLRDSEEQDKEGDRKGFKVKHDKNSYPLRKNSTQLSDSAVYCCAMS
Chrysemys picta bellii V464 ighv AHGY02134005.1 552 ALSQLQLVASGPGVGKVSEPLTLTCAVSGVSIASQDHVWYWLRQSPGEGLESMGGVYPYDGDTRYAPSLQGRITISADTAKNQVSLQLRSLTATDTANYYCARG
Chrysemys picta bellii V463 trav AHGY02132825.1 1054 ALGQYTVTQDQPQAAAHEGEPTQLNCSYTGTEDSVHWYRQPQGGQPRFVALLSSSGRDTRENFTMSLDTKTKSSFLYLNSSRLEDSAVYLCAL
Chrysemys picta bellii V462 ighv AHGY02132722.1 437 AQTQVVLIQSGPEMKKPGEYTRRKCTVSGFTVTSYYMAWVRQEPGKGLEWLVRYHTPTATNYYSDSIQGRFTASKDSSNFYLQMTSLKPQDTVMYYCAR
Chrysemys picta bellii V461 igkv AHGY02132642.1 312 SNGQIVMTQTPESLAVSPGDTVTIRCKASSSLTSGSYHYLAWYQQKSGQAPKLLIYLASTLQSGVPARFSGSGSGTDYTLTISKVEAEDAGDYYCQQSRS
Chrysemys picta bellii V460 iglv AHGY02132101.1 74 TSSQYVVTQEPSLLVSPEGTVKLSCSVSIVSDITSIYPYWFQQRGGGVPRLLIYNANVKVSGTPERFSGSSSGNTAYLTIKGALAEDEADYYC
Chrysemys picta bellii V459 trav AHGY02131455.1 771 SSMEDAVTQTQPAVSGVERESVSLDCTYETATSSYYLYWYKRPPGESLNFLIRQHSGGTKRNEAGERFSVNLEKSKSSVSLRITALELGDAAMYFCAFSR
Chrysemys picta bellii V458 trav AHGY02130739.1 398 ALGQYTVTQDRSQAAAHEGEPTQLNCSYTGTEYSVHWYRQPQGGQPRFLSSLSSSGRDTRENFTMSLDTKTKSSFLYLNSSRLEDSAVYLCAL
Chrysemys picta bellii V457 ighv AHGY02130646.1 1159 VRSQVQLVESGGCVKKPGDSLRLSCEASVSTFTDYCMRWIRQAPGKGLEWVAALSSGSRLSQWCSKGVKGRFTISRDNSVNTAYLQMTGLKPEDTAR
Chrysemys picta bellii V456 ighv AHGY02130320.1 1843 VRSDVQLVESGGVKKPRDSLRLSCKTSGFTFADYNMHWIRQAPGKGLDWVAYISGPSGTYIGYSQAVKGRFTISRDNSNSLLNLQMSDLKAEATGLYYCARE
Chrysemys picta bellii V455 ighv AHGY02124501.1 445 DPVRSREGETRRRSQTDLCHVRLLQSQESLLELDLAPSGMRLEWMGDIRFNGEVVYAPSVRDRATISRDISKSEFYMPLSSLIPTDTATYYCVREDTAV
Chrysemys picta bellii V454 igkv AHGY02123845.1 2708 ASAQPTLTQPASESVPPGGTIKLSCTMSSGTSISGYYIYWFQQTAGKPPRYLLSYKDESSKHQGSGVPARFSASKDTSSNICYLTITGIQAEDDADYYC
Chrysemys picta bellii V453 ighv AHGY02122410.1 1732 VQSQVQLVESGGGVKRPGESVRITCKASGFPFSDSYLSWLRQAPRKGLEWVGDINPNGSDIRYLDSVKSRFTISRDNSKSELYLRITNLQSEDEADYYCAR
Chrysemys picta bellii V452 ighv AHGY02122168.1 2043 ARSQIQLVQSGPGVVKPGETLSLTCTVSGYSISSGYHWAWIQQAPGKGLEYMGHVYAASGSTNYAPTFQGRITISADTAKNQFSLQLRSLTAADTATYYCA
Chrysemys picta bellii V451 ighv AHGY02122168.1 2043 ARSQIQLVQSGPGVVKPGETLSLTCTVSGYSISSGYHWAWIQQAPGKGLEYMGHVYAASGSTNYAPTFQGRITISADTAKNQFSLQLRSLTAADTATYYCA
Chrysemys picta bellii V450 ighv AHGY02121447.1 903 AHSQVQLVESGGDVKMAGESISISCKASGFTFGDYWMHWYRQAPGKGPEWVSAISYWAGTDKRYAESVKGRFTISRDNPNNLLYLQMTGLRPEDTAVYYCQR
Chrysemys picta bellii V449 ighv AHGY02121227.1 513 VRSQVKLLQTGAAQVKPSQTLRLTCSVSGFSLTEYGYRVSWVRQPPGKGLEWLSAADWEDDKYYQESLKNRLSISRDTSKSEVYLEMRGMEAGDSGTYYCARS
Chrysemys picta bellii V448 igkv AHGY02120626.1 733 VSGQTVMTQTPESLAVSPGDRVTINCKASSSVSSYMSWYQQKSGQAPKLLIYGASTRVSGVPDRFSGRGSDTDFTFTISRVEADDAGDYYCQGYN
Chrysemys picta bellii V447 ighv AHGY02120307.1 1874 VLSATQLVQSGPGAVKPGDTLTLTCAVSGTSISSDTAWHWIRQPPGTGLEWMGWVYPYGRSTGYASSLQGRTTISADTAKNQFSLQLRSLTAADTGTYYCARQ
Chrysemys picta bellii V446 igkv AHGY02119810.1 924 SHGDIVMTQTPESLAVSPGDRVTINCKASSSVSSYMAWYQQKPGQAPKLLIHSASTRPSGIPDRFSGCGSGTDFTFKISRVEADDTGDYYCQQGNYWP
Chrysemys picta bellii V445 ighv AHGY02119754.1 1785 AISQLQLVASGPGVGKVSEPLTLTCAVSGFSINTRYYYWYWLRQAPGEGLESMGWVYPYDGGTRYAPSLQGRVTISADTARNQFSLQLHSLTATDTATYYCARR
Chrysemys picta bellii V444 igkv AHGY02119332.1 1756 TLLTQTPESVAVSPGDTIIINCKASSSMMGLLTWYQQKPGQAPKVLLYNASTLLPGVPAQFHGSQAGSSVTDYSLLVSTVQTEDEGDYYCQPFYGTP
Chrysemys picta bellii V443 ighv AHGY02119123.1 3248 VYSQISLVESGGGIKNPGETLRLTCTVSGFSLTSYAVHWARQPALKGLQWMGGIWAGGGNNCNDGLKSRLPITRDTSKNRVFLQLTGLRPADTSVYYCA
Chrysemys picta bellii V506 trav AHGY02164096.1 251 AVLGESIQSNKPEVSAGEGDNVTLSCSYNTSYSDVSLYWYRQFPGQGPQYVLRTGAKAYSSVRDFAEFARKRFTPQADDRSTALSITLALADTAVYYCALQRAQ
Chrysemys picta bellii V505 ighv AHGY02162541.1 348 ARTQIQLVQSGPGMVKPQETLILTCSVSGYTISSGFNWGWIRQAPGKGLEYMGYTYGPSQVTSYTPAFQSRITIAIDSSKNQFSLQLRSLTPADTATYYCAR
Chrysemys picta bellii V504 ighv AHGY02160308.1 1092 VRSQVQLVESGGDVKKPGDSLRLSCKASGFTFSSYYMSWVRQAPGKGLEWVSYISDGGGTIQYLDSVKGRFTISRDNSKSELYLQMTGLKPEDTARYYCAG
Chrysemys picta bellii V503 ighv AHGY02160308.1 4416 AQTQVVLIQSGPEMKKPGEYTRRKCTVSGFTVTSYYMAWVRQEPGKGLERLVRYHTPTATNYYSDSIQGRFTASKDSSNFYLQMTSLKPQDTAMYYCAR
Chrysemys picta bellii V502 igkv AHGY02159377.1 505 STGDIVLTQTPESLAVSPGDRVTINCKASSSIKVFLGSSYLAWYQQKPSQALQFLIYDASTRASGIPDRFSGSGSGTDFTLTISSVQAEDAGDYYCQQGFETP
Chrysemys picta bellii V501 ighv AHGY02158870.1 393 ARTQIQLVQSGPGMVKPQETLILTCSVSGYTISSGFNWGWIRQAPGKGLEYMGYTYGPIQVTSYAPAFQSRITIAIDSSKNQFSLQLRSLTPADTATYYCTR
Chrysemys picta bellii V500 ighv AHGY02158489.1 4201 VLSQVLVQSGQGVVKPGDTLTLTCAVSGFSITTQHYDWHWIRQPPGKGLEWMGRVYPYSSGATNYAPSLQARITISADTAKNQVSLQLRSLTAADTATYYCARR
Chrysemys picta bellii V499 ighv AHGY02157767.1 876 VLSPVQLIPSGPGAVKPGETLALTCAVSGVSIIDGSYAWDWVQQPPGKGLEWVTRIYPPDGGKWFAASLQSRTIISSDTSKNQFSLQLASLAAADTATYYCARDTQ
Chrysemys picta bellii V498 ighv AHGY02157094.1 681 VLSQVQLVQTGPGAVKPSETLSITCKVSGVSVSSNYWGWVRQPPGKGLEWMGRMRSTADGGTTDYSSAFSSRITITRDTSKDEVYLQLRSLTATDTGTYYCAR
Chrysemys picta bellii V497 ighv AHGY02156534.1 191 AFSQAQLVESGEGVKKPGDSLRLSCQASGFTFTLDQTGPWEGIGVDQGNTPNFNYHQLRTALQGTLHHLQNNPKMAYLQLSSLRPEDTALYYCSRI
Chrysemys picta bellii V496 ighv AHGY02156347.1 4929 VRSQVQLVESGGDVKKPGDSLRLSCKASGFTFSSYWMNWVRQAPGKGLEWVATITSSAGSTYYPDSVKGRFTISRDDSKSELYLQMTGLKPEDTARYYCAR
Chrysemys picta bellii V495 iglv AHGY02155838.1 1896 SCAQHVVTQPPSMSASPGQTVKLSCSVSGGYDISSDGISWYQQTPGNPPRYLLYYLSDSITDRGSGVPDRFSGSASGSVGYLTISGLQAEDDADYYCLTWDDSAEM
Chrysemys picta bellii V494 trav AHGY02155804.1 16 ANGESVTQPDDRVTVSQGEPVLLRCTYNTTLIPTLWWYEQRPNEAPRLLLTQYEASDEEARRSRRGFSATPDKQGKTFHLKKSSSELRDSAVYYCAMS
Chrysemys picta bellii V493 iglv AHGY02155783.1 20 SLAQYELTQPPSVSVSPGQNAQLTCSGDNITIYHVHWYQQKPGSAPVALIYQNSKRVPGIPDRFSGANSGNTATLTITGVQAQDEAVYYCRVWNNP
Chrysemys picta bellii V492 trav AHGY02155419.1 389 SCCEAQVVQSPEWLVTGEGKVSTMSCSFTSAYQTFQWYQQLPGQGPTHLLTASSNENVTLGRFIGERLENGKRSSLHITDSQLGDSGSYLCAVDAQ
Chrysemys picta bellii V491 trdv AHGY02154970.1 444 SVAGNSLTQIPASLPATEGERVEIRCQYSTSYASYALDWYQELPGKQPLFLLGRYSSGSEHKSSSVAPRFSSQLDKGAKSFKLTIDGAQRADSAVYFCALWD
Chrysemys picta bellii V490 igkv AHGY02154705.1 6386 ASAQPTLTQPASESVPPGGTIKLSCTMSSGTSISGYYIRWFQQTAGTPPRYLLSYKDESSKHQGSGVPARFSASKDTSSNICYLTIMGIQAEDDADYYC
Chrysemys picta bellii V489 iglv AHGY02151787.1 390 SLAQYVLTQPPAVSVSPGQNAQLTCSGNNIGSKDVQWFQQKPGSAPLRVIYGSGSGPSGIPDRFSGANSGNTATLTITGVQVQDEADYYCQVWDSSAQ
Chrysemys picta bellii V488 trdv AHGY02150196.1 39 SVAGNSLTQIPASLSATEGQRVEIRCQYSTSYTSYALDWYQELPGKQPLFLLRRYSGGSERKSDSLARRFSSQLDTRAKSFKLTIDGAQRADSAVYFCALWD
Chrysemys picta bellii V487 trav AHGY02149765.1 14 FVQGDSVFQSPLEVTVSEGHDALLQCNFTTAFTSPNLFWYRQYPNQPPQHILTAYKSPAEKNTFTAGKFSTVLFDANKTVLLKIEAVSLQDKAVYHCALR
Chrysemys picta bellii V486 iglv AHGY02148943.1 462 ASSQPTLTQPPADSVSLGNSVKLSCTLSSQHSSYSVGWYQQRDGQAPRFLWYGSSIKGDGVPDRFTVSSSGAIRYLTITNIQPEDEATYYCGAGYSIGS
Chrysemys picta bellii V485 trgv AHGY02148687.1 211 GCAQIHLRQTQLSITRAETKTARIVCEASGIQNFRSAVIHWYRHRPGEAPERILYISAVKVEFDKGSDDKFDCENNPDQPVSTLVVNGITTDDRAIYYCAYWD
Chrysemys picta bellii V484 trav AHGY02142786.1 695 SCCEAQVVQNPESLVTGEGKVSTMSCSFTSAYQTFQWYQQLPGQGPIHLLTASSNENVTVGRFIGERLENGKRSSLHITDSQLGDSGSYLCAVDAQ
Chrysemys picta bellii V483 ighv AHGY02142537.1 513 AQAQVRLEESGGGAANTGGSRRLSCTGSGFTFSSYDMFWYRQRPGEGLEWVSWISSTGGSTDYPDSVKGRFTVTRDNAKNQLYLQMSRLGPEDTARYHCAAR
Chrysemys picta bellii V482 ighv AHGY02141616.1 55 VRSQVQLVESGGDVKKPGDSLRLSCKASGFTFSSNYMSWVRQAPGKGLEWVAYIAGSGGDIQYLDSVKGRFTISRDNSKSELYLQMTSLRSEDTARYYCAK
Chrysemys picta bellii V481 iglv AHGY02141470.1 389 SSSQTVVTQPPSVSVSPGNTVKLSCALSSGTSIVDYYVSWYQQKSGNSPRYLLYYYTDSSKGQGSGVPARFSGSKDTASNAGYLTISGVLAEDEADYYCAVIKS
Chrysemys picta bellii V480 iglv AHGY02140827.1 275 SLAQYVLTQPPSVSVSPGQNSQPTCSGNNIGSKDVQWFQQKPGSAPLCVIYGSSSRPSGIPDRFSEANSGNTATLTITCVQVQDEADYYCQVWDSSAQ
Chrysemys picta bellii V479 trav AHGY02140691.1 546 ALGQYTVTQDQPQAAAHEGEPTQLNCSYTGTEYSVHWYRQPRGRGQPRFVALLSSSGRDTRENFTMSLDTKTKSSFLYLNSSRLEDSAVYLCAL
Chrysemys picta bellii V478 igkv AHGY02140335.1 32 SSGQIVLTQTPESLAVSPGDRVTINCKASSSVGGAIAWYQQKSGQAPKLLIYDASTRASGIPDRFSGSGSGTDYTFTISRVEADDAGDYYCQHYYGYP
Chrysemys picta bellii V477 ighv AHGY02140218.1 660 VLSEIRLVQWGPDQVKPTESARLTCAVYGTSVDGNNWSWIRQPPGRGLEWLGVIWSSGGTGYSSGIKDRIRITRDSSKGQVYLQLNNMKAADTATYYCAR
Chrysemys picta bellii V476 iglv AHGY02139341.1 565 SCAQYMVTQPPSMSASPGQTVKLSCSVSGGYNISSNGVRWFQQTPGNPPRYLLYYFSDSSTDRGSGVPDRFSGSASGSVGYLTISGLQAEDDADYYCLTWDDELRC
Chrysemys picta bellii V475 ighv AHGY02138836.1 135 ARAQVVLTQSSPEIKKPGESTKLTCAVSGFALSSTNMYWIRQAPGKGLEWLIYYYSSSDNSYSPAIQGRFTASKDSSNFYLHMTSLRAEDTAVYYCAR
Chrysemys picta bellii V474 ighv AHGY02138088.1 104 ARAQVVLTQSSPEIKKPGESTKLTCTVSGFALSSTSMHWVRQAPGKGLQWLIYYYSSSSNSYSPTIQGRFTASKDSSNFYLHMTSLRAEDTAVYYCAR
Chrysemys picta bellii V473 trav AHGY02137827.1 187 LTQGQTVIQPVGETKVKEGEFVTLDCSYNSGFPTLLWYRQESGGSPQFILHEGSRQEDLEERFRNRFKAKINKTSRVFPLDISSVQLSDSATYYCALR
Chrysemys picta bellii V472 ighv AHGY02137201.1 705 VRSQVQLVESGGDVKKPGDSLRLSCKASGFDFSSSSYGMNWVRQAPGKGLEWVAYISSSGGTIYYLDSVKGRFTISRDNSKSELYLQMTGLKPEDTARYYCAR
Chrysemys picta bellii V471 ighv AHGY02137060.1 64 VRSQVQLVESGGDVKKPGDSLRLSCKASGFTFSSYWMSWVRQAPGKGLEWVAFISTDGSTIYYPDSVKGRFTISRDNSKSELYLQMTGLKPEDTARYYCAR
Chrysemys picta bellii V523 ighv AHGY02195209.1 456 ARSQVQLVESGGDVKKPGDSLRLSCKASGFTFTEYDMHWVCQAPGKGLEWVAGISSPSGSNKWYSQAVEGRFTISRDNSVNTAYLQMTGLKPEDTARCYCAR
Chrysemys picta bellii V522 trav AHGY02190533.1 140 AVLSDSVRSKEPEVSGSEGGFVTLSCSYETSYTAGVYLYWYRQYPNRAPQYILLRGAKGNRASNTAGFAQKRFSSQADDSSTVLNIAALELADTAVYLCALRL
Chrysemys picta bellii V521 trav AHGY02188736.1 4 RLGEPNGRDRFSLRGDPVLLNCTYEFSGYPSPSWHVQDPNQPLQLFLRDVGREDSDEGVRRGFNAKAERKPASFHLGKASSKLSDSATYYCAVSDS
Chrysemys picta bellii V520 ighv AHGY02188681.1 2010 ARSQIQLVQSGPGVVKPGETLSLTCTVSGYSISSGYNWAWIQQAPGKGLEYMGNVYAASGSTYYAPTFQGRITISADTAKNQFSLQLRSLTAADTATYYCA
Chrysemys picta bellii V519 ighv AHGY02188681.1 2010 ARSQIQLVQSGPGVVKPGETLSLTCTVSGYSISSGYNWAWIQQAPGKGLEYMGNVYAASGSTYYAPTFQGRITISADTAKNQFSLQLRSLTAADTATYYCA
Chrysemys picta bellii V518 iglv AHGY02185187.1 116 SLAQYVLTQPPSVSVSPGQNAQLTCSGNNIGSKNVQWYQQKPGSAPLCVIYGSSSRPSGIPDRFSGANSGNMATLTITGVQAQDEADYYCQVYDSSSDQ
Chrysemys picta bellii V517 ighv AHGY02184632.1 190 ARSQVVLTQSGPELKKPGESTRLKCAVSGFAVSSDYMDWVRQEPGKGLEWLVHYWKPGSEYYSPTIKGRFTASKDSSNFYLQMNSLKAEDTAVYYCTRRE
Chrysemys picta bellii V516 igkv AHGY02182975.1 1870 ASGQIVMTQTPESLLVSPGDRVTINCKASANAYSFMAWYQQKSGQAPKLLIYLASNRASGVPDRFSGSGSGTDFTFTISRVEADDAGDYYCQQY
Chrysemys picta bellii V515 ighv AHGY02180720.1 940 ARSQVVLTQSGPEVKKPGESTQLKCAVSGFVPNDWWMDWVRQLPGKGLEWLVHYRQSSVTNYYSSSIQGRFTASKDSANFYLQMTGLKPEDTAMYYCA
Chrysemys picta bellii V514 ighv AHGY02179182.1 74 VLSQVQLVQSGPGVVKPGETLTLTCSITGYSVTNSYWEWVRQAPGKGLDWVGQIDWAASKWRIYYGPSFQSRATLSADSSKNQFSLQLRSLTAADTATCYCAR
Chrysemys picta bellii V513 ighv AHGY02177583.1 654 ARSQVVLTQSGPEVKKPGESTQLKCAVSGFVPNDWWMDWVRQLPGKGLEWLVHYRQSSVTNYYSPSIQGRFTASKDSTNFYLQMTGLKPEDTAMYYCA
Chrysemys picta bellii V512 igkv AHGY02177259.1 125 FSSQQLQSLKASEFVSPGGTVTLSCSLSSGAITDNSFPHWVQQRLGNVPQLIMHTTGTRPSGIPERFTGSRSGNTMSLTIKGALAEDDADYYCCVWTGSA
Chrysemys picta bellii V511 ighv AHGY02174581.1 499 RLVESREDIKKPGQSLRLTCKGSGFDFSQAGMHWLRQDPGKGLERVSMFFFSGSKEYYVASVKGPFTTSRNNSPNLAYLDISGLKPEDTARYYCAA
Chrysemys picta bellii V510 ighv AHGY02174581.1 2081 VRSQALVESGGDVKKPGDSLRLSCKASGFPFSSYLMDWIRLAPGKGLEWLARAAAQGSTYYADSVKGRFTISRDNANSLVHLQISSLRAEDTALYYCVR
Chrysemys picta bellii V509 ighv AHGY02170448.1 952 ARSQVVLTQSGPEVKKPGESTQLKCAVSGFVPNDWWMDWVRQLPGKGLEWLVHYRQSSVTNYYSPSIQGRFTASKDSTNFYLQMTSLKPEDTAVYYCA
Chrysemys picta bellii V508 ighv AHGY02168736.1 1787 VLSQVQLVQTGPGAVKPGATLSITCKVSGVSVSDYYWSWNRQPPGKGLEWMGFIRRTAAGGTTEYNSALKPRVTITRDTSKNEVYLQLGSLTAADTATYYCAR
Chrysemys picta bellii V442 ighv AHGY02119122.1 3605 VRSQVQLVESGGDVKKPGDSLRLSCKASGFTFSSYRMHWVRQAPGKGLEWVAIIYPGGSTIYYLDSVKGRFTISRDDSKSELYLQMTGLKPEDTARYYCAR
Chrysemys picta bellii V433 ighv AHGY02117452.1 1072 ARSQVQLLESGGDVKKPGDSLRLSCKASGFTFGDYWMSWVRQAPGNGLEWVAAISYWAGSTIHYANAVKGRFTISRDNANSLLYLQMTGLKPEDTALYYCA
Chrysemys picta bellii V396 iglv AHGY02111998.1 2820 SLAQFVLTQPPSASASPGQTVTISCARSSGNIGSYYVSWYQQKPGSAPKLIIYEWNKRPSGISDRFSGSTDTSANTASLTISGVQADDEADYYCDSYDSNSN
Chrysemys picta bellii V359 trav AHGY02108928.1 2608 ANGESVTQPDDRVTVSQGETVLLKCIYDTSYGTPTLWWYEQHPNEAPRLLLGDYEASNDEERRSRRGFSATPDKQGKTFHLKKSSSELRDSAVYYCAMS
Chrysemys picta bellii V330 ighv AHGY02104441.1 1875 VLSATQLVQSGPGAVKPGDTLTLTCAVSGTSISSDTAWHWIRQPPGTGLEWMGWVYPYGGSTGYDSSLQGRTTISADTAKNQFSLQLRSLTAADTATYYCTR
Chrysemys picta bellii V322 ighv AHGY02100086.1 1705 VRSQALVESGGDVKKPGDSLRLSCKASGFTFSSAYMNWVRQAPGKGLEWVAYISSSGSTIYYLDSVKGRFTISRDNSKSELYLQMTGLKPEDTARYYCAR
Chrysemys picta bellii V285 trdv AHGY02094451.1 4553 KGVLCNQITQTPSALTAEIGNQAKIFCNYATTYSNPDLYWYRQISDHTLQFILHRDNSRSRDADFAKGRFAVERDLAGKTFHLVISPVGSEDAASYYCAIR
Chrysemys picta bellii V251 trbv AHGY02067865.1 5168 LCSGVTVTQKEKFIAIQNGREARIPCEHDDKTYITVLWYQQKGAERQLQLVAFSVDGNPAVIEDQFKTRFNVTRPATLNTSLTINPGTVEDTAVYFCAASKAQ
Chrysemys picta bellii V248 trbv AHGY02067864.1 16303 GADVSFNQTLSLVLERGKTAELQCEQNINYDYMYWYQQLQGKGLHLIYYSYDTAKVEPGNISERVTAIRPQTQLFQLKISPVKPEDSAVYFCASSL
Chrysemys picta bellii V228 trgv AHGY02026071.1 5381 GAAQVQLTQDQLSITRNLMKTVRIDCKVSGINFGDAYLHWYRQRPGEAPEWILYFKTQTEKSNFDKEKFSIHKTTEKSTCTLTVDKLTYNDTATYYCAYW
Chrysemys picta bellii V211 trgv AHGY02026039.1 2546 GYSQITLIQTPLSVTRAVTKSASMRCKISGKSFNFNSAYIHWYRQSPGAAPKRILYIKSQSVTTDPGFDEKKFIADSYVSVSTSKLTVHQLTQEDSATYYCATWD
Chrysemys picta bellii V174 igkv AHGY02214933.1 3858 SSGQIVMTQSPESLAVPVGGRVSINCKASTSISDYLHWYQQKPGQAPKILITYTSILQSGVPARFSGSGSGTDFTFTISSVEAEDAGVYYCQQGNSFP
Chrysemys picta bellii V167 igkv AHGY02214912.1 8465 SNGQTVMTQTPESLSVSVGGTATIKCKASTSISNNIAWYQQKPGQAPKLLIYYASSRPTGIPDRFSGSGSGTDFTFTISRVEADDAGDYYCQQGNSFP
Chrysemys picta bellii V136 ighv AHGY02132518.1 55 ARPQVVLTQSGPELKKPGESTRLKCAVSGFTITDYYMDWVRQEPGKGLEWLVHYWKPGSEYYSPTIQGRFTASKDSSNFYLQMNSLKPDDTAVYYCTRRE
Chrysemys picta bellii V106 trav AHGY02112376.1 4185 AVLSDSVRSNEPEVSRSEGDTVTLGCSYETSYTAGVCLYWYRHYPNRAPQYILRRRAKGIRTRVTAGFAQERFSSLADDSSTVLNITSLELADTAVYYCALEP
Chrysemys picta bellii V99 igkv AHGY02110144.1 5550 SSGQTVMTQSPESLALPVGGRVSVNCKASTSITNDIHWYQQKPGQAPKLLISYASSLQSGVPARFSGSGYGTDFTFTISSVEADDAGDYYCQQSNSFP
Chrysemys picta bellii V81 iglv AHGY02105972.1 1014 CYAQVTQPPSEFVSPGGNVQLPCTLEGSYTVSANRVIWIQQRPGSVPRYLMYFYTESNKGMGSGVPSRFAGSRSGSDKIGYLTITGAQAEDDAVYYCVTWTGSA
Chrysemys picta bellii V61 igkv AHGY02101540.1 1063 SSGQIVMTQTPESLAVSPGDRVAINCKASASVTGDYTLLGWYQQKSGQAPKLLIYGATSRASGIPDRFSGSGSGTDFTLTISNVQAEDAGDYYCQQAYS
Chrysemys picta bellii V524 ighv AHGY02195582.1 130 VRSQVQLVESGGDVKKPGDSLRLSCKASGFTFSSSSMNWVRQAPGKGLEWIAYIKYDGSTINYLDSVKGRFTISRDDSKSELYLQMTGLKPEDTARYYCA
Chrysemys picta bellii V507 ighv AHGY02164286.1 519 VWSQIQLVETGGGIETSGGSLRLSCKASGFTFRNYCVNWVRQAPGKGLEWVSEIHNPAHNSAAYYSDAVKGRFTSSRDESRSSVYLQMNSLRAEDTARYYCVRR
Chrysemys picta bellii V30 trav AHGY02094390.1 403 IFGDSVTQTEGTVLVKEGAPLVIECTYETILFPYLLWYIQYPNEAPKLWLRDKTSGGGQDEGDKQGFFADHVQNKKSFDLKKSSSEVNDSAVYYCAFR
Chrysemys picta bellii V1 iglv AHGY02017561.1 38 SSSQTVVTQPPSVSVSPGNTVKLSCTLSSGTGIGDYYVSWYQQKPGNSPRYLLYYYSDSSKGQGSGVPARFSGSKDTSSNAGYLTISGALAEDEADYYCTVRKS
Chrysemys picta bellii Vs41 trgv AHGY01036318.1 338 GYAQIYLRQAQLSLTRAKTKTARINCEASGIQNFRSAVIHWYRHRRGEAPERILYISSAQPVFDKVSNENKFNCEKKPDQPISTLVVNEIAPNDEATYYCAYWD
Chrysemys picta bellii Vs40 trgv AHGY01036316.1 26 GAAQLTQDQLSITRKEKKTVRIDCKVSGINVGDAYIHWYRQRPGEAPEWILYFKSHAQNEQSNFDKDKFSVDKTTEKSTCTLTVDKLIYNDTATYYCAYW
Chrysemys picta bellii Vs211 trbv AHGY01190172.1 1249 HTDAEITQTPSLVLKRGETAQLTCRQTDNHNSMYWYHQQQGKGLQLIYYSLGKDSKQDGDSDIKNDFTAYRPQIEVFHLNTSSVKIEHSAVYFCASSL
Chrysemys picta bellii Vs45 trgv AHGY01036429.1 208 GAAQVQLTQDQLSITRNLMKTVRIDCKVSGINVGDAYIHWYRQRPGEAPEWILYFKSHAQNEQSNFDKDKFSVDKTTEKSTCTLRVDKLTYNDMATYYCAYWD
Chrysemys picta bellii Vs44 trgv AHGY01036361.1 790 VLWAIHLEQEQISVTKQPLQGSSAKFTCKVFGGSDSTYIHWYRARAGEAPQRLLYLTLSGSDLKREAGFSSEKLFAYGTQSISNLLVHRLEKTDSGRYYCATWDF
Chrysemys picta bellii Vs47 trgv AHGY01036435.1 1868 GEAQVLVQSQLSITRPEDMTVNLCSSVTGIIFNSAYIHWYRQMQLWNGFSIFHQENRSFDQDSEKAKFEAEKQLSESICVPIVKKLAKSDVAAYYCAAW
Chrysemys picta bellii Vs46 trgv AHGY01036434.1 2685 GSSQVRLTQPQLSITREENKTLRIDCHVSLSEDFGKTPIHWYRQRPGAAPERILPISTQLVFDGVSDKGKFNAEKKIGQSTCTLTINKITSSDIATYYCAYW
Chrysemys picta bellii Vs352 trav AHGY01258186.1 538 SSMEDAVTQTQPAVSGVEHESVSLGCTYETVASSYIFYWYKRPPGESLIFLSWQHSGGEKRNDAGERFFFSLEKSKSSISLRITALELGDTAMYFCAFSRD
Chrysemys picta bellii Vs353 trav AHGY01258194.1 1487 SCCEAQVDQSPEWLVTGEGKVSIMSCSFTSTYRTFQWYQQLPGQGPTHLLTASSNENVTLGRFTGERLESGKRSSLHITDSQLGDSGSYLCAVD
Chrysemys picta bellii Vs350 trav AHGY01258175.1 447 GSCQAEVHQNLSVVTWEGQNGSISCHYKTSKFWSLQWFRQLPGGQPASLLILVSDGKQTKEPNLTAELDKGKRLSSLHIRDSQLGDAATYFCAVA
Chrysemys picta bellii Vs351 trav AHGY01258177.1 656 ASGQLSVEQSPEWRGVSEGQNGTVTCTYSEVITSLHWYRQAPGERPLFLLMLFGKGSETQEPNFTADHDPGQKRSSLHIRGCRLGDTARYLCVVE
Chrysemys picta bellii Vs356 trav AHGY01258199.1 79 GATGVSVTQTKGPVSVSEGEGLRLNCSYDAAVYAVFWYVHLPSQPPRLLLRDVGRDDSDEGIRKGFDATHDKKDKSFHLWKPSSEQSDSATYYCAAS
Chrysemys picta bellii Vs357 trav AHGY01258200.1 142 APGRAEIQQPGSAEALEGAELNLTCSQPSTEAGDSTVWYRQIPNPGPQFAVTGYKETVNSPEPAGALHISAEREPSPLALSPVRRGDAAVYFCARR
Chrysemys picta bellii Vs354 trav AHGY01258195.1 2070 SCCEAQVVQSPEWLVTGEGKVSTMSCSFTSAFQAFQWYQQLPGQGPTHLLTASSNENVTVGRFIGERLESGKRSSLHITDSQLGDSGSYLCTVD
Chrysemys picta bellii Vs1104 igkv AHGY01283634.1 2142 SSGQIVMTQTPESLAVSPGDRVTINCKASSSVSGWVSWYQQKSGQAPKLLIYLASTRSSGIPDRFSGSGSGTDYTFTISRIEADDAGDYYCLQKTASFP
Chrysemys picta bellii Vs1070 ighv AHGY01274939.1 738 AQTQVVLIQSGPEMKKPGEYTRRKCTVSGFTVTSYYMAWVRQEPGKGLEWLVRYHTPTATNYYSDSIQGRFTASKDSSNFYLQMTSLKPQDTVMYYCAR
Chrysemys picta bellii Vs359 trav AHGY01258223.1 651 APGRAKIQQPGSADGLEGGELNLTCSHPSIKTNENVVWYRQFPNQGPQYIVSGFRETTHSTDPEGALHVSGDRKSSALALRRVRLADAAVYYCALS
Chrysemys picta bellii Vs1318 trav AHGY01397865.1 349 SVAGNSLTQIPASLSATEGQRVEIRCQYSTSYTSYALDWYQELPGKQPLFLLRRYSGGSERKSDSLARRFSSQLDTRAKSFKLTIDGAQRADSAVYFCALWD
Chrysemys picta bellii Vs1319 ighv AHGY01397875.1 6739 VLSQLHLQESGPGVVKPGETLTLTCTVTGGTITSSYWWNWIRQAPGQGLEWMGLWTGSTSYAPSLQGRITITVDSSNTKYYLRLSSLTATDTGTYYCAR
Chrysemys picta bellii Vs1314 ighv AHGY01395732.1 5140 ARSQVVLTQSGPEVKQPRESTQLKCTMSGFVPNDRWMAWVRQQPGKGLEWLVRYHQSSVTNYHSPSVQGRFTASKDSSNFYLQMTSLKAEDTAVYYCAR
Chrysemys picta bellii Vs1315 ighv AHGY01395732.1 1664 QLKEIGPQAVKPGESLTLTCTISGDSVSSTRATWDWFRQPAGKRPEWMGCTWYRSGSWYTEYPSSLQSRMTITQDTSKNQFSLQLRSLTAADTATYYCSGR
Chrysemys picta bellii Vs1316 trav AHGY01395974.1 318 FVQGDSVFQSPLEVTVSEGHDALLQCNFTTAFTSPNLFWYRQYPNQPPQHILTAYKSPAEKNTFTAGKFSTVLFDANKTVLLKIEAVSLQDKAVYHCALR
Chrysemys picta bellii Vs1310 ighv AHGY01395197.1 3363 VWSQALVESGGDVKKPGDSLLLSCKASGFTFSNYWMHWVRQAPGKGLEWVTAINTGGSSTYYLDSVKGRFTISRDNPKSELYLQMTGLKPEDTARYYCAR
Chrysemys picta bellii Vs1312 ighv AHGY01395538.1 1318 VRSQVQLVESGGDEKKPGDSLRLSCKASGFTFSSAYMDWVRQAPGKGLEWVAEIRPDGSSQSYSPAVKGRFTISRDNSKSELYLQMTGLKPEDTARYYCG
Chrysemys picta bellii Vs1313 ighv AHGY01395539.1 402 AWSQVQLVESGGDVKKPGDSLRLSCKGSGYTFSSHQMSWVRQAPGKGLEWIAFIDVTTIYYADSVKGRFTISRDNSNSLLYLEMTGLKPEDTARYHCA
Chrysemys picta bellii Vs680 iglv AHGY01411005.1 376 SLAQYVLTQPPSVSVSLGQNAQITCTGEKVDKQYVSWYQQKPGHAPVLVIYKDSERPSGIPERFSGASSGKTATLTITGVQAQDEADYHCHHNFKDSS
Chrysemys picta bellii Vs455 iglv AHGY01307865.1 2778 SVAGNSLTQIPASLQGTEGQRVEIRCQYSTSYTSYALDWYQELPGKQPRFLVGKFSYDLERKSDSVAPRFSAQLDKGAKSLTLSIDGAQRADSAVYFCALWD
Chrysemys picta bellii Vs454 ighv AHGY01307857.1 6682 AQSQMQLVESGGAVRNEGESIRLSCKGSGFTFSNYDMFWYRQSPGKSPEFVSRIYYDGTGIRYAAWVEGRFTISRDNAKSELYLAMSRLRREDTARYHCAAP
Chrysemys picta bellii Vs457 ighv AHGY01307868.1 2538 ARSQVQLAASGPGLGQVSEPLTLTCAVSGGSVTADYWDWYRQLPRGGLDWLGEIDWYNSQWRVDYTPSLQGRKTLSADSSKNQFSLRLRSLTAADTATYYCARR
Chrysemys picta bellii Vs456 ighv AHGY01307865.1 4386 VHSQIQLVESGGGVKTTGDSISISCKASGFTFGNYWMYWYRQAPGKAPEWISYINPDSTNADYAHSVKGRFAISRDNPNNLLYLQMTGLRPEDTAVYHCQR
Chrysemys picta bellii Vs451 trdv AHGY01307851.1 1843 SVAGNSLTQIPASLPATEGQRVEIRCQYSTSYTSYTLDWYQELPGKQPLFLMRRYSGGSERKSGSVAPRFSSQLDKGVKSFKLTVDGAQRADSAVYFCALWD
Chrysemys picta bellii Vs450 ighv AHGY01306989.1 508 VRSQALVESGGDVKKPGDSLRLSCKASGFTFSSYDMSWVRQAPGKGLEWVAVIYTGGSTYYLDSVKGRFTISRDNSKSELYLQMTGLKPEDTARYYCAR
Chrysemys picta bellii Vs453 ighv AHGY01307856.1 1596 VQSEVQLVQSGAEIKKPGESVKISCKTSGFTLTDYYMSWIRQTPGKGLVWLGRIDPEDGATSYADSVKDSVTISTDNSISTVYLQLRSLRTEDTAVYYCAR
Chrysemys picta bellii Vs452 ighv AHGY01307853.1 105 AQAQMRLVESGGGAANTGGSRRLSCTGSGFAFSSYTMFWYRQRPGEGLEWVSWISSSGGSTDYPESVKGRFTVSRDNAKNQLYLQTSRLGPEDSARYHCAAR
Chrysemys picta bellii Vs1471 ighv AHGY01550310.1 3511 VRSQVQLVESGGDVKKPGDSLRLSCKASGFTFSSAYMNWVRQAPSKGLEWVAYINPGGSTIYYLDSVKGRFTISRDDSKSELYLQMTGLKPEDTARYYCAR
Chrysemys picta bellii Vs1223 trav AHGY01345843.1 300 GSCQAEVHQNLSAVTWEGQSGSISCHYTTSNFWSLQWFRQLPGGQPVSLLILVSDGKQTKEPNLTAELDKGKRLSSLHIRESQLGDAATYFCAVA
Chrysemys picta bellii Vs459 ighv AHGY01307872.1 1590 ALSQLQLVASGPGVGKVSEPLTLTCAVSGFSINTQYYSWYWLRQPPGEGLESMGWVYPYDGDTRYAPSFQGRVTISADTARNQFSLQLHSLTATDTATYYCARG
Chrysemys picta bellii Vs458 ighv AHGY01307871.1 574 AQSQMQLVESGGAVRNEGESIRLSCKGSGFTFSSYTMFWYLQSPGESPEFVSRINYDGSNPYYAAGVQGRFTISRDNAKSELYLAMSRLRRGDTARYHCAARE
Chrysemys picta bellii Vs355 trav AHGY01258196.1 797 GAVDAKVSQPAARSFLAGGRADLPCNHSVAAYDIVIWYYQNPGVAPRAVISGYNSAETSGRFELSIDSRSRSAPLRITRVAVEDSGVYYCAVR
Chrysemys picta bellii Vs1269 ighv AHGY01363650.1 3341 VLSEVVLTQSGPEVRRPGEATILKCAVTGADHSTSIMTWIRQAPGKGLEWLVYYYSQASIFYSPAMQGRFTASMDSSSLYLQMHSLKEEDTAVYYCVRLGV
Chrysemys picta bellii Vs1385 trav AHGY01444195.1 695 FVQGDAVFQTLPEVTVSEGHDVLLPCNFTTISNTPKLFWYRQYPNQPPQHILTAYKSAAEKNTFTSGKFSTVLIDDNKTVPLKIGAVSLQDRAVYYCALR
Chrysemys picta bellii Vs1384 ighv AHGY01442815.1 1399 VRSQVQLVESGGDVKKPGDSLRLSCKASGFTFSSYYMSWVRQAPGKGLEWVSYISDGGGTIQYLDSVKGRFTISRDNSKSELYLQMTGLKPEDTARYYCAG
Chrysemys picta bellii Vs1260 ighv AHGY01358344.1 823 AQAQVRLEESGGGAANTGGSRRLSCTGSGFTFSSYDMFWYRQRPGEGLEWVSWISSTGGSTDYPDSVKGRFTVTRDNAKNQLYLQMSRLGPEDTARYHCAAR
Chrysemys picta bellii Vs767 iglv AHGY01503652.1 2315 VSSQPVVTQEPSMSVTPGGAVTLSCSLSSGAITTSNAPGWFQQKPGSAPRTLIYSTNSRPSGIPARFSGSISGNNAALTITGVQAVDEADYYCIVWTGSV
Chrysemys picta bellii Vs1389 ighv AHGY01449120.1 658 ARTQIQLVQSGPGMVKPQETLILTCSVSGYTISSGFNWGWIRQAPGKGLEYMGYTYGPSQVTSYTPAFQSRITIAIDSSKNQFSLQLRSLTPADTATYYCAR
Chrysemys picta bellii Vs1265 trav AHGY01359775.1 989 SCCEAQVVQNPESLVTGEGKVSTMSCSFTSAYQTFQWYQQLPGQGPIHLLTASSNENVTVGRFIGERLENGKRSSLHITDSQLGDSGSYLCAVD
Chrysemys picta bellii Vs1476 ighv AHGY01550328.1 2021 ARSQVLVESGGDVKKPRDSLRLSCKASRFTFSSYTMSWVRQAPGKGLEWVSGIYTAGSQQFDSVRGRFTISRDNPNNLLYLQMTGLKPKDTARYHCAG
Chrysemys picta bellii Vs1267 ighv AHGY01363650.1 20101 VYSQVSLVESGGGIKKPGETLRLTCTVSGFSITSYGVHWVRQSVGKGLEWMGVIWSGGNNNYNDALKSRLTITRDTSKSQVFLQLTGLQPADTSLYYCAR
Chrysemys picta bellii Vs1181 ighv AHGY01321404.1 371 VRSQVQLVESGGDVKKPGDSLRLSCKASGFTFSSYWMSWVRQAPGKGLEWVAFISTDGSTIYYPDSVKGRFTISRDNSKSELYLQMTGLKPEDTARYYCAR
Chrysemys picta bellii Vs1183 iglv AHGY01322237.1 400 SRAQPVLTQPASILVLPGQTVKLSCALNPGYNIREFGVSWYQQRPGSPPRYLLYYNSEVDKDKPSGIPDRFSASKDPASNACVLTIAAVQAEDHADYYCS
Chrysemys picta bellii Vs1182 igkv AHGY01321585.1 546 SSGQIVMTQSPELLSVPVEGKVSINCKASTSIGSKINWYQQKPGQAPKILIYAASNLQSGIPARFSGSGSGTDFTFTISSVEAEDAGDYYCQQDSNYP
Chrysemys picta bellii Vs1184 ighv AHGY01322465.1 1018 VRSQVQLVESGGDVKKPGDSLRLSCKASGFDFSSSSYGMNWVRQAPGKGLEWVAYISSSGGTIYYLDSVKGRFTISRDNSKSELYLQMTGLKPEDTARYYCAR
Chrysemys picta bellii Vs1187 ighv AHGY01323181.1 3219 VRSQVQLVESGGDVKKPGDSLRLSCKASGFTYSSAYMNWVRQAPGKGLEWVAYINPGGGTIRYLDSVKGRFTISRDNSKSELYLQMTGLKPEDTARYYCAAR
Chrysemys picta bellii Vs1186 ighv AHGY01323178.1 1734 RLVESGGDVKKPGQSLRLTCKGSGFDFSQAGMHWLRQAPGKGLEWVSVIFFDGSKEYYAASVKGRFTTSRDNSQNLAYLDMSSLKPEDTARYYCAA
Chrysemys picta bellii Vs1189 ighv AHGY01323190.1 1632 ARSQVQLVESGGDVKKPGDSLRLSCKASGFDFSSYYMSWVRQAPGKGLEWVGYISDDGSDIDYLDSVKGRFTISRDNSKNELYLQMTGLKPEDTARYYCAR
Chrysemys picta bellii Vs1188 ighv AHGY01323184.1 784 ARSQVVLTQSGPEVKKPGESTQLKCSVSGFVPNDWWMDWVRQLPGKGLEWLVHYRQSSVTNYYSPSIQGRFTASKDSANFYLQMTGLKPEDTAMYYCA
Chrysemys picta bellii Vs608 ighv AHGY01376618.1 2698 VLSQVRLVQSGPGIVNPGETFTLTCAVSGVPINDLSYSWNCIRQPPGKGLEWMGYVYPYNSRETGYAPSLQGRVTISADTAKNQVSLQLRSLTAADTAAYYCA
Chrysemys picta bellii Vs609 ighv AHGY01376619.1 679 VLSQVQLVQSGPGAVKPGETLTLTCAVSGVSITESNYVWDWVRQGPGKGLEWMGYVYMYSGGGTNYAPSLQGRITISGDTSKNQFSLQLRSLTTADTATYYCA
Chrysemys picta bellii Vs600 ighv AHGY01372525.1 3289 VHSQIQLVESGGDVKTTGDSISISCKASGFTFGNYWMYWYRQAPGKAPEWISYINTDSTNADYAHSVKGRFTISRDNPNNLLYLQMTGLRPEDAAVYHCQR
Chrysemys picta bellii Vs601 ighv AHGY01374407.1 968 VQSQVLVESGGDVKKPGDSLRLSCKASGFTFSSAYMNWVRQAPGKGLEWVAQIYPSGSSTYYLDSVKSRFTISRDNSKSEVYLQMTGLKPEDTARYYCAR
Chrysemys picta bellii Vs602 ighv AHGY01374408.1 1054 VRSQVQLVESGRDVKKPGDSLRLSCKGSGFTLSSYDMHWVHQAAGKGLEWVSRIYSDGSQQFYADSVKGRFTISRDNPNNLLYLQMTGLKPEDTARYYCA
Chrysemys picta bellii Vs603 ighv AHGY01374408.1 3609 VRSQVQLVESGGGIQTPGGSLRLSCKASGFTFSSYWMDWVCQAPGKGLEWVAEILEPVNNLAAYYSDAVKGRFTISRDESSSSVYLQMNSLKAEDTARYYCAR
Chrysemys picta bellii Vs604 ighv AHGY01374409.1 1571 ARSQVVLTQSGPALKKPGESHKLQCATSGFTFSSTWMGWVSQEPGKGLEWLTLYYSEGSKYYASSVQGRFTASKDSTNFYLQMTSLRAEDTAVYYCAR
Chrysemys picta bellii Vs605 trdv AHGY01375936.1 227 FSQGQGSVTQTQVQLAKLGGQTVTLECTFSTGYPDYYLFWYRQHRSGTMDFLFRIDYSNTEKNGAGRRFSAQFRKSSKFVSLTIKELEPTDSALYFCALRE
Chrysemys picta bellii Vs606 trav AHGY01375937.1 123 AVLSDSVRSNEPEVSRSEGDTVTLGCSYETSYTAGVCLYWYRHYPNRAPQYILRRRAKGIRTRVTAGFAQERFSSLADDSSTVLNITSLELADTAVYYCALEP
Chrysemys picta bellii Vs607 trav AHGY01375939.1 2922 AAFGNSVQSNEPEVSGSVGGSVTLRCSYTTSDSYVYLYWYRQYPNQAPQYILQRGAKSYSGQSHTANFAQKRFSSQADDSSTVLSIAGLELADTAVYLCALSL
Chrysemys picta bellii Vs1413 ighv AHGY01486910.1 2382 VRSQALVESGGDVKKPGDSLRLSCKASGFPFSSYLMDWIRLAPGKGLEWLARAAAQGSTYYADSVKGRFTISRDNANSLVHLQISSLRAEDTALYYCVR
Chrysemys picta bellii Vs1412 igkv AHGY01484837.1 853 VSGQTVMTQTPESLAVSPGDRVTINCKASSSVSSYMSWYQQKSGQAPKLLIYGASTRVSGVPDRFSGRGSDTDFTFTISRVEADDAGDYYCQGYN
Chrysemys picta bellii Vs784 ighv AHGY01526100.1 1184 VRSDVQLVESGGDVKKPRDSLRLSCKTSGFTFADYNMHWIRQAPGKGLDWVAYISGPSGTTIYYSQAIKGRFTISRDNSSNLLNLQMSDLKAEATGLYYCARE
Chrysemys picta bellii Vs787 ighv AHGY01527373.1 1316 AADGVWGGVKKPRDSLRLSCKASGFDFSSHWMEWVRQVLGKGLEWVAEINEAEWSQWYSPAVQGQFTISRDNPNNLLYLQMTGLKPEDTTRYHCA
Chrysemys picta bellii Vs786 ighv AHGY01527050.1 1453 CGAAITLTQPSSAQAEPGNSITLDCTVSGYNVNDRHMQWLRLPRGKNLVRIASFRPGYTIYIADEFKGRVTPSTSGSTGKLKIDGLTAADTATYYCATN
Chrysemys picta bellii Vs621 trav AHGY01382830.1 489 SSMEDAVTQTQPAVSGVERESVSLDCTYETAASSYYLYWYKQPSGESLNFLFQQYSGGTKRNEAGERFSVSLEKSKSSVSLRITALEFGDAAMYFCAFSR
Chrysemys picta bellii Vs1130 ighv AHGY01288645.1 868 ALSQLQLVASGPGVGKVSEPLTLTCAVSGVSIASQDHVWYWLRQSPGEGLESMGGVYPYDGDTRYAPSLQGRITISADTAKNQVSLQLRSLTATDTANYYCARG
Chrysemys picta bellii Vs626 trav AHGY01385502.1 1304 SALGDSVKSKEPEVSGSVGGSVTLSCSYTTSDSYVYLYWYRHYPNQAPQYILRRGAKSYSGQSHTADFAQKRFSSQADDSSTVLSIAALELADSAVYLCALRL
Chrysemys picta bellii Vs777 ighv AHGY01517167.1 1366 VRSQVLVESGGDVKKPGDSLRFSCKASGFTFSSYGMSWVRQAPGKGLEWVSHIYSDGSQQYYADSVKGRFTISRDNSNNLLYLQMSVLKPEDTARYHCA
Chrysemys picta bellii Vs770 ighv AHGY01506896.1 363 AADPDRPGAVKAGETLSITCKVSGVSFSSYYWSWARQPPGKGLEWMGFIQHTVNGGSTEYNSAFTPHVTITRDTSKDEVYLQLGSWTAADTSTYYCA
Chrysemys picta bellii Vs771 trdv AHGY01508589.1 873 LSQGQGSVTQTQGQLAKLGGQTVTLECTFSTGYQNYYLFWYRQHRSGAMDFLFRISQSNAQKNGAGRRFSAEFRKSSKFVSLTIKELEPTDSALYFCALRE
Chrysemys picta bellii Vs772 trav AHGY01508589.1 2251 AVLSDSVRSNEPEVSGSEGGSVTLSCSYETSYTGGVYLYWYRQYLNRAPQYILRRGAKGITFSDTADFAQERFSSQADDSSTVLNITSLELADTAVYYCALQR
Chrysemys picta bellii Vs625 trav AHGY01385501.1 1022 AVLSDSVRSNEPEVSGSEGDTVTLGCSYETSYTAGVYLFWYRQYPNRAPQYILRRGAKGITFSDTAVFAQERFSSQADDSSTVLNITSLDLADTAVYYCALQR
Chrysemys picta bellii Vs1442 ighv AHGY01516573.1 494 ARSQVVLTQSGPELKKPGESTRLKCAVSGFAVSSDYMDWVRQEPGKGLEWLVHYWKPGSEYYSPTIKGRFTASKDSSNFYLQMNSLKAEDTAVYYCTRRE
Chrysemys picta bellii Vs1443 iglv AHGY01518437.1 417 SLAQYVLTQPPSVSVSPGQNAQLTCSGNNIGSKNVQWYQQKPGSAPLCVIYGSSSRPSGIPDRFSGANSGNMATLTITGVQAQDEADYYCQVYDSSSDQ
Chrysemys picta bellii Vs679 ighv AHGY01410935.1 3804 VHSQIQLVESGGGVKTTGDSISVSCKASGFTFGNYWMYWYRQAPGKAPEWISYINPDSANADYAHSVKGRFTISRDNPNNLLYLQMTGLRPEDTAVYHCQR
Chrysemys picta bellii Vs678 trav AHGY01410935.1 2042 SVAGNSLTQIPASLPATEGERVEIRCQYSTSYTSYALDWYQELPGKQPLFLLGRYSGGSERKSSSVAPRFSSQLDKGAKSFKLTVDGAQRADSAVYFCALWD
Chrysemys picta bellii Vs675 ighv AHGY01409349.1 474 AWAQVVLTQSSPEIKKPGESTKLTCAVSGFALSSTSMYWIRQAPGKGLEWLIYYYSSSSNSYSPTIQGRFTASKDSSNFYLHMTSLRAEDTAVYYCAR
Chrysemys picta bellii Vs674 ighv AHGY01406730.1 1252 VRSQVKLLQTGAAQVKPSQTLRLTCSVSGFSLTSSGNGVSWVRQPPGKGLEWLSAVDWEDDKYYQESLKNRLTISRDTSKSEVYLEMRGMEARDSGTYYCAGS
Chrysemys picta bellii Vs677 ighv AHGY01410933.1 998 ALSQLQLVASGPGVGKVSEPLTLTCAVSGFSINTQDYYWYWLRQPPGEGLESMGGVYPYNGGTGYAPSLQGRVTISADTAKNQFSLQLRSLTAADTATYYCTRG
Chrysemys picta bellii Vs671 ighv AHGY01406480.1 676 VRSQVKLLQTGAAQVKPSQTLRLTCSVSGFSLTSSGNAVSWIRQPPGKGLECLCLVYWDDDKRYHESLKNRLTISRDTSKSEVYLEMRGMEAGDSGTYFCARS
Chrysemys picta bellii Vs670 ighv AHGY01403788.1 593 IQSQALVESGGDVKKPGDSLRLSCKASGFTFSSYPMNWVRQAPGKGLEWVAYISSSGGTIHYLDSVKDRFAISRYNSKSELYLQLTGLKPEDTARYHCAG
Chrysemys picta bellii Vs673 ighv AHGY01406481.1 2200 PILGFTMTQSGLGEVTVSGSLSLTCAVSDSALSTGGDWWHWLRQPPGKGLVWLALIDRYGNTRYLPDIQNRTTITVNPSKDEFYLRVDSLSPQDTATYYCAR
Chrysemys picta bellii Vs672 ighv AHGY01406480.1 4180 VRSQVKLLQTRAAQVKPSQTLRLTCSVSGFSLTSSGNRVSWIRQPPGKSLEWLCLVDWEDDKYYQESLKNQLTICRDTSKSEGYLEMRGMEAGDSGTYYCTT
Chrysemys picta bellii Vs1454 trav AHGY01531544.1 453 AVLSDSVRSKEPEVSGSEGGFVTLSCSYETSYTAGVYLYWYRQYPNRAPQYILLRGAKGNRASNTAGFAQKRFSSQADDSSTVLNIAALELADTAVYLCALRL
Chrysemys picta bellii Vs624 trav AHGY01385498.1 2541 FVQGDSVFQSPLEVTVSEGHDVLLQCNFTTDFTSPNLFWYRQYPNQPPQHILTAYKSPAEKNTFTSGKFSTVLFDANKTVLLKIEAVSLQDRAVYHCALR
Chrysemys picta bellii Vs550 igkv AHGY01364883.1 1765 SYGQIVLTQTPESLSVSLGQRVTINCKAGTSISNYLGWYQQKPGQAPKLLISDSTNRVSGIPDRFSGSGSGTDFTLTISSVEAEDAGDYYCQQRQSF
Chrysemys picta bellii Vs551 igkv AHGY01364884.1 2679 SCGQTVLTQTPESLAVSPGQRVTISCKASTSISNNLDWYQQKPGQAPKLLIYDSTNRVSGTPARFSGSGSGADFTLTISSVEVQDAGDYYCQQRNSYP
Chrysemys picta bellii Vs552 igkv AHGY01364886.1 1261 SSGQIVMTQTPESLSVSVGETVTIKCQASSSIGTYAHWYQQKSGQSPKLLIYSASSRPSGIPARFSGSGSGTDFTLTISGVEADDAGDYYCQQSGYSAP
Chrysemys picta bellii Vs553 igkv AHGY01364888.1 2657 SSGQTVMTQSPESLAVPVGGRVSINCKASTSIGSYINWYQQKPGQTPKLLIYGASTLHSGVPARFSGSGSGTDFTFTISSVEAEDAGDYYCQKGDS
Chrysemys picta bellii Vs554 igkv AHGY01364896.1 1404 SSGQMVMTQTPESLAVSPGDRVAINCKASSSTGNYVAWYQQKSGQAPKLLIHSASTRPSGIPDRFSGSGSGSGYTDYTLTISSVEAEDAGDYYCQQGNSSP
Chrysemys picta bellii Vs555 igkv AHGY01364901.1 3415 SYGQVTMTQSPESLSVSLGQKVTIRCTASSSRDSHYVSWYQQKPGQAPKLLIYWGSTLESGVPARFSSSESGTEYTLTISSVEADDAADYYCLQTES
Chrysemys picta bellii Vs556 igkv AHGY01364908.1 142 SSGQTVMTQSPESLAVPVGGRVSINCKASTSVGNNLHWYQQKPGQAPKLLIYRASSLQSGVPARFSGSGSGTDFTFTISSVEAEDAGDYYCQQGY
Chrysemys picta bellii Vs557 igkv AHGY01364908.1 2787 SNGQTVMTQTPESLSVSVGGTATIKCKASTSISNNIAWYQQKPGQAPKLLIYYASSRPTGIPDRFSGSGSGTDFTFTISRVEADDAGDYYCQQGNSFP
Chrysemys picta bellii Vs558 igkv AHGY01364908.1 7846 SYGQVTMTQSPESLSVTPGEKITIRCTASSRLGSSTVSWYQEKPRKAPKLHIYGDTDSASGVPARFSGSQSGTIYTLTISSIKADDAADYYCLQSQS
Chrysemys picta bellii Vs559 igkv AHGY01364912.1 5013 SYGQVTMTQSPESLSVTPGEKVTIRCTASSSLGSYAVSWYQQKPGQAPKLLIYDDTDRASGVPARFSGSGSGTIYTLSISSVEADDAADYYCLQTDS
Chrysemys picta bellii Vs419 ighv AHGY01296942.1 7089 IQSQVSLIQPIAEIKRPGESLKLTCKFSGFNFTKYWMQWVRRAGEIGLTWIGEVSTSGVSTNVLQSLRPRFSITRDNTNNMVHLEMRNLQADDCATYYCA
Chrysemys picta bellii Vs418 ighv AHGY01296536.1 934 FMQWISTRLMGTVIYYYLCQRITRRPMACRFWMDWVRHAAVKGLEWVTHISSGSGSSTHYVDAVRGQFTICRDNPNNLLYRQMTVLGPEDTAQYHCAG
Chrysemys picta bellii Vs411 igkv AHGY01291190.1 874 SNGQIVMTQTPESLAVSPGDTVTIRCKASSSLTSGSYHYLAWYQQKSGQAPKLLIYAGSSLQSGVPARFSGSGSGTDFTLTISKVEAEDAGDYYCQQYSS
Chrysemys picta bellii Vs410 igkv AHGY01291186.1 307 SSGQIVLTQTPESLAVSPGDTVTIRCKASSSVTSGSTHYLAWHQQKSGQAPKLLIYAGSSLQSGVPARFSGSGSGTDFTLTISKVEAEDAGDYYCQQ
Chrysemys picta bellii Vs412 igkv AHGY01291193.1 123 SSGDIVVTQTPESLAVSPGEKVTINCKASSSLTYEGKEYLAWYQQKSGEKPKRLIYLASTRPSGIPDRFSGSGSGTDFTLTISRVEADDAGDYYCQQYRSYP
Chrysemys picta bellii Vs414 iglv AHGY01293665.1 215 SLAQYVLTQPPSVSVSLGQKAQLTCSGNNIGGKSVHWYQQKPGSAPVLVIYSDSSRPSGIPERFSGANSGNTATLTITGVQAQDEADYYCQVWDSSSDQ
Chrysemys picta bellii Vs417 igkv AHGY01296397.1 412 SYGQITMTQSPESLSVTPGEKVTIRCTGSSSLDSDYVSWYQQKSGQAPKLLIYQASTLESGVPARFSGSGSGTVYTLSISSVEADDAADYYCLQTDSSP
Chrysemys picta bellii Vs323 trdv AHGY01255553.1 1673 FSQGQGSVTQAQGQLAKLGGQTVTLECTFSTGYQYFYLFWYRQHRSGAMDFLFQIDESNAQKNGAGRRFSAEFRKSSKFVSLTIKELEPTDSAVYFCALWE
Chrysemys picta bellii Vs321 trav AHGY01255533.1 466 AALGDSVQSKEPHVSGVEGGSVTFSCSYNTTDSRGVYLYWYRQSPNRAPQYILWRGTKLYAANRDTADFAQQRFSSQADETSIILNITALELTDTALYLCALQR
Chrysemys picta bellii Vs320 trav AHGY01255529.1 102 LAQSDSVDQFPPEVRVSEGQSVTLHCNFTTLGTNPYLFWYRQYPNRPPQHILTKTKFDAPDQTLVQGKFSASLYMANETVPFKIEAVSHQESAVYYCALR
Chrysemys picta bellii Vs327 trav AHGY01255555.1 5862 AVLSDSVQSEETQVSGAEGDAVTLRCSYTTSYTGSVYLHWYRQDPNQGLQYILWRGAQDARAFSDTADFAQERFSSQVDDSSTGLNITALEVADGAVYYCALGL
Chrysemys picta bellii Vs326 trav AHGY01255555.1 1031 AAFGNSVQSNEPEVSGSVGGSVTLSCSYTTSDSYVYLYWYRHYPNQAPQYILYRGAKSASHLSDTASFAQERFSSQADDSSTVLSIAALELADTAVYLCALSL
Chrysemys picta bellii Vs325 trav AHGY01255554.1 1486 AALGDSVQSNEPEVSGPVGVSVTLSCSYTTSSAYAYLFWYRQYPNQAPQYILWKGAKSASGTSDTADFAQQRFSSQATDSSTVLSITALELADSAVYYCALQR
Chrysemys picta bellii Vs324 trav AHGY01255553.1 3298 AVLSDSVRSKEPEVSGSEGGSVTLSCSYETSYTAGVYLYWYRQYPNRAPQYILLRGAKGITFSDTAGFAQQRFSSQADDSATVLNITALELADTAVYLCALRL
Chrysemys picta bellii Vs329 trav AHGY01255555.1 11385 AALGDSVQSREPHLSGREGDSVTLTCSYDTSSTGYVYLFWYRQFPGRAPQYILFRGVKQARGQSNTAEFAQKRFSSQADDSSTVLNITALELTDTAVYLCALQR
Chrysemys picta bellii Vs328 trav AHGY01255555.1 8701 AALGDSVHSKDPQVSGIKGDSVTLSCSYTTSYTGSLSLYWYRQYPNQAPQYILQKGAKGSRYQHTASFAQQRFSSQADDSSTVLTIRALELADTAVYLCALQR
Chrysemys picta bellii Vs1347 ighv AHGY01419777.1 798 DPVRSREGETQRRSQTDLCRVRLLQSQGSLLELDSAPSRKRLEWMGGIRFNGEVVYAPSVRDRATISRDISKSEFYMPLSSLIPTDTATYYCVREDTAV
Chrysemys picta bellii Vs1346 trgv AHGY01419632.1 799 GAARVQLTQDQLSITRNLMKTVRIDCKVSGISFGDAYIHWYRQRPGETPEWILYFKTQAEQSIFEKEKFSVDKTTEKSTCTLTVDKLTYNEMATYYCAYWD
Chrysemys picta bellii Vs544 iglv AHGY01358584.1 2824 PSSQQLLALKPSESVSPGGTVTLSCSLSSGAITENSFPHWVQQRPGNVPRRLIQGTSARAAGVPERFTASMSGNTMSLTIAGALAEDDAGYYCAVWSGGA
Chrysemys picta bellii Vs1228 ighv AHGY01347552.1 10146 VRSQSLVESGGDVKKPGDSLRLSCKASGFTFSSYGMIWVRQAPGKRLEWVAYTSNDGGTIYYLESVKGRFIISRDDSKSELYLQMTGLKPEDTARYYCA
Chrysemys picta bellii Vs1229 ighv AHGY01347552.1 5002 QLVESGPGTVKPSETLSLTCSISGASSDTLGSNCCWWHWIRQSPGKGLEWIGDIAQGGSTNYAASLQSRITISVNPSKNQFSLQLRSLTAADTATYYCAR
Chrysemys picta bellii Vs1341 ighv AHGY01411035.1 746 DPVRSREGETRRRSQTDLCHVRLLQSQESLLELDLAPSGMRLEWMGDIRFNGEVVYAPSVRDRATISRDISKSEFYMPLSSLIPTDTATYYCVRE
Chrysemys picta bellii Vs1340 ighv AHGY01409985.1 3010 VRSQVHLVESGGDVKKPGDSLRLSCKASGFTFSSYYVGWVRQAPGKGLEWLTWIHGSSIYYSDSIKGRFTISRDDPNSLLYLQMTGLKPEDTARYYCAR
Chrysemys picta bellii Vs1226 trav AHGY01347198.1 832 ALGQYTVTQDQPQAAAHEGEPTQLNCSYTGTEYSVHWYRQPRGRGQPRFVALLSSSGRDTRENFTMSLDTKTKSSFLYLNSSRLEDSAVYLCAL
Chrysemys picta bellii Vs1227 iglv AHGY01347547.1 573 SLAQYVLTQPPSVSVSPGQNSQPTCSGNNIGSKDVQWFQQKPGSAPLCVIYGSSSRPSGIPDRFSEANSGNTATLTITCVQVQDEADYYCQVWDSSAQ
Chrysemys picta bellii Vs1220 trav AHGY01345837.1 4743 VTFGDSVTTEDTAIVKEGAPLVIECTYESILFHYLLWYIQHPHKAPKLWLRDKTSGGGRDEGDKQGFFADHVQDKKSFDLKKSSSEVNHSAVYYCAFR
Chrysemys picta bellii Vs1221 trav AHGY01345837.1 2206 RANGEPVTQPDARVTVSQGEPVLLKCTYDPSQSPRLWWYEQYPNEAPRLLLGDYEAFSDEERRSRRGFSATPDKQGKTFHLKKSSSELRDSAVYYCAMS
Chrysemys picta bellii Vs1349 ighv AHGY01422270.1 2850 ARSQVVLTQSGPELKKPGESTQLKCSVSGFTITDYYMDWVRQEPGKGLEWLVHYWKPGSEYYSPTIKGRFTASKDSSNFYLQMNSLKAEDTAVYYCAR
Chrysemys picta bellii Vs1348 trdv AHGY01420946.1 754 SVAGNSLTQIPASLPATEGERVEIRCQYSTSYASYALDWYQELPGKQPLFLLGRYSSGSEHKSSSVAPRFSSQLDKGAKSFKLTIDGAQRADSAVYFCALWD
Chrysemys picta bellii Vs510 ighv AHGY01341948.1 2210 ARSQVQLVESGGDVKKPGDSLRLSCKTSRFTFSSYYMDWVRQGPGKGLEWVAEIKSDGSSQWYSPAVQGRFRISRDNSDNLLYLQMTGLKPEDTARYHCA
Chrysemys picta bellii Vs511 ighv AHGY01341950.1 2466 VRSQVQLVESGGDVKKPGDSLRLSCKASGFTFSSSAMSWVRQAPGKGLEWVAYINYDGSTIYYLDSVKGRFTISRDDSRSELYLQMTGLKPEDTARYYCV
Chrysemys picta bellii Vs526 trav AHGY01354332.1 573 GIYGADSVTQTEGTIMISQWDPVRLNCTYQFSASVTVYPFWYVQFPNQPPRLLLRDLGREASDEGIRKGFDATHDKKNKSFHLWKPSSELSDSATYYCAAR
Chrysemys picta bellii Vs522 ighv AHGY01350639.1 458 VLSTTQLVQSGPGAVKPGDTLTLTCAVSGTSISSDTAWHWIRQPPGTGLEWMGRVYPYGGSTGYNSSLQGRTTISADTAKNQFSLQLRSLTAADTATYYCA
Chrysemys picta bellii Vs392 ighv AHGY01283600.1 964 VLPATQLVQSGPGVVKPGDTLTLTCAVSGTSISSDTAWHWIRQPPGTGLEWMGWVYPYGGSTGYASSLQGRATISADTAKNQFSLQLRSLTGADTATYYCARQ
Chrysemys picta bellii Vs259 iglv AHGY01246622.1 1266 VSSQPVVTQEPSMSVTPGGAVTLSCSLSPGAITTGSYPAWFQQKPGSAPRTLIYNTNTRPSGIPARFSGSISGNNAALTITGVQAEDEADYYCILWTGSV
Chrysemys picta bellii Vs469 iglv AHGY01322223.1 1856 CYAQVTQPPSEFVSPGGNVQLPCTLEGSYTVSANRVIWIQQRPGSVPRYLMYFYTESNKGLGSGVPSRFAGSRSGSDKIGYLTITGAQAEDDAVYYCVTWTGSA
Chrysemys picta bellii Vs987 trbv AHGY01190172.1 26768 LCEEGEQVVLSQVPRWVTQKTETMAKLHCYQNNTDHGWMYWYRQPVAQWGLDLIGVLIKGTPEPTFEEHFRDNRFSMVRDNDRHCTLQIDLLKTRDSALYFCAT
Chrysemys picta bellii Vs1405 ighv AHGY01467338.1 2100 VLSQVQLVQTGPGAVKPGATLSITCKVSGVSVSDYYWSWNRQPPGKGLEWMGFIRRTAAGGTTEYNSALKPRVTITRDTSKNEVYLQLGSLTAADTATYYCAR
Chrysemys picta bellii Vs1406 ighv AHGY01473918.1 1250 ARSQVVLTQSGPEVKKPGESTQLKCAVSGFVPNDWWMDWVRQLPGKGLEWLVHYRQSSVTNYYSPSIQGRFTASKDSTNFYLQMTSLKPEDTAVYYCA
Chrysemys picta bellii Vs632 ighv AHGY01390100.1 253 ARSQVALTQSGPALKKPGESHTLQCATSGFTLSSTWMDWVRQELGKGLEWLVSYYDPSYKSYASSVQGRFTASKDSTNFYLQMTSLRAEDTAVYYCAR
Chrysemys picta bellii Vs1400 ighv AHGY01463547.1 1822 AISQLQLVASGPGVGKVSEPLTLTCAVSGFSINTRYYYWYWLRQAPGEGLESMGWVYPYDGGTRYAPSLQGRVTISADTARNQFSLQLHSLTATDTATYYCARR
Chrysemys picta bellii Vs1401 iglv AHGY01465471.1 641 SLAQYVLSQPPAVSVSPGQNAQLTCSGNNIGSKDVQWFQQKPGSAPLCVTYGSSSRPSGIPDRFSGANPGNTATLTITGVQVQDEADYYCQVWDSSAQ
Chrysemys picta bellii Vs636 ighv AHGY01394185.1 1291 VRSQALVESGGDVKKPGDSLRLSCKASGFTFSSSAMSWVRQAPGKGLEWVATIYTGGSSTYYLDSVKGRFTISRDNPKSELYLQMTGLKPEDTARYYCA
Chrysemys picta bellii Vs638 ighv AHGY01394307.1 477 VLSQLQLVQSGPGAVKPGETLTLTCAVSGFSVSSSSYAWHWIWQPPGKGLEWMGYVYPYNSGETGYTPSLQARITISADTAKNQFSLQLRSLTAADTATYYCAR
Chrysemys picta bellii Vs1142 ighv AHGY01299120.1 1280 VRSQVQLVESGGDVKKPGDSLRLSCKASGFTFSSYAMSWVRQAPGKGLEWVSYIYTDGSQQFYRDSVKGRFTISRDNPNNLLYLQMTGLKPEDTARYHCA
Chrysemys picta bellii Vs734 trav AHGY01467953.1 936 AAFGNSVQSNEPEVSGSVGGSVTLRCSYTTSDSYVYLYWYRQYPNQAPQYILYRGAKSASGQSHTANFAQKRFSSQADDSSTVLSIAALELADSAVYLCALRL
Chrysemys picta bellii Vs989 trbv AHGY01190178.1 1507 CSGAQINQPPSLVLEKGHRAQLVCNQTYGHNNMFWYRQDPGQGFQLLFLFVHKQQTDKGNVTDRFQAERPQTELFHLDISPVKPEDSAVYFCASSS
Chrysemys picta bellii Vs988 trbv AHGY01190177.1 16595 GADVSFNQTLSLVLERGKTAELQCEQNINYDYMYWYQQLQGKGLHLIYYSYDTAKVEPGNISERVTAIRPQTQLFQLKISPVKPEDSAVYFCASSL
Chrysemys picta bellii Vs594 iglv AHGY01370541.1 2962 FSSQQLQSLKASEFVSPEGTVTLSCSLSSGALTDNNYPLWVQHRLGNVPRLIMHHTSTRPSGIPERFTGSRSGNTMSLTIKGALAEDDADYYCCVWTGSA
Chrysemys picta bellii Vs595 iglv AHGY01370549.1 2961 FSSQQLQSLKASEFVSPGGTVTLSCSLSSGALTDNNYPLWVQQRLGNVPRLIMHTTSTRPSGIPERFTGSRSGNTMSLTIKGALAEDDADYYCCVWTGSA
Chrysemys picta bellii Vs596 iglv AHGY01370606.1 636 SSYQFTLTQPLSMSVTPGETAQLACVLSSGDSISSRYIRWYQQKQGEKPRYLLYYKDDSTQGKGSGVPDRFTASKDTSRNTCFLTISRAEAEDDADYYCTGWD
Chrysemys picta bellii Vs598 trdv AHGY01372516.1 63 SVAGNSLTQIPASLSATEGERVEIRCQYSTSYSNYALDWYQELPGKQPLFLLRRYSDGSEHKSDSLARRFSSQLDTGAKSFKLTIDGAQRADSAVYFCALWD
Chrysemys picta bellii Vs599 ighv AHGY01372523.1 775 ALSQLQLVASGPGVGKVSEPLTVTCAVSGVSIKTRYYYWYWLRQPPGEGLESMGWVYPYDGGTRYAPSLQGRITISADTAKNQLSLKLHSLTATDTATYYCASR
Chrysemys picta bellii Vs1169 ighv AHGY01321119.1 3367 VRSQALVESGGDVKKPGDSLRLSCKASGFTFSSYWMYWVRQAPGKGLEWVTAINPGGSSTYYLDSVKGRFTISRDDSKSELYLQMTGLKPEDTARYYCAG
Chrysemys picta bellii Vs188 iglv AHGY01182585.1 3523 SLAQYVLAQPPTVSVSLGQKAQLTCSGNNIGDKSVYWFQQKPGSAPLLVIYRDSSRPSGIPDRFSGANSGNTATLTITGVQAQDEADYYCQVYDSSA
Chrysemys picta bellii Vs187 iglv AHGY01182583.1 72 SLAQYVLTQPPAVSVSPGQSAQLTCTGEKFDKYYVHWYQQKPGRAPVLVIYKDSERPSGIPERFSGASSGNTATLTITGVQAQDEADYYCQVWDDDNKT
Chrysemys picta bellii Vs186 iglv AHGY01182569.1 1957 RADSAALSVCVSRAKCSAHLLREQHWELLCAMVPAETWQRPPTLIYQNSNRPSGIPERFSGANSGNTATLTITGVQAQDEADYYCQVWDSSSAQ
Chrysemys picta bellii Vs185 iglv AHGY01182566.1 7904 SLAQYELTQPPSVSVSPGQNAQLTCSGDNITIYHVHWYQHKPGSAPVALIYQNSKRVPGIPDRFSGANSGNTATLTITGVQAQDEADYYCQVWSNP
Chrysemys picta bellii Vs184 iglv AHGY01182566.1 1752 SLAQYVLTQPPSVSVSPGQNAQLTCSGNNIGSKYVHWYQQKPGSAPLRVIYDSSSRASGIPDRFSGASSGNTATLTITGVQAQDEADYYCRVWDSNA
Chrysemys picta bellii Vs1163 ighv AHGY01315306.1 452 ALAQLQLVASGPGVGKSSESLSLTCAVSGESITTSGFTGHWYRQDPGKGPEWLGLIYWDGDTRYAPSLQDRTTISADTAKNQFSLQLRSLTAADTATYYCARS
Chrysemys picta bellii Vs182 iglv AHGY01182555.1 5860 SSSQTVVTQPPLVSVSPGNTVKLSCTMSSGTSIGDHVVSWYQQKSGNSPRYLLYYYSESDKGQGSGVPARFSGSKDTSSNAGYLTISGALAEDEADYYCAVRKR
Chrysemys picta bellii Vs181 iglv AHGY01182555.1 3258 SLAQYVLTQPPSVSVSPGQNAQLTCSGNNIGSKNVQWFQQKPGSAPLLVIYASSSRPSGIPDRFSGAKSGNTATLTITGVQAQDEADYYCQVWDSNA
Chrysemys picta bellii Vs748 trav AHGY01486590.1 378 SIYGADSVTQTEGSVTISQGEPVRLNCTYQFSVTPYPLWYVQFPSQALTLFLRDVGREDSDERIRKGFDATHDKKNKYFHLWKPSSELSDSGTYYCAAS
Chrysemys picta bellii Vs745 igkv AHGY01485054.1 212 SSGQTVMTQSPESLAVPVGGSVSINCKASTSISNYLHWYQQKPGQAPKLLIYRASNLQSGVPARFSGSGSGTDFTFTISSVEAEDAGDYYCQQSNSYP
Chrysemys picta bellii Vs746 iglv AHGY01485217.1 1271 SSYQFTLTQPLSMSVTPGESVQLACVLSSGDSISSRYIYWYQQKQGEKPRYLLYYKDDSTQGKGSGVPDRFTASKDTSRNTCFLTISRAQVEDEADYYCSDWD
Chrysemys picta bellii Vs743 igkv AHGY01484510.1 214 SSGQTVMTQSPESLAVPVGGRVSINCKASTSISNYLHWYQQKPGQAPKLLIAYASTLQSGVPARFSGSGSGSDFTFTISSVEAEDAGDYYCQQSNSWP
Chrysemys picta bellii Vs1268 ighv AHGY01363650.1 12018 VRSQVQLVESGGDVKKPGDSLRLSCKASGFTFSSYYMSWVRQAPGKGLDWLAWIYGSSINYSDLVKGRFTISRDDSKSELYLQMTGLKSDDTARYYCAR
Chrysemys picta bellii Vs208 trbv AHGY01190158.1 5296 QTDAKITQTPSLVLERGQTAYLRCQQTYGHNSMFWYRQDPGQGLQLLFNFYYKEEREKGTNSSHFQADQPQDDLFRLNISSVQPEHSAVYFCASSL
Chrysemys picta bellii Vs209 trbv AHGY01190163.1 4193 IHSATIVQSPQSVVEELGRQISLECSLEGTSNPYIYWYRQLPGGQIYMLAYSVSIGQVDNTGPSHFSTSRTKDKEFLLSINGLLANDTGVYYCAW
Chrysemys picta bellii Vs814 trav AHGY01549672.1 54 AVLGESIQSNKPEVSAGEGDNVTLSCSYNTSYSDVYLYWYRQFPGQGPQYVLRTGAKAYSSVRDFAEFASKRFTPQADDSSTALSITSLELADTAVYYCALQR
Chrysemys picta bellii Vs204 trbv AHGY01190153.1 50168 GRSQTLHQIPRFISLPPGSSVQLDCYLPGYSSTLYMYWYQQPPQGGALHMLFLSRSKDLIDDSSEKHFTAARPAQQNFTLSTDSLFPNDTGLYYCAWN
Chrysemys picta bellii Vs205 trbv AHGY01190153.1 60493 QADAKITQTPSLVLERGHSAYLRCQQSYGHSYMFWYRQDPGQGMQFLISFYNKKESEKGKITDRFQADQPQDDLFHLNISSAQPEDSAVYFCASSL
Chrysemys picta bellii Vs206 trbv AHGY01190155.1 9518 HTDAKITQTPSLVLKRGQTAQLTCRQTDSHSYMYWYQQQQGKGLQLIYYSVTVDNKEEGDIKAGFTASRPQINVFDLNITSVKMEHSAEYFCASSL
Chrysemys picta bellii Vs207 trbv AHGY01190155.1 23882 TRSATIVQSPQSVVEQLGRQASLECSLEGTSNPNIYWYRQLPAGQIHMLTYSVSTGEVDNTGLSSHFNASRPKDEEFLLSINGLLANDTGVYYCAWS
Chrysemys picta bellii Vs817 trav AHGY01551707.1 1076 GSCQAEVQQNLSAVTWEGQNGSISCHYTTSTFRSLQWFRQLPGGQPAFLLILVSDGKQTKEPNLTAELDKGKRLSSLHIRESQLGDAATYFCAVA
Chrysemys picta bellii Vs203 trbv AHGY01190153.1 45121 GRSQTLHQTPRFISLPPGSKVQLDCYLQGYNAEPWMYWYWQPPQGGALHMLFLSRVKGSIDDSLEKHFIAARPAQQNFTLSTDSLFPNDTGLYYCAWS
Chrysemys picta bellii Vs1309 iglv AHGY01393976.1 763 ASSQPTLTQPPADSVSLGNSVKLSCTLSSQHSSYSVGWYQQRDGQAPRFLWYGSSIKGDGVPDRFTVSSSGAIRYLTITNIQPEDEATYYCGAGYSIGS
Chrysemys picta bellii Vs1308 ighv AHGY01393953.1 1300 VWSQVQLVESGGDVKKPGDSLRLSCKGSGYTFSSHQMSWVRQAPGKGLEWIAFIDVTTIYYADSVKGRFTISRDNSNSLLYLEMTGLKPEDTARYHCA
Chrysemys picta bellii Vs1303 ighv AHGY01393472.1 432 ARAQVVLTQSSPEIKKPGESTKLTCAMSGFALSSTSMYWIRQAPGKGLQWLIYYYSSSNNNYSPAIQGRFTASKDSSNFYLHMTSLRAEDTAVYYCA
Chrysemys picta bellii Vs1306 trgv AHGY01393519.1 524 GCAQIHLRQTQLSITRAETKTARIVCEASGIQNFRSAVIHWYRHRPGEAPERILYISAVKVEFDKGSDDKFDCENNPDQPVSTLVVNGITTDDRAIYYCAYWD
Chrysemys picta bellii Vs1305 ighv AHGY01393474.1 327 AWSQVHLVESGGDVKKPRDSLRLSCKASWFTFSSYTMSWVRQAPRKGLEWVSCIYSDGSQQYYADLVKVQFTISRDNPNNLLYLQMTGLKPEDTARYHCA
Chrysemys picta bellii Vs1304 ighv AHGY01393473.1 3060 QLKETGPGAVKPGESLTLTCTISGDSVSSTSVTWTWIRQPVGKGLEWVGRIYYRPSQWYTNYASSLQSRTTITQDTSKNQFSLQLRSLTAADTATYYCARE
Chrysemys picta bellii Vs1088 ighv AHGY01282682.1 2316 ARSQVQLVESGGDVKKPGDSLRLSCKASGFPFSSYLMDWIRLAPGKGLEWLARAAAQGSTYYADSVQGRFTISRDNANSLVHLQISSLRAEDTALYYCVR
Chrysemys picta bellii Vs1089 ighv AHGY01282682.1 703 RLVESREDIKKPGQSLRLTCKGSGFDFSQAGMHWLRQDPGKGLERVSVFFFSGSKEYYVASVKGRFTTSRNNSPNLAYLDISGLKPEDTARYYCAA
Chrysemys picta bellii Vs493 trav AHGY01334060.1 4245 AALGDSVQSREPHFSGREGDAVTLTCSYDTSSTGYVYLYWYRQFPNQAPQYILFRGVKQARDESNTADFAQKRFSSQADDSSTVLSIKALELADTAVYLCALDV
Chrysemys picta bellii Vs446 ighv AHGY01306982.1 1951 ARSQVVLTQSGPEVKKPGESTQLKCAVSGFVPNDWWMDWVRQLPGKGLEWLVHYRQSSVTNYYSPSIQGRFTASKDSTNFYLQMTSLKPEDTAMYYCA
Chrysemys picta bellii Vs447 ighv AHGY01306983.1 2376 VQSQVQLVESGGDVKKPGDSLRLSCKASGFTFSSYYMSWVRQAPGKGLEWVAYLNSAGGDIQYLGSVKGRFTISRDNSKSEPYLQMTGLKPEDTARYYCAR
Chrysemys picta bellii Vs299 ighv AHGY01251566.1 1279 ALSEVKLVQSSPGTVKPSESLHLTCTTSGFSIASSGYTCHWIRRTPGKGLEWLGYINMYYSTSGSIPPLQSRISITQDPSKNELYLRLRSLTAADTAAYYCA
Chrysemys picta bellii Vs298 ighv AHGY01251562.1 2157 VQSQVQLVESGGDVKKPGDSLRLSCKASGFTFSDYWMSWVRQAPGKGLEWVANIHYGGSTYYLDSVKGRFTISRDNSKSELYLQMTGLKPEDTARYYCAR
Chrysemys picta bellii Vs442 ighv AHGY01305386.1 12541 VQSQVLVESGGDVKKPGDSLRLSCKSSGFTFGDHWMSWVHQAPGKGLEWVTAISYWAGSTVCYTSSVQVRFTISRDNPNNLLYLEMTGLKPEDTTRYHCAG
Chrysemys picta bellii Vs443 ighv AHGY01306332.1 635 ALSQLKLVASGPGVGKVSEPLTLTCAVSGFSINTRYYYWYWLRQPPGEGLESMGWVYPYDGDSDYAPSLQGRVTISADAAKNQFSLQLRSLTAADTATYYCARR
Chrysemys picta bellii Vs440 ighv AHGY01305386.1 3321 VWSQVQLVESGGDVKKPGDSLRLSCKASGFTFSSYNMNWVRQAPGKGLEWVAYINPGGGSTYYLNSVKGRFTISRDNSKSELYLQLTGLKPEDTARYYCAG
Chrysemys picta bellii Vs441 ighv AHGY01305386.1 9834 ARSQIQLVESGGDVKKPGDSLRLSCKASGFTFSSYEMSWIRQAPGKGLEWIAYIYSTSIYYSDSVKGRFTISRDNPNSLLYLQMTGLKPEDTARYYCAR
Chrysemys picta bellii Vs293 ighv AHGY01251554.1 3668 AADPDCPGAVKAGETLSITCKVSGVSVSNYCWSWVRQPPGKRLEWMGFIRSTARGGTTEYNSALKPRVTSTRDTSKDEVYLQLGSRTAADTGTYYCA
Chrysemys picta bellii Vs292 ighv AHGY01251554.1 405 VLSQLQLQESGPGVVKPGETLTLTCTVTGGTITSSYRWNWIRQAPGQGLEWMGYWTGSTSYAPSLQGRITISVDSSNTKYYLRLSSLTATDTGTYYCAR
Chrysemys picta bellii Vs291 ighv AHGY01251552.1 14193 VRSQALVESGGDVKKPGESLRLSCKASGFTFSSAYMNWVRQAPGKGLEWVAQIYPGGSTTNYLDSVKGRFTISRDDSKSELYLQMSGLKPEDTARYYCAR
Chrysemys picta bellii Vs290 ighv AHGY01251552.1 10489 VYSQVSLVESGGGIKKPGETLRLTCTVSGFSITSYRVHWARQPAGKGLEFVSTIWSGGSTNYNDALKNHLSITRDTSKSQVFLQLTGLQPADTSVYHCAR
Chrysemys picta bellii Vs297 ighv AHGY01251556.1 7972 VRSQVLVESGGDVKKPGDSLRLTCKASGFTFSSYTMHWVRQAPGKGLEWVSLIYTDGSQQFYADSVKGRFTISRDNSNNLLYLQMTGLKPEDTARYHCAG
Chrysemys picta bellii Vs296 ighv AHGY01251556.1 6255 VRSQVQLVESGGGMKKPRDSLRLFCKASRFTLRSYWMSWVRQAPGKGLECIVEIHPTSTTINYAQPCKGCFTISRDNPNNLLFLQMTGLKPEDTARYHCA
Chrysemys picta bellii Vs295 ighv AHGY01251556.1 1650 VRSQVQLVESGGDVKKPGDSLRLSCKASGFTFSSSWMSWVRQAPGKGLEWVSTISSGGSTYYPDSVKGRFTISRDNSKSELYLQLTGLKPEDTARYYCA
Chrysemys picta bellii Vs294 ighv AHGY01251554.1 6700 VLSATQLVQSGPGAVKPGDTLTLTCAVSGTSISSDTAWHWIRQPPGTGLEWMGRVYPYGGSTGYDSSLQGRTTISADTAKNQFSLQLRSLTAADTATYYCARQ
Chrysemys picta bellii Vs56 trgv AHGY01036542.1 143 VLWAIHLEQEQISVTKQPLQGSSAKFTCRVFGGSDSTYIHWYRARAGEAPHRLLHLTLSGSKLNREAGFSNDKFSAYGTQNISNLLVHKLEKTDNGHYYCATWDF
Chrysemys picta bellii Vs497 iglv AHGY01337701.1 1081 LSSQQLQPLKTSEFVSPGGTVTLSCSLSSGAITDNNYPRWVQQRLGNVPRLIMYSTSTRPSGIPARFTGSRSGNTMSLTIAGALAEDDADYYCSVWTGSA
Chrysemys picta bellii Vs57 trgv AHGY01036542.1 8549 GSSQVRLTQPQLSITREENKTLRIDCHVSLSEDFGKAPIHWYRQRPGAAPERILLISTQSESKGKFNAEKKIGQSTCTLTINKITSSDVATYYCAYW
Chrysemys picta bellii Vs194 iglv AHGY01182587.1 7979 SLAQYVLTQPPAVSVSPGQSAQLTCTGEKVDEQSVHWYQQKPGRAPVLIIYADSERPSGIPERFSGASSGKTATLTITGVQAQDEADYYCQVWDSDSSS
Chrysemys picta bellii Vs1216 igkv AHGY01343455.1 330 SSGQIVLTQTPESLAVSPGDRVTINCKASSSVGGAIAWYQQKSGQAPKLLIYDASTRASGIPDRFSGSGSGTDYTFTISRVEADDAGDYYCQHYYGYP
Chrysemys picta bellii Vs195 iglv AHGY01182588.1 517 SLAQYVLTQPPAVSVSPGQNAQLTCRGEKIDEQYVSWYQQKPGRAPVLVIYKDSERPSGIPERFSGTSSGNTATLTITGVQAQDEADYYCER
Chrysemys picta bellii Vs27 ighv AHGY01021020.1 1632 VRSQIQLVPSAPGVVKPGESLTVTCTVSGDSIATRAWWNWVRELPGRGLQWVGRIHFSGSTNYAPDLQTRANIAKDDAKNEFYLQLRSLTAADTATYYCTRWD
Chrysemys picta bellii Vs26 ighv AHGY01021019.1 11160 VLSQVQLVESGPGVVKPGETLTLTCAVSGFSISSSGYSWDWVRQPPGKGLEWMGYVYPQAGTTGSAPSLQGRITISADTAKNQFSLQLRSLTAADTATYYCSR
Chrysemys picta bellii Vs25 ighv AHGY01021019.1 8058 VLCQVQLVQSGPGTAKPGETLTLTCAVSGFSITTQYYTWNWIRQPPGKGLEWMGYVYPYSSGSTGYAPSLQGRITISADTAKNQVSLQLRSLTAADTATYYCAR
Chrysemys picta bellii Vs1273 ighv AHGY01369108.1 6747 VLSQLQLQESGPGVVKPGETLTLTCTVTGGTVTSSYWWNWIRQAPGQGLEWMGLWTGSTSYAPSLQGRITISVDSSNTKYYLRLSSLTATDTGTYYCAR
Chrysemys picta bellii Vs1272 ighv AHGY01369107.1 604 VLSATQLVQSGPGAVKPGDTLTLTCAVSGTSISSDTAWHWIRQPPGTGLEWMGWVYPYGGSTGYDSSLQGRTTISADTAKNQFSLQLRSLTAADTATYYCARQ
Chrysemys picta bellii Vs1271 ighv AHGY01369102.1 2170 QLKETGPGAVKPGESLTLTCTISGDSVSSTSVTWTWVRQPAGKGLEWVGRIYYRPSQWYTNYASSLQSRTTITQDTSKNQFSLQLRSLTAADTAMYYCARE
Chrysemys picta bellii Vs1234 ighv AHGY01350577.1 1576 VRSQVQLVESGGDVKKPGDSLRLSCKASGFTFTSYWMGWVRQAPGKGLEWLTWIHGSSIYYSDSIKGRFTVSRDDPNSLLYLQMTGLKPEDTARYYCAR
Chrysemys picta bellii Vs197 iglv AHGY01182588.1 6517 SLAQYVLTQPPSVSVSPGQNAQLTCRGEKIDEEYVSWYQQKPGRAPVLVIYKDSERPSGIPERFSGTSSGNTATLTITGVQAQDEADYYCQRWDSDSSS
Chrysemys picta bellii Vs1279 iglv AHGY01373615.1 1502 FSSQQLQSLKASEFVSPGGTVTLSCSLSSGALTDHNHPLWVQQRLGNVPRLIMHSTSTRPSGIPERFTGSRLGNTMSLTITGALAEDDADYYCSVWAVS
Chrysemys picta bellii Vs1278 iglv AHGY01373611.1 635 SLAQFVLTQPPSASASPGQTVTISCARSSGNIGSYYVSWYQQKPGSAPKLIIYEWNKRPSGISDRFSGSTDTSANTASLTISGVQADDEADYYCDSYDSNSN
Chrysemys picta bellii Vs806 igkv AHGY01545232.1 856 SSGQIVLTQTPESLAVSPGDRVTINCKASSSVGGAIAWYQQKSGQAPKLLIYGASTRPSGIPDRFSSSGSGTDFTFTISRVEADDAGDYYCQQRSSIP
Chrysemys picta bellii Vs802 ighv AHGY01543853.1 63 VRSDVQLVESGGDVKKPGDSLPLSCKTSGFTFADYNMHWIRQAPGKGLDWVAYISGPSGTTIYYSQAIKGRFTISRDNSSNLLNLQMSDLKAEATGPYYCARQ
Chrysemys picta bellii Vs1376 ighv AHGY01439814.1 1303 VRSQVQLVESGGDVKKPGDSLRLSCKPIGFKVRDYWMMWVRHAPGKGLEWVSSIYWNRYYADSVKGRFTISRDDSNNLLHLDMTGLKPEDTARYYCERY
Chrysemys picta bellii Vs1374 ighv AHGY01436732.1 703 ARTQIQLVQSGPGMVKPQETLILTCSVSGYTISSGFNWGWIRQAPGKGLEYMGYTYGPIQVTSYAPAFQSRITIAIDSSKNQFSLQLRSLTPADTATYYCTR
Chrysemys picta bellii Vs1375 igkv AHGY01439631.1 818 STGDIVLTQTPESLAVSPGDRVTINCKASSSIKVFLGSSYLAWYQQKPSQALQFLIYDASTRASGIPDRFSGSGSGTDFTLTISSVQAEDAGDYYCQQGFETP
Chrysemys picta bellii Vs1373 ighv AHGY01436117.1 4517 VLSQVLVQSGQGVVKPGDTLTLTCAVSGFSITTQHYDWHWIRQPPGKGLEWMGRVYPYSSGATNYAPSLQARITISADTAKNQVSLQLRSLTAADTATYYCARR
Chrysemys picta bellii Vs808 iglv AHGY01547109.1 40 SSSQTVVTQPPSVSVSPGNTVKLSCTLSSGTGIGDYYVSWYQQKPGNSPRYLLYYYSDSSKGQGSGVPARFSGSKDTSSNAGYLTISGALAEDEADYYCTVRKS
Chrysemys picta bellii Vs1371 iglv AHGY01434329.1 379 SSYQFTLTQPLTMSVTPGETAQLACVLSSGDSISSRYIYWYQQKQGEKPRYLLYYKDDSTQGKGSGVPDRFTASKDTSRNTCFLTISRAEAEDDADYYCTGWD
Chrysemys picta bellii Vs364 trav AHGY01258537.1 1380 APGRAKIQQPVSAEALEGAELNLTCSHPSASADNILWYRQFPNRGPEFIVTGFSGTAHSPDPEGTLHISKDKENSIFALRRVRLADAAVYYCARR
Chrysemys picta bellii Vs363 trav AHGY01258526.1 1384 AVLSDSVRSNEPEVSGSEGGSVTLSCSYETSYTGGVYLYWYRQYLNRAPQYILRRGAKGITFSDTADFAQERFSSQADDSSTVLNITSLELADTAVYYCALQR
Chrysemys picta bellii Vs362 trav AHGY01258249.1 2096 GANGESVTQPDDRVTVSQGEPVLLKCIYDYDTSYGTPTLWWYEQHPNEAPRLLLTQYEASDEEARRSRRGFFATPDNQGKTFHLKKSSSELRDSAVYYCAMS
Chrysemys picta bellii Vs361 trav AHGY01258236.1 538 GSYGADSVTQTEGSVIISQGDPVRLNCTYQFSVPAYPFWYVQFPSQPPRLFLRDLGREDSDEGIRKGFDATHDKQHKSFHLWKPASELSDSGTYYCAAR
Chrysemys picta bellii Vs360 trav AHGY01258231.1 177 QSNGELVTQTKGSVLISQGESVLVNCTYEAASPSLFWYVQFPSQPPRLFLRDVGWEASDEGTRKGFDATYEKKDKSFHLWKPASELSDSATYYCAAR
Chrysemys picta bellii Vs58 trgv AHGY01036542.1 11136 GCAQIHLRSTQLSITKAENKTARIVCEASGIQNFGSAVIHWYRHRPGEAPERILYISPEKLEFDKDSDENKFNCEKKPDQPISTLTVHEIAPNDGATYYCAYWG
Chrysemys picta bellii Vs699 ighv AHGY01426459.1 3606 VRSQVQLVESGGDVKKPGDSLRLSCKASGFTFSDYSMNWIRQAPGKGLEWASRIYYDGSQQFYADSVKGRFTISRDNSNNLLYLQMTGLKPEDTARYYCAR
Chrysemys picta bellii Vs1282 ighv AHGY01374218.1 488 ARSQVLVESGGDVKKPGDSLRLSCKASGFTFSSAYMNWVHQAPGKGLEWVAHINPSLGIVYLDSVKGRFTISRDNSKSELYLQMTGLKPEDTARYYCAR
Chrysemys picta bellii Vs1283 ighv AHGY01374475.1 1499 VRSQVQLVESGGDVKKPGDSLRLSCKASGFTFSSYYMDWVRQAPGKGLEWVAQIRPDASKQWYSPAVDGRFTISRDNPNNLLYLQMTGLKPEDTARYYCA
Chrysemys picta bellii Vs1280 ighv AHGY01374208.1 2231 ARSQVQLLESGGDVKKPGDSLRLSCKASGFTFGDYWMSWVRQAPGNGLEWVAAISYWAGSTIHYANAVKGRFTISRDNANSLLYLQMTGLKPEDTALYYCA
Chrysemys picta bellii Vs1281 ighv AHGY01374214.1 3025 VQSQALVESGGDVKKPGDSLRLSCKASGFTFSSYDMSWVRQAPGKGLEWVAVIYTGGSSTYYLDSVKGRFTISRDDSKSELYLQMTGLKPEDTARYYCAR
Chrysemys picta bellii Vs1284 ighv AHGY01374481.1 5236 VRSQVQLVESGGDVKKPGDALRLSCKASGFTFSDYWMHWVRQAPGKGLEWVAGINSGTGTSTYYADTVKGRFTISRDNPNNLLYLQMTGLKPEDTARYHCAG
Chrysemys picta bellii Vs1285 ighv AHGY01374481.1 977 ARSQVQLVESGGDVKKPGDSLRLSCKASGFTFSSTYMHWVRQAPGKGLEWVSAISSSGSTYYPDSVKGRFTVSRDNSKSELYLQMTGLKPEDTGRYYCAR
Chrysemys picta bellii Vs792 trav AHGY01536728.1 881 AVLGDSVQPREPQMSGAEGGSVTLSCSYESSYTAGVYLYWYRQFPNRAPQYILRRGTKEVRSGSVTADFAQKRFSSQADGNSTALSIAALELADTTVYLCALQR
Chrysemys picta bellii Vs793 ighv AHGY01537467.1 335 FVASGREVKMLRDSLQISCKTSGFSSGDYRMTWYGNTPGKALEWVSTISYWARDTKHYAASVKGRFTISRDNPNNLLYLHRTNLRPEDAAEYYCGW
Chrysemys picta bellii Vs790 ighv AHGY01533784.1 1192 ARSQVQLAASGPWLGQVSEPLTLTCAVSGGSATDDYWDWYRQLPRGGLDWLGEIDWYNSQWRVDYARSLQGRITLSADSSKNQFSLLLHSLTAADTATYYCARR
Chrysemys picta bellii Vs796 ighv AHGY01541762.1 626 VRSDVQLVESGGGVKKPRDSLRLSCKTSGFTFADYNMHWIRQAPGKGLDWVAYISGPSGTYIGYSQAIKGRFTISRDNSNSLLNLQMSDLKAETTGLYYCARQ
Chrysemys picta bellii Vs797 igkv AHGY01541976.1 1261 SSGQIVLTQTPESLAVFPGDRVTINCKASSSVNEWVAWYQQKSGQAPKLLIYSALHRPPGIPDRFSGSELGTGYTLTISRVEADDAGDYYCQYHYSSP
Chrysemys picta bellii Vs1123 ighv AHGY01285934.1 519 VYSQISLVESGGGIKNPGETLRLTCTVSGFSLTSDGVCWAHQAAGKGLEWMGGIWAGGGNNYNDGLKSRLPITRDTPKNRVFLQLTGLRPADTSVYYCAG
Chrysemys picta bellii Vs1122 ighv AHGY01285932.1 2709 VRSQVLVESGGDVKKPGDSLRLSCKASGFTFSSYHMNWVRQAPGKGLEWVAVIYTGGSTYYLDSVKGRFTISRDDSKSELYLQMTGLKPEDTARYYCAG
Chrysemys picta bellii Vs1120 ighv AHGY01285929.1 1445 VLSQLWLQESGPGVVKPGEMLTLTCAVTGGTVTSSYWWNWICQAPGQGLEWMGRWSGGTSYALSLQGRITITVDSSNTKNYLRLNSLTAADTGTYYCARG
Chrysemys picta bellii Vs1126 ighv AHGY01285943.1 1447 VLCQVKLVQSGPGAAKPGETLTLSCAVSGVSITTQHYYWSWIRQFPGKGLEWMGYVYPYSSGSTSYAPSLQGRITISADTAKSQFSLQLRSLTAADTATYYCAR
Chrysemys picta bellii Vs1125 ighv AHGY01285938.1 1245 CGAAVTLTQPSSAQADPGSSLSLDCVVSGYNINDHHLSWIRQAPGKGPVWLAAFRTGYTTYITDEFKGRVTPRTSGATARLNINSLTAADTATYYCARN
Chrysemys picta bellii Vs1124 ighv AHGY01285936.1 2009 VRSQALVESGGDVKKPGDSLRLSCKASGFTFSSAYMNWVRQAPGKGLEWVAYISSSGSTIYYLDSVKGRFTISRDNSKSELYLQMTGLKPEDTARYYCAR
Chrysemys picta bellii Vs1081 ighv AHGY01282668.1 4831 VRSQALVESGGDVKKPGDSLRLSCKASGLDFTGYRMHWIRQAPGKGLEWVTSISSGGVSIYYPHSVKGRFTISRDNSKSELYLQMTGLKPEDTARYYCA
Chrysemys picta bellii Vs1083 ighv AHGY01282673.1 865 QLKEMGPGAVKPGESLTLTCTISGDSVSSTSATWDWIRQPAGKGLEWVGRIYYRPSQWHTNYASSLQSRTTIAQDTSKNQFSLQLRSLTAADTATYYCARG
Chrysemys picta bellii Vs1084 ighv AHGY01282676.1 2931 IQSQALVESGGDVKKPGDSLRLSCKASGFTFSSYPMNWVRQAPGKGLEWVAYISSGGGTIHYLDSVKGRFTISRDNSKSELYLQMTGLKPEDTARYYCAR
Chrysemys picta bellii Vs1085 ighv AHGY01282678.1 8145 ARSQVVLTQSGTAVKKPGESHTVKCAVSGFNIMSYNMHWIRQAPGKGLEWLIYYYSSSDNSYFPTIQGQFTASKDSSNFYLQMTSLKPEDTTVYYCA
Chrysemys picta bellii Vs1086 ighv AHGY01282678.1 3808 VLSQVQLVQSGPGAVKPGETLALTCAVSGFSVSSSGYDWHWIRQPPGKGLEWMGRVYPYSSGTTNYAPSLQARITISADTAKNQVSLQLRSLTAADTAAYYCAR
Chrysemys picta bellii Vs1087 ighv AHGY01282681.1 776 VWSQVLVESGGDVKKPGDSLRLSCKASRFTFSSYYMSWVTQAPGKGLEWVGYISDGGGTAYLDSVKGRFTISRDNSKSELYLQLTGLKPEDTARYYCA
Chrysemys picta bellii Vs701 ighv AHGY01429484.1 277 AQAQVRLEESGGGAGNTGGSRRLSCTGSGFTFGSYYMFWYRQRPGEGLEWVSWISSSGGSTDYPDPVKGRFTVTRDNAKNQLYLQMSRLGPEDTARYHCAAR
Chrysemys picta bellii Vs700 trav AHGY01428273.1 95 GAVDTKVSQPAALSFLAGGRADLPCNHSVAGYDKIIWYYQSPGAAPRAVISGYNSAETSGRFELSIDPSSRSAPLRITEVAVQDSGVYYCAVR
Chrysemys picta bellii Vs704 ighv AHGY01436194.1 888 VLSQVLVQSGQGVVKPGDTLTLTCAVSGFSITTQHYDWHWIRQPPGKGLEWMGRVYPYSSGATNYAPSLQARITISADTAKSQFSLQLRSLTAADTATYYCARR
Chrysemys picta bellii Vs706 ighv AHGY01436694.1 1637 VRSQVQLVESGGDVKKPGDSLRLSCKASGFTFSSYAMSWVRQAPGKGLEWVAIIYPGGSSTDYLDSVKGRFTISRDDSKSELYLQMTGLKPEDTARYYCAR
Chrysemys picta bellii Vs668 ighv AHGY01403015.1 336 VISQVQLVQTGLGTVKAGETLSITCKVSGVSVSNYYWSWVRQPPGKELEWMGFIRHTVNGGTTEYNSAFTPRVTITRDTSKDEVYLQLRSLTTADTGTYYCG
Chrysemys picta bellii Vs666 ighv AHGY01402954.1 4001 VRSQALVESGGDVKKPGDSLRLSCKASGFDFSSYWMNWVRQAPGKGLEWVADISSSGGTIYYLDSVKGRFTISRDNSKSELYLQMTGLKPEDTARYYCAR
Chrysemys picta bellii Vs667 ighv AHGY01402955.1 3348 ARSQIVLTQSGPEMKKPGESTQLKCAVSGFTVSDYYMAWVRQEPGKELEWLVSYHTPSSTNYYSDSIQGRFTASKDSSNFYLQMTSLKAEDTAVYYCAR
Chrysemys picta bellii Vs1449 trav AHGY01527444.1 314 HRTDRGRLGEPNGRDRFSLRGDPVLLNCTYEFSGYPSPSWHVQDPNQPLQLFLRDVGREDSDEGVRRGFNAKAERKPASFHLGKASSKLSDSATYYCAVSDS
Chrysemys picta bellii Vs662 ighv AHGY01401416.1 328 VRSQVLVESGGDVKKPGDSLRLSCKASGFTFSSYNMDWVRQAPGKGLEWVAEISTDGSSQWYSPAVQGRFTISRDNPNNLLYLQMTGLKPEDTARYYCA
Chrysemys picta bellii Vs660 ighv AHGY01401415.1 185 ARPQVQLVESGGDVKKPGDSLRLSCKASGFPFSSYLMDWIRLAPGKGLEWLARAAAQGSTYYADSMQGQFTISRDNANSLVHLQISSLRAEDTALYYCVR
Chrysemys picta bellii Vs1450 ighv AHGY01528284.1 1412 ARSQIQLVQSGPGVVKPGETLSLTCTVSGYSISSGYHWAWIQQAPGKGLEYMGHVYAASGSTNYAPTFQGRITISADTAKNQFSLQLRSLTAADTATYYCA
Chrysemys picta bellii Vs60 trgv AHGY01036543.1 2975 GCAQIHLRQTQLSVTRAENKTARIVCEASGIQNFRSAVIHWYRHRSGEAPERILYISTIKVEFDKDTDKKKFDCEKKSDQSISTLVVNTITPNDRAIYYCAFWV
Chrysemys picta bellii Vs633 ighv AHGY01390179.1 345 ARSQVVLTQSGPALKKPRESHTLQCATSGFTLRSTWMDWVRQELGKGLEWLVSYYDPSYKSYTSSVQGRFTASKDSTNFYLQMTSLRAEDTAVYYCAS
Chrysemys picta bellii Vs1407 ighv AHGY01474517.1 2187 VLSATQLVQSGPGAVKPGDTLTLTCAVSGTSISSDTAWHWIRQPPGTGLEWMGWVYPYGRSTGYASSLQGRTTISADTAKNQFSLQLRSLTAADTGTYYCARQ
Chrysemys picta bellii Vs571 igkv AHGY01364967.1 321 SYGQIVLTQTPESLSVSPGERVTINCKAGTSISNYLGWFQQKSGQAPKLLIYDSTNRASGIPARFSGSGSGTDFTLTISSVEAEDAGDYYCQQRNSFP
Chrysemys picta bellii Vs1156 ighv AHGY01312009.1 2133 AWSQVVLTQSGPELKKPGESTRLKCAVSGFAVSSDYMAWVRQEPGKGLERLVRYHTPTATNYYSDSIQGRFTASKDSSNFYLQMTSLKPQDTAVYYCAR
Chrysemys picta bellii Vs1154 ighv AHGY01311999.1 626 VLCQVQLVQSGPGAVKPGETPTLTCAVSGFSITSSGYGWNWVRLPPGEGLQWLGYIGASGGTGYTPSLQSRLSFSRDTAKNALSLQLRSLTATDTATYYCTR
Chrysemys picta bellii Vs1155 ighv AHGY01312000.1 2185 VLSATQLVQSGPGAVKPGDTLTLTCAVSGTSISSDTAWHWIRQPPGTGLEWMGWVYPYGGSTGYDSSLQGRTTISADTAKNQFSLQLRSLTAADTATYYCTR
Chrysemys picta bellii Vs1152 ighv AHGY01311997.1 6694 VLSQVQLVESGPGVVKPGQTLTLTCAVSGVSITSSSYVWNWVRQPTRKGLEWVARIYPHDGRKWFAASLQSRTTISSDTSKNQFSLQLASLAAADTAMYYCAR
Chrysemys picta bellii Vs1153 ighv AHGY01311998.1 2503 VLCQVQLVQSGPGAVKPGETLTLTCAVSGFSITSSGYGWNWVRLPPGEGLQWLGYIGASGGTGYTPSLQSRLSFSRDTAKNALSLQLRSLTATDTATYYCAR
Chrysemys picta bellii Vs1150 ighv AHGY01311983.1 3969 AGAQARLVESGGDVKKPGQSLRLTCKGSGFDFSQAGMHWFRQAPGKGLEWVSVIFFDGSKEYYAASVKGQFTTSRDNSQKLAYLDMSSLKPEDTARYYCAA
Chrysemys picta bellii Vs1151 ighv AHGY01311989.1 1408 VRSQALVESGGDVKKPGDSLRLSCKASGFTFSSYSMNWVRQAPGKGLEWVAYISYDGSAIYYLDSVKGRFTISRDNSKSELYLQMTGLKPEDTARYYCAG
Chrysemys picta bellii Vs408 igkv AHGY01291181.1 2461 SSGQIVLTQTPESLAVSPGDTVTIRCKASSSVSIGSTHFLAWYQQKSGQAPKLLIYAGSSLQSGVPDRFSGSGSGTDFTLTISKVEAEDAGDYYCQQSLS
Chrysemys picta bellii Vs409 igkv AHGY01291183.1 7181 SSGQIVLTQTPESLAVFPGDRVSINCKASSNLTSSSSGKELLSWHQQKLGQAPKRLIYYADTLQSGVPARFSGSRSGSDYTLTISSVEAEDAGDYYCQ
Chrysemys picta bellii Vs1451 ighv AHGY01529428.1 1137 AHSQVQLVESGGDVKMAGESISISCKASGFTFGDYWMHWYRQAPGKGPEWVSAISYWAGTDKRYAESVKGRFTISRDNPNNLLYLQMTGLRPEDTAVYYCQR
Chrysemys picta bellii Vs402 igkv AHGY01291162.1 62 AKGQIVLTQTPESLAGFLGDKVTINCKASSSVGSYMAWYQQKSGQAPKLLIHSTSTRPSGIPDWFSGSGSGTDFTFTISQVEPDDARNYYCLQSNNFP
Chrysemys picta bellii Vs403 igkv AHGY01291163.1 1064 SSGQIVMTQTPESLAVSPGDRVAINCKASASVTGDYTLLGWYQQKSGQAPKLLIYGATSRASGIPDRFSGSGSGTDFTLTISNVQAEDAGDYYCQQAYS
Chrysemys picta bellii Vs406 igkv AHGY01291177.1 1784 SSADIVMTQSPESLAVSLGDRVTINCKASESITGSSGTIYLAWYQQKHRQAPKLLIYEASTRAAEIPDRFSGSGSGTDFTLTISKVEAEDAGDYYCQQSWS
Chrysemys picta bellii Vs407 igkv AHGY01291178.1 982 SSADIVMTQSPESLAVSLGDRVTINCKASESITGSSGTIYLAWYHQKHRQAPKLLIYEASTRASEIPDRFSGSGSGTDFTLTISKVEAEDAGDYYCQQGWS
Chrysemys picta bellii Vs405 igkv AHGY01291173.1 140 SNGQIVLTQTPESLAVSPGERVTINCKASSSLTHSSTGKELLAWYQQKSGRAPKLLIYYASTLQSGIPAQFSGSRSGSDYTLTISSVEAEDAGDYYCQ
Chrysemys picta bellii Vs43 trgv AHGY01036346.1 135 GEALELIQSQLSITKANDRTARIDCHVSGITLSSAYIHWYRQRPDAALERILYFSSGKPEFDQDSEKGKFEADKQLSKSTCTLTVKKTTKSDSATYYCAAW
Chrysemys picta bellii Vs338 ighv AHGY01255596.1 1191 ARSQVQLAASGPGLGQVSEPLTLTCAVSGGSVTADYWDWYRQLPRGGLDWLGEIDWYNSQWRVDYAPSLQGRITLSADSSKNQFSLLLHSLTAADTATYYCARR
Chrysemys picta bellii Vs339 ighv AHGY01255596.1 2546 ALSQVRLVESGPGVGKVSEPLTLTCAVSGDSIASSDYLWYRVPASPEAGLEYLGVITRSGTPFPAQSLRNRLTISRDTAKNQVSLQLVSLRAADTATYHCARRE
Chrysemys picta bellii Vs334 trav AHGY01255575.1 6963 AALGDSVLSREPEKSRSEGDTVTLSCSYTTSDSYVFLYWYRHYPNQAPQYILYRGAKSYSHLSDTASFAQERFSSQADGGSTVLTIAALELADTAVYLCALRL
Chrysemys picta bellii Vs335 trav AHGY01255583.1 236 LTQGQTVIQPVGETKVKEGEFVTLDCSYNSGFPTLLWYRQESGGSPQFILHEGSRHEDLEERFRNRFKAKINKTSRVFPLDISSVQLSDSATYYCALR
Chrysemys picta bellii Vs336 ighv AHGY01255587.1 606 AISQLQLVASGPGVGKVSEPLTLTCAVSGFSINTRYYYWHWLRQPPGKGLESMGWVYPYDGDTRYAPSLQGRVTISADTAKNQFSLQLRSLTATDTATYYCARR
Chrysemys picta bellii Vs337 ighv AHGY01255592.1 94 AQAQVRLVESGGGAANTGGSRRLSCTGSGFAFSSSTMYWYRQRPGEGLEWVSLITSTGGSTDYPDPVKGRFTVTRDNAKNQLYLQMSRLGPEDSARYHCAAR
Chrysemys picta bellii Vs330 trav AHGY01255555.1 14082 AALGDSVQSREPHLSGREGDTVTLTCSYDTSYTGYVYLYWYRQFPNQAPQYILRRGVKQARGESHSADFAKGKFSSQADDSSTVLSIAALELADSAVYLCALRL
Chrysemys picta bellii Vs331 trav AHGY01255557.1 784 AGLGDSVEPSKPAVSGGEGDAVTLTCSYNTDYSGGIYLYWYRHYPNRAPQYILWRGAKSYSKLNDTAEFAEKRFSSQTDDSSIVLTIKPLELADTAVYLCALRR
Chrysemys picta bellii Vs332 trav AHGY01255572.1 1767 AALGDSVQSREPHLSGREGDAVTLTCSYDTSSTGYVYLYWYRQFPGQAPQYILFRGVKSASEFSDTAGFAQERFSSQADDSSTVLNFTALELADTAVYLCALSV
Chrysemys picta bellii Vs333 trav AHGY01255575.1 1962 AALGDSVQPEELQVSGIEGDAVALRCSYDTSSTGSVYLNWYRQHPNQALQYILKRGAKLAQGYTHTADLAGKRFSSQGDDSSTVLNITALELADTAVYYCALER
Chrysemys picta bellii Vs1332 iglv AHGY01403679.1 514 SLTQYVLTQPSSVSVSPGQNAQLTCSGNNIGSKDVRWFQQKPGSAPLLVMYENSKRPSGIPDRFSGANSGNTATLTITGVQAQDEADYYCQAWDSSSAQ
Chrysemys picta bellii Vs1333 iglv AHGY01403682.1 495 SSSQTVVTQPPSVSVSPGNTVKLSCTLSSGTGIGDYYVYWYQQKPGNSPRYLLYYYSDSDKHQGSGVPARFSGSKDTSSNAGYLTISGALAEDEADYYCAVRKS
Chrysemys picta bellii Vs1239 igkv AHGY01351310.1 4965 SSGQIVLTQTPESLAVSPGDRVTINCKASSRVGSSYLSWYQQKSGQAPKLLIHSASTRPSGVPDRFSGSGSGTDFTFTISRVEADDAGDYYCQKGGSSP
Chrysemys picta bellii Vs1238 igkv AHGY01351310.1 9038 SSGQIVMSQTPESLAVSPGDRVTINCKASSSVGSWMAWYQQKSGQAPKLLIYGASTRPSGIPDRFSGSGSGTDFTFTISRFEAGDAGDYYCQQYSS
Chrysemys picta bellii Vs1336 ighv AHGY01406386.1 3911 VRSQVQLVESGGDVKKPGDSLRLSCKASGFTFSSYRMHWVRQAPGKGLEWVAIIYPGGSTIYYLDSVKGRFTISRDDSKSELYLQMTGLKPEDTARYYCAR
Chrysemys picta bellii Vs1337 ighv AHGY01406387.1 3432 VYSQISLVESGGGIKNPGETLRLTCTVSGFSLTSYAVHWARQPALKGLQWMGGIWAGGGNNCNDGLKSRLPITRDTSKNRVFLQLTGLRPADTSVYYCA
Chrysemys picta bellii Vs1334 iglv AHGY01404793.1 688 SLAQYVLTQPPAVSVSPGQNAQLTCSGNNIGSKDVQWFQQKPGSAPLRVIYGSGSGPSGIPDRFSGANSGNTATLTITGVQVQDEADYYCQVWDSSAQ
Chrysemys picta bellii Vs1335 ighv AHGY01406293.1 977 VLSQVQLVQSGLGTVKPGETLTLTCAVSGVSITDSSYAWHWIRQPPGKGLEWMGYVYPYSSGSTSYAPSLQGRITISGDTAKNQFSLQLRSLTAADTTTYYCARQ
Chrysemys picta bellii Vs1232 ighv AHGY01347553.1 3412 VRSQVQLVESGGDVKKPGDSLRLSCKASGFTFSSYQMDWVRQAPGKGLEWVAFINTGGGTVYYPDSVKGRFTISRDNSKSELYLQLTGLKPEDTAHYYCAR
Chrysemys picta bellii Vs1338 ighv AHGY01406634.1 1665 QLKETGPGAAKSGESLTLTCTISGDSVSSTRATWDWFRQPAGKRPEWMGCTWYRSGSWYTEYPSSLQSRMTITQDTSKNQFSLQLRSLTAADTATYYCSGR
Chrysemys picta bellii Vs1230 ighv AHGY01347552.1 1575 ALSQVQLVESGGDVKRPGDSLRLSCKASGFTFSSNWMHWVRQAPGKGLEWIARIYSSSINYSDSVKGRFTISRDDSKSELYLQMTGLKPEDTARYYCA
Chrysemys picta bellii Vs1237 ighv AHGY01350584.1 3148 VRSQALVESGEDVKKPGDSLRLSCKASGFTFSSSSMHWIRQATGKGLEWVTAINPGGSSTYYLDSVKGRFTISRDNSKSELYLQMTGLKPEDTARYYCAG
Chrysemys picta bellii Vs1236 ighv AHGY01350583.1 3606 ARSQVVLTQSGPEMKKPGESTQLKCAVSGFTVSGYYMVWLRQEPGKELEWLVSYHTPSSTNYYSDSIKGRFTASKDSSNFYLQMTSLRAEDTAVYYCAR
Chrysemys picta bellii Vs1235 ighv AHGY01350580.1 2717 VWSQVQLVESGGDVKKPGDSLRLSCKASGLTFSSYYMHWVRQAPGKGLEWVAIIYTDGSTDYLDSVKGRFTISRDDSKSELYLQMTGLKPEDTARYYCVR
Chrysemys picta bellii Vs42 trgv AHGY01036326.1 727 VLWAIHLEQEQISVTKQPLQGSSATFTCKVFGGSDSTYIHWYRARAGEAPQRLLYLTLSGSELKREAGFSNDKFVAYARQSTCILMVYKLEETDSGRYFCATWDI
Chrysemys picta bellii Vs536 trav AHGY01357468.1 166 GANGESVTQPDDRVTVSQGEPVLLKCTYDNTPIPTLWWYEQHPNEAPRLLLTQYEALDEEDRKSRRGFSATPEKQESFHLKKNSSELSDSAVYYCGMS
Chrysemys picta bellii Vs537 trav AHGY01357474.1 394 FVQGDSVFQSPLEVTVSEGHDVLLHCNFTTTSSGPYLFWYRQYPNQPPQHILTAYKSPAEKNTFTSGKFSTVLFDHNKTVPLKIEAVSLQDRAVYYCALR
Chrysemys picta bellii Vs534 trav AHGY01357458.1 1094 SCCEAQVDQSPESLVTGEGKVSTMSCSFTSAFKIFQWYQQLPGQGPTHLLTASSNENVTVGRFIGERLESGKRSSLHITDSQLGDSGPYLCAVD
Chrysemys picta bellii Vs535 trav AHGY01357467.1 876 AVLGDSVQPREPQMSGVEGGSVTLSCSYESSYTAGVYLYWYRQYPNRAPQYILRRGTKGARSGSDTADFAQERFSSHADGNSTGLSIAALELADTAVYLCALQR
Chrysemys picta bellii Vs532 igkv AHGY01357441.1 378 SSGQIVMTQSPESLAVPVGGRVSINCKASTSISNNLQWYQQKPGQAPKLLIYLATNLQSGVPARFSGSGSGTDFTFTISSVEAEDAGDYYCQQSSSWP
Chrysemys picta bellii Vs533 trav AHGY01357455.1 241 SCCEAQVDQNPQSLVTGEGKVSTMSCAFTSKYQTFHWYQQLPGRGLTHLLTVSPQENATEKRFVGQPLEDGKRSSLHITDSQLGDSGSYLCAVD
Chrysemys picta bellii Vs531 igkv AHGY01357432.1 5552 SSGQTVMTQSPESLALPVGGRVSVNCKASTSITNDIHWYQQKPGQAPKLLISYASSLQSGVPARFSGSGYGTDFTFTISSVEADDAGDYYCQQSNSFP
Chrysemys picta bellii Vs538 trav AHGY01357477.1 556 SALGDSVKSNEPEVSGSVGGSVTLSCSYTTTDSYVYLYWYRLYPNQAPQYILYRGAKSYSGQSHTANFAQQRFSSQADDSSTVLNITALELADSAVYYCALQR
Chrysemys picta bellii Vs1489 ighv AHGY01550336.1 5157 FFSCSLLSLSGAFLFPRVIPINSSLKLSCKAAGFTFSSSWMNWVHQVPGKGLQWAAWIRSDSGLGQRAIHHLQGQSQQPAVSANDQPEDTARYHCARDRQ
Chrysemys picta bellii Vs909 igkv AHGY01110891.1 23167 AKGQIVLTQTPGDTARDSGDRVTINCKASSSVSNSYMHWYQQKSGHTPKLLIYSTSTRPSGIPDRFSGSGSGTDFTFTISRVEADDAGDYYCQQAHSLP
Chrysemys picta bellii Vs908 igkv AHGY01110889.1 2789 SQGQIVLTQTPESLAVSPGDRVTINCKASSSLTDEDFGSDTLAWYQQKTGQAPKLLIYEASTLQTGVPARFSGSGSGTDFTLTISSVEAEDAGDYYCQQGSQTP
Chrysemys picta bellii Vs1484 ighv AHGY01550333.1 4692 VSSQIQLTQSGAEIKKPGESVRVTCKTSGYTFTSYDISWVRQAPGKALEWIGYIYTSSGGTGYAQAFQGRFTITRDTSISTAYLQLGSLRTDDTATYYCA
Chrysemys picta bellii Vs1485 ighv AHGY01550334.1 14765 ARSQVQLVESGGDVKKPGDSLRLSCKASGFTFSSYWMGWVRQAPGKGLEWIASIYSTSIYYSDSVKGRFTVSRDDPNSLLYLQMTGLKPEDTARYYCAR
Chrysemys picta bellii Vs1486 ighv AHGY01550334.1 8640 FFSCALLSLSGALLFPRVIPINSSLKLSCKASGFTFSSSWMNWVHQAPGKGLQWAAWIRSDSRLGQRAIHHLQGQSQQPAVSANDQPEDTARYHCARDRQ
Chrysemys picta bellii Vs1487 ighv AHGY01550334.1 6644 VSSQIQLTQSGAEIKKPGESVKVTCKTSGYNFASYNIHWVRQAPGKGPEWIGYISAYSGSTGYAQAFQGRFTITRDTSISTAYLQLGSLRTDDTATYYCA
Chrysemys picta bellii Vs1480 ighv AHGY01550331.1 6715 VSSQIQLTQSGAEIKKPGESVKLTCKTSGYTFTSYNINWVRQAPGKALEWIGYITPSTGGTGYAQAFQGRFTITRDTSISTAYLQLGSLRTDDTATYYCAR
Chrysemys picta bellii Vs1481 ighv AHGY01550332.1 2313 VSSQIQLTQSGAEIKKPGESVKLTCKTSGYTFTDYYINWVRQAPGKGLEWIGYIYPSSGSTSYAQAFQGRFTITRDTSISTAYLQLGSLRTDDTATYYCAR
Chrysemys picta bellii Vs1482 ighv AHGY01550333.1 9798 VKAQIQLVQSGAEVKKPGESVKESCKGSGYTFTSYGISWVQQIPGKGLFDIGWINTDTGAPAYRENLKGKVTMTLDKPLSTAFLLVSSLRAEDTAVYYCA
Chrysemys picta bellii Vs1483 ighv AHGY01550333.1 8449 NVVLVESAGRLKKPGESLKLSCKASGFTFSSSWMDWVRQAPGNVLQWVASIRQDGGDSYYPDWVKGRFTISRDNPNNPLYLQLTDLKTEDTTRYYCAR
Chrysemys picta bellii Vs1248 ighv AHGY01353475.1 2843 ARPQVQLVESGGDVKKPGDSLRLSCKASGFPFSSYLMDWIRLAPGKGLEWLARAAAQGSTYYADSVQGRFTISRDNANSLVHLQISSLRVEDTALYYCVR
Chrysemys picta bellii Vs1249 ighv AHGY01353475.1 1244 AGAQARLVESGGDVKKPGQSLRLTCKGSGFDFSQAGMHWLRQAPGKGLEWVSVIFFDGSKEYYAASVKGRFTTSRDNSQNLAYLDMSSLKPEDTARYYCAA
Chrysemys picta bellii Vs1246 ighv AHGY01353474.1 6067 VRAQVQLVESGGDVKKPGDSLRLSCKASGFTFTSYNMDWVRQAPGKGLEWVAEIYTDGSSQWYSPAVQGRFTISRDNPNNLLYLQMTGLKPEDTARYHCA
Chrysemys picta bellii Vs1247 ighv AHGY01353474.1 3059 VRSQVKLLQTGAAQVKPSQTLRLTCSVSGFSLTSSGYRMSWVRQPPGKGLEWLSAVDWDEDKYYQESLKNRLTISRDTSKSEVYLEMRGMEAGDSGTYYCAGS
Chrysemys picta bellii Vs1245 iglv AHGY01353355.1 705 SSSQTVVTQPPSVSVSPGNTVKLSCALSSGTSIVDYYVSWYQQKSGNSPRYLLYYYTDSSKGQGSGVPARFSGSKDTASNAGYLTISGVLAEDEADYYCAVIKS
Chrysemys picta bellii Vs1242 igkv AHGY01351317.1 1927 SSGQIVLTQTPESLAVSPGDRVTINCKASSSVSYMAWYQQKSGQALKLLIYRASTRPSGIPDRFSGSGSGKDFTFTISRVEADDAGDYYCQQYTS
Chrysemys picta bellii Vs1243 igkv AHGY01351320.1 1231 SYGQVTMTQSPESLSVTPGEKVTIRCTASSSLGSYYVSWYQQKPGQAPKLLIYQASTLESGVPARFSGSGSGTVYTLSISSVEADDAADYYCFQWDSSP
Chrysemys picta bellii Vs1240 igkv AHGY01351311.1 495 SSGQLVLNQTPESLEVSPGDRVTINCKVISSVNSHYMAWYQQKSGQAPKLLVYSASTRPSGIPDRFSSSESGMDYTFTINQVEADDAGDYYCLHYSSSP
Chrysemys picta bellii Vs1241 igkv AHGY01351313.1 1857 SSGQLVLTQTPESLAVSPGDRVTINCKAISSVTSNFMAWYQQKSGQVPKLLIYGASTRASGIPDRFSGSGSGTDFTFTISRVEADDAGDYYCQQHSSSL
Chrysemys picta bellii Vs990 trbv AHGY01190179.1 12372 SGLGVLISQLPRTVTQRPGETMKITCVQNETSYTYMYWYKQLQGEGPRLIAQSVDGFNATYEERYNATKFPITRLNTRISSMSVVDLRTQDSASYFCAAS
Chrysemys picta bellii Vs991 trbv AHGY01190179.1 7688 AGVGDLISQWPTSAIQKPGEAVTMNCYQNGTVRTNMLWYQQPQGEGLKLIAITYTGSRPSYEKDFNESKFVISREQQRLSDMTVKKVTARDAATYFCAAS
Chrysemys picta bellii Vs992 trbv AHGY01190179.1 5496 LCSGVTVTQKEKFIAIQNGREARIPCEHDDKTYITVLWYQQKGAERQLQLVAFSVDGNPAVIEDQFKTRFNVTRPATLNTSLTINPGTVEDTAVYFCAASK
Chrysemys picta bellii Vs993 trbv AHGY01190180.1 1269 LCSGVTVTQKEKFIAIQNGSKGSIPCEHDDNSYYTVLWYQQKNGAERQLQLVATSLDVNSAEMEKEFKTRFNVTRPATLNTSLTINPGMVEDTAVYFCAASK
Chrysemys picta bellii Vs994 trbv AHGY01190183.1 13675 SHFLPGVGSAYVEQLPFLTGRHGRSLALQCTLTQSNCDRMFWYRQRGGRELEGLFYSYGDQLVNFTAELLTAQRSNKNWNLKWKSLSQSDSAVYYCAC
Chrysemys picta bellii Vs995 trbv AHGY01190183.1 9493 MGSAYVEQPPFLTGARENPKTLQCTLKQSSCSWMYWYRQREGKELEGLFNSVGDGPGTNFTAEPMTALRNNTKWDLIWRSLSLSDSAVYYCAC
Chrysemys picta bellii Vs996 trbv AHGY01190191.1 7627 VGSAYVEQLPFLTGVAGESQTLQCTLKETSHYWMYWYWQKEAEELGQLFYSSGDGSGTNFTAEPMSAWRKNNNWHLQWKDLSWSDSAVYYCAC
Chrysemys picta bellii Vs1414 ighv AHGY01486910.1 791 RLVESREDIKKPGQSLRLTCKGSGFDFSQAGMHWLRQDPGKGLERVSMFFFSGSKEYYVASVKGPFTTSRNNSPNLAYLDISGLKPEDTARYYCAA
Chrysemys picta bellii Vs1419 ighv AHGY01493788.1 952 ARSQVVLTQSGPEVKKPGESTQLKCAVSGFVPNDWWMDWVRQLPGKGLEWLVHYRQSSVTNYYSPSIQGRFTASKDSTNFYLQMTGLKPEDTAMYYCA
Chrysemys picta bellii Vs1418 iglv AHGY01492304.1 429 FSSQQLQSLKASEFVSPGGTVTLSCSLSSGAITDNSFPHWVQQRLGNVPQLIMHTTGTRPSGIPERFTGSRSGNTMSLTIKGALAEDDADYYCCVWTGSA
Chrysemys picta bellii Vs471 iglv AHGY01322244.1 1016 CYAQVTQPPSEFVSPGGNVQLPCTLEGSYTVSANRVIWIQQRPGSVPRYLMYFYTESNKGMGSGVPSRFAGSRSGSDKIGYLTITGAQAEDDAVYYCVTWTGSA
Chrysemys picta bellii Vs470 iglv AHGY01322242.1 4248 VQTQPVLTQEPSVSIASGESVTLKCVMSAAKFKDYCVDWYQQKSGSAPSIILEYCAKSGLKRGEGVPERFSGSKDHSLDKGYLNISRVQPEDEADYYCSIWDK
Chrysemys picta bellii Vs49 trgv AHGY01036448.1 122 GCAQIHLRQTQLSITRANDKTARIDCEALGIQNFGSAVIHWYRHRSGEAPEWILYFKTQSDQLSMDRKKFIVEKTTEKSTCTLRVDKLTYNDMATYYCAYWD
Chrysemys picta bellii Vs623 trav AHGY01384931.1 807 QSNGEPVTQTKGSVLISQGESVVVNCTYEAVSPSLFWYVQFPSQPPRLFLRDLGRENSEEGIRKGFDATHDKQHKSFHLRKPSSELSDSATYYCALS
Chrysemys picta bellii Vs48 trgv AHGY01036442.1 866 GYAQIHLRQSQLSITRAKDKTARIDCEASGIQDFESAVIHWYRHRPGEAPEWILYFKTQSDQSSIDRKKFRVEKTTEKSTCTLRVDKLTYNDMATYYCAYWD
Chrysemys picta bellii Vs570 igkv AHGY01364965.1 321 SYGQIVLTQTPESLSVSPGERVTINCKAGTSISNYLAWFQQKSGQAPKLLIYDSTNRASGIPDRFSGSGSGTDFTLTISSIETEDAGDYYCQQRNSFP
Chrysemys picta bellii Vs588 trav AHGY01366326.1 535 APGRAEIRQPRSAEALAGAELNLTCSHGSLTTETIFWYRQFASRGPQYIVSGYQGIVNSIDPEGALHIPEDRKSSTLSLRRARLADAAVYYCALR
Chrysemys picta bellii Vs198 iglv AHGY01182588.1 10489 SLAQYVLTQPPSVSVSPGQNAQLTCSGNNIGGKSVYWYQQKPGSAPLLVIYGSSSRPSGIPDRFSGANSGNTATLTITGVQAQDEADYYCQVYDSGA
Chrysemys picta bellii Vs199 iglv AHGY01182588.1 16593 SSSQPVLTQPPLVSVSSGNTVKLSCTMSSGTSISDYYVNWYQQKPGNSPRYLLRYKSDSDKGQGSGVPARFSGSKDTASNTGYLTISWTLVEDEADYYCAV
Chrysemys picta bellii Vs1118 ighv AHGY01285926.1 6305 APVGTGGDEAQRDPHPDVCCLQGLHLYSILSLGLDPAAPETGLEWLGEIYPYNRDTAYAPSLQGRVTMSAGTVKSQVSLQRRSLRAADTATYYCARRP
Chrysemys picta bellii Vs1119 ighv AHGY01285929.1 5330 VLSQVQLVQTGPGVVKPGETLTLTCAVSGYSITSGYSWSWIRQPPGTGLEWLGRGYYSGSTWNTNYASSFQSRITISTDSSKNQFSLQLRSLTAADTSTYYCA
Chrysemys picta bellii Vs1112 ighv AHGY01285914.1 1174 VFSQVQLVLSGPEAAKPRETLTLSCAVSVVSISTQYNYWEWIRQSPGKRLEWMGGVYPYDGTMSFIPSIKSRATISADTAKNQFSLQLRSLTAADTATYYCAR
Chrysemys picta bellii Vs1113 ighv AHGY01285918.1 1184 QLVESGPGTVKPSETLSLTCSISGASSDTLGSSCCWWHWIRQSPGKGLEWMGDIEQGGRKYYASSLQSRITISENPSKNQFSLELRSLTAADTGTYYCARS
Chrysemys picta bellii Vs1110 igkv AHGY01283650.1 2348 SSGQIVMTQSPESLTVTPGDKITINCKASSDPLTYVAWYQQKSGQPPKLLIYAVSTRPSGVPERFSGSRSGNDFILTVNRVDVDDTGDYYCEQSRNFQS
Chrysemys picta bellii Vs193 iglv AHGY01182587.1 1242 SLAQYVLTQPPSVSVSPEQKAQLTCSGNNIGGKNVQWYQQKPGSAPLLIIYHDSSRPSGIPDRFSGANSGNTATLTITGVQAQDEADYYCQVYDSSA
Chrysemys picta bellii Vs1116 ighv AHGY01285923.1 528 VRSQMQLVESGGDVKKPGDSLRLSCKASGFTFSSYNMKWVRQAPGKGLEWVAHINPNLSIVYLDSVKGRFTISRDDSKSELYLQMTGLKPEDTARYYCAR
Chrysemys picta bellii Vs1117 ighv AHGY01285924.1 4338 VRCQVQLVESGGDVKKPGDSLRLSCKASGFTFSSYRMYWIRQAPGKGLEWVAYISGSRVIIRYLDSVKGRFTISKDNSKSELYLQMTGLKPEDTARYYCA
Chrysemys picta bellii Vs196 iglv AHGY01182588.1 2682 SISQPVLTQPPSVSVSPGNTVKLSCTMSSGTSISDYVVFWYQQKPGNSPRYLLYYYSESVKGQGSGVPARFSGSKDTASNAGYLTISGALAEDEADYYCAV
Chrysemys picta bellii Vs1115 ighv AHGY01285922.1 29758 NHRSNCSFTGDVKKPGDSLRLSCKASGFTFTSYWMGWVRQAPGKGLEWLALIHGSSIYYSDSIKGRFTISRDDPNSLLYLQMTGLKPEDTARYYCAR
Chrysemys picta bellii Vs696 ighv AHGY01422295.1 305 SQAQVRLVESGGGAANTGGSRRLSCTGSGFAFSSYTMFWYRQRPGEGLEWVSRITSSGGSRDYPDSVKGRFTVTRDNAKNQLYLQMSRLGPEDSARYHCAVR
Chrysemys picta bellii Vs1464 ighv AHGY01545292.1 708 VRSDVQLVESGGVKKPRDSLRLSCKTSGFTFADYNMHWIRQAPGKGLDWVAYISGPSGTYIGYSQAVKGRFTISRDNSNSLLNLQMSDLKAEATGLYYCARE
Chrysemys picta bellii Vs694 ighv AHGY01419829.1 740 VLCQVQLVQSGPGAVKPGETLTLTCAVSGFSITSSGYGWNWVRLPPGEGLQWLGYIGASGDTGYTPSLQSRLSFSRDTAKNALSLQLRSLTATDTATYYCTR
Chrysemys picta bellii Vs693 ighv AHGY01419827.1 209 VLSATQLVQSGPGAVKPGDTLTLTCAVSGTSISSDTAWHWIRQPPGTGLEWMGWVYPYGRSTGYASSLQGRTTISADTAKNQVSLQLRSLTAADTGTYYCARQ
Chrysemys picta bellii Vs692 ighv AHGY01419826.1 1309 VLSQVQLVQSGPGAVKPRETLSITCKISGVSISSYHWSWARQPAGKGLQWMGIIRSSAAGGTTEYNSDFKPCVTMTRDTLKDEVYLQLGSLTAADTGTYYCAR
Chrysemys picta bellii Vs752 ighv AHGY01491133.1 1948 VLSQVQLVQTGPGAVKPGATLSITCKVSGLSVSSYYWGWARQPPGKGLEWMGRIQSTADGGNTAYNSAFSSRITITRDTSKDEVYLQLRSLTAADTGTYYCA
Chrysemys picta bellii Vs750 ighv AHGY01489664.1 1749 ARSQVQLVESGGDVKKPGDSLRLSCKASGFTFSSHWMDWVRQAPGKGLEWVSGISGGGSTYYPASVRGRFTISRDTSSNLLYLQMTSLRPEDTAVYYCARE
Chrysemys picta bellii Vs279 ighv AHGY01251528.1 2267 QLVPSGPGAVKPGETLTLTCAVSGDSSSVISSGCCYWSWIRQSPRKGLEWMGRITKGGSTDYATSLQSRITIAVESSKNQFSLQLRSLTAADTATYYCAR
Chrysemys picta bellii Vs278 ighv AHGY01251525.1 8712 ARSQINLVESGGDVKKPGDSLRLSCKASGFTFSDYGMNWVRQAPGKGLEWVGYISDGGGIIRYLDSVKGRFTISRDNSKSELYLQMTGLKPEDTARYYCAR
Chrysemys picta bellii Vs271 ighv AHGY01251517.1 2717 ARSQVLVKSGGDVKKPGDSLRLSCKASGFTFSSYDMSWVRQAPGKGLEWVSLIYSDGSQQYYTDSVKGRFTISRDNSNNLLYLQMTGLKPEDTARYHCA
Chrysemys picta bellii Vs270 ighv AHGY01251515.1 757 VRSQVLLVESGGGIQKPGGSLRLSCKASGFTLSSYFMGWVRQAPGKGLEWVSLIYNPAYSLSTFYSDAVKGRFTISRDDSNSLVYLQMNSLKAEDTARYYCAR
Chrysemys picta bellii Vs273 ighv AHGY01251521.1 271 AWSQVQLVESGGDVKKPGDSLRLSCKGSGYTFSSHRMSWVRQAPGKGLEWVAYIYSTSIYYSDSVKGRFTVSRDDPNSLLYLEMTGLKPEDTARYHCAG
Chrysemys picta bellii Vs272 ighv AHGY01251517.1 6955 VRSQALVESGGDVKKPGDSLHLSCKASGFKVGDYGMHWVRQAPGKGLEWVSRIYWDVWNHYYYADSVKGRFTISRDDSNNRLHLDMTGLKPEDTARYYCV
Chrysemys picta bellii Vs275 ighv AHGY01251523.1 5296 QLRETGPGVVKPGESLTLTCTISGDSVSSTSATWNWIRQPVGKGLEWMGWIYYRSSGWHTEYPSSLQSRVTITQDTSKNQFSLQLRSLTAADTATYYCAR
Chrysemys picta bellii Vs274 ighv AHGY01251521.1 5754 ARSQVQLVESGGDMKKPGDSLRLSCKASRFTFSNHSMHWVRQAAGKGLEWVAQVSKPTGSSQWYSPAVQGRFTISRDNSINTVYLQMTDLKPEDTARYYCA
Chrysemys picta bellii Vs277 ighv AHGY01251523.1 20708 VQSQVQLVESGGGIQTPGGSLRLSCKASGFTFSSYHMNWVRQAPGKGLEWVAQILNPAYSSAAYYSDAAKERFTISRDESRSSVYLQMTSLRAEDTARYYCVRR
Chrysemys picta bellii Vs276 ighv AHGY01251523.1 13993 ARSQVALTQSGPALKKPRESHKLQCATSGFTLSSTWMSWVRQEPGKGLEWLAYYYGESNTKHYASSVQGRFTASKDSTNFYLQMTSLRAEDTAVYYCAR
Chrysemys picta bellii Vs910 igkv AHGY01110891.1 19204 AKGQIVLTQTPESLAVSPGDRVTINCKASSSVSNSYMHWYQQKSGHAPKLLIYSTSTRPSGIPDRFSGSGSGTDFTFTISRVEADDAGDYYCQQAHSLP
Chrysemys picta bellii Vs190 iglv AHGY01182585.1 15321 SSSQPVVTQPPSVSVSPGNTVKLSCTTSSGTSISDYSVYWYQQKPGNTPRYLLYYYTESEKHQGSGVPARFSGSKDTSSNAGYLTISGALVEDDADYYCAV
Chrysemys picta bellii Vs912 igkv AHGY01110891.1 10452 SSGQIVMTQTPESLAVSPGDTVTIRCKASSSLTHNSYHYMAWYQQKSGQAPKLLIYAGSSLQTGVPARFSGSGSGTDFSLTINRVEAEDAGDYYCQEVWS
Chrysemys picta bellii Vs284 ighv AHGY01251539.1 1507 ARSQGALTQSGTAVKKPGESHTVKCAVSGFNVMGYNMFWIRQAPGKGMEWIIHYYSPSRNNYSPAIQGRFTASKDSSNFYLQMTSLKPEDTAVYYCAR
Chrysemys picta bellii Vs286 ighv AHGY01251541.1 4128 ARSQVQLVESGGDVKKPGDSLRLSCKASGFTFSSYWMSWVRQAPGMGLEWIGEIHPTSTTINYAQPFKGRFTISRDNPNNLLYLQLTGLKPEDTTRYYCAR
Chrysemys picta bellii Vs287 ighv AHGY01251546.1 1270 ARSQVVLTQSGTAVKKPGESHQLQCAVSGVSSMGNMHWIRQAPGKGLEWLIYYYSPSDNSYSPAIQGRFTASKDSSNFYLQMTSLKPEDTAVYYCAR
Chrysemys picta bellii Vs280 ighv AHGY01251529.1 6189 VRSQIQLVPSAPGVVKPGESLTVTCTVSGDSIATGAWWNWVRELPGRGLQWVGRIHFSGSANYAPDLQTRANIAKDDAKNEFYLQLRSLTAADTATYYCTRWD
Chrysemys picta bellii Vs281 ighv AHGY01251530.1 903 VRGQIQLVQSGPGVVKPGATLTLTCTVSGQSITSGHGWHWVRQPPGKGLEWLGRRYYSSSTWQTNYGSSFQSRITISPDSSKNQFSLQLASLTDADTAMYHCARE
Chrysemys picta bellii Vs282 ighv AHGY01251535.1 1339 VYSQISRVESGGGIKRPGETLRLTCTVSGFSLTSNHVHWARQPPGKGLEWVGGIAPGGGTAYSNVLKNRLTITKDNSKSRVFLQLTGIQPADTSVYYCAR
Chrysemys picta bellii Vs283 ighv AHGY01251536.1 1437 VLSEVRLVQSGPGVAKPGETLTLTCAVSGISITDSTYYWQWIRQAVGKGLEWMGLLHPNSGGTSYPPSLKGRVTLSADSSKNQVSLQLRSLTAADTATYYCTR
Chrysemys picta bellii Vs914 igkv AHGY01110892.1 4003 SSGDIVVTQTPESLAVSPGERVTINCKASSSLTYKDKNYLAWYQQKMGQAPKLLIYGASTRPSGIPDRFSGSGFGTDFTLTISRFEADDAGDYYCQQ
Chrysemys picta bellii Vs288 ighv AHGY01251546.1 3811 VRSQVQLVESGGDVKKPGDSLRLSCKASGFTFSGYTMYWVRQAPGKGLEWVSRIYDDGSAVYYADTVKGRFTISRDNPKNLLYLQMSNLKPEDTGRYYCAR
Chrysemys picta bellii Vs915 igkv AHGY01110892.1 2042 ASGQIVMTQTPESLAVSPGDRITINCKASSSLTYQGNKYLAWYQQKMGQAPKPLIYLASTRASGIPDRFSGSGSGTDFTLTISRVEAEDAGDYYCYQ
Chrysemys picta bellii Vs472 iglv AHGY01322245.1 6715 VQTQPVLSQEPSVSIAPGEPVTVKCVMSGAKFKYYCVDWYQQKSGSAPSIILEYCAKSGLKRGEGVPERFLGSKDHSLDEGYLNISRVQPEDEADYYCSIWDD
Chrysemys picta bellii Vs578 igkv AHGY01365010.1 12214 SNGQIVMTQTPESLLVSPGDTATIRCKASATAYSSMYWYQQKSGQSPKLLIHSASTRPSGIPDRFSGSGSGTDFTFTISRVEVDDAGDYYCMQGQSFP
Chrysemys picta bellii Vs579 igkv AHGY01365010.1 20130 SNGQIVLTQTPESLAVSPGDTVTIRCKASSSLYSSGFEKLAWYQQKSGQAPKLFIYHASNRDSGIPARFSGSGSGTDFTLTISRVEAEDAGDYYCQQYRSYP
Chrysemys picta bellii Vs191 iglv AHGY01182585.1 21555 SLAQYVLTQPPSVSVSPGQNAQLTCSGNNIGSKPVSWYQQKPGSAPLLVIYSDGSKPSGIPDRFSAANSGNTATLTITGVLAQDEADYYCLVREG
Chrysemys picta bellii Vs572 igkv AHGY01364983.1 1073 SSGQIVLTQTPESLAVSPGDRVTINCKASSSASGWVAWYQQKSGQAPKLLIYLASTRPSGIPDRFSGSGSGTDYTFTISRVEADDAGDYYCQYHYSSP
Chrysemys picta bellii Vs573 igkv AHGY01364988.1 1103 SSGDILMTQTPELLLVSPGDRITINCKASSNVYSYMAWYQQKSGQAPKLLIRSASTRPSGIPDRFSGSGSGTDFTFTISRVEGDDAGDYYCQHYY
Chrysemys picta bellii Vs479 ighv AHGY01327263.1 9817 FVASGGEVKMLRDSLRIACKTSGFSFGDYRMTWYRITPGKGLEWGSTISYWARNKKNYAASVKGRFTVSRDNPNILLYLHLTNLRPEDASEYYCML
Chrysemys picta bellii Vs478 ighv AHGY01327263.1 8141 VQTSNEFVASGGEIKMLGDSLRISCKTAGFNFGGYGMNWVRHTPGMGLERVATISNAGDPVYYSESVKGRFTISRDNSRSLLYLHMTELRPEDAAEYYCTW
Chrysemys picta bellii Vs576 igkv AHGY01364999.1 1454 TNAQIVLTQTPESLAVSPGDTVTIRCKASSSLTSGSYQVLAWYQQKPGQAPKMLIYYATSRPSGIPTRFSGSGSGTDFTLTISRVETEDAGDYYCQQGKSLP
Chrysemys picta bellii Vs577 igkv AHGY01365010.1 2879 AKGQIVLTQTPESLAVSPGDRVTINCKASSNANRNIQWYHQKSGQAPKLLVYTTSTRPSGVPDQFSGSGSGTDYTFTISRVEADDAGDYYCQQSQSWP
Chrysemys picta bellii Vs574 igkv AHGY01364991.1 1523 SSGQIVLTQTPESLAVSPGDRVTINCKASSSAGGWMAWYQKKSGQSPRLLIHSASTRPSGIPDRFSGSGSGTDYTFTISRVEADDAGDYYCQQHS
Chrysemys picta bellii Vs575 igkv AHGY01364993.1 1297 SSGQIVVTQTPESLAVFPGDRVTINCKASSSVNEWVAWYQQKSGQAPKLLIYSALHRPPGIPDRFSGSELGTDYTLTISRVEADDAGDYYCQYHYSSP
Chrysemys picta bellii Vs305 trav AHGY01255476.1 2706 QSNGEPVTQTKGSVLISQGESVVVNCTYEAVSPYLFWYVQFPSQPPRLFLRDLGRENSDEGIRKGFDATHDKNHKSFHLWKPSSELSDSATYYCALR
Chrysemys picta bellii Vs304 trav AHGY01255471.1 545 APGRAKIQQPVSAEGLEGAELNLTCSHPSASTDNIFWYRQFPNRGPEFIVTGFSGTAHSPDPEGTLHISKDKENSTFALRRVRLADAAVYYCARR
Chrysemys picta bellii Vs307 trav AHGY01255476.1 13519 ALGRAEIQQPVSAEAVEGEKLTLSCNHPNVTTEKIMWYRHVPSQAPRLLAGGFRGETPGTEAGGTLYIAQDKASSVFEFRRVRLADAAVYYCALS
Chrysemys picta bellii Vs306 trav AHGY01255476.1 10905 GVYGADSVTQTDGSVFISQGDPVLLNCTYQISGFPYLFWYVQFPNQPPRLFLRDPGREDSDEGIIKGFDAIHDKEQKSFQLWKLSSEVSDSATYYCAGT
Chrysemys picta bellii Vs300 ighv AHGY01251568.1 5136 ARSQVVLTQSGPEVKKPGESTQLKCAVSGFVPNDRWMDWVRQLPGKGLEWLVHYRQSSVTNYYSPSIQGRFTASKDSSNFYLQMTSLKAEDTAVYYCAR
Chrysemys picta bellii Vs303 trav AHGY01255470.1 834 APGSAEIRQPRSAEALEGAEMNLTCSHGSVTTETIVWYRQFPSRGPQYIVSGYQGIFNSIDPEGALHIPEDRKSSTLSLRRVRLADAAVYYCALR
Chrysemys picta bellii Vs309 trav AHGY01255486.1 1866 LAQSDSVDQSPPEVRVSEGQSVTLHCNFTTADSSPYLFWYRQFPNRPPQHILTKTKFDAPDQTLVQGKFSASLYMANKTVPFKIEAVSHQESAVYYCALR
Chrysemys picta bellii Vs308 trav AHGY01255477.1 405 IFGDSVTQTEGTVLVKEGAPLVIECTYETILFPYLLWYIQYPNEAPKLWLRDKTSGGGQDEGDKQGFFADHVQNKKSFDLKKSSSEVNDSAVYYCAFR
Chrysemys picta bellii Vs1202 ighv AHGY01329720.1 9599 ARSQVLVGSGGDMKKPGDSLHLSCKASGFTFSSYAMSWVRQAPGKGLEWVSSINYDGGKTYYADSVKGRFTISRDNHNNLLYLQMTGLKPEDTARYHCVG
Chrysemys picta bellii Vs1203 ighv AHGY01329740.1 656 IQSKLDFVASGGKVKMLGDSLRISCKTSGFTFGDYGMTWYRHTPGKGLQWVAYISKSSGDTKSYADSVQGRFTISRDNSRSLLYLHMTNLRREDAAEYYCGW
Chrysemys picta bellii Vs1200 ighv AHGY01327204.1 402 ARAQVVLTQSSPEIKKPGESTKLTCTVSGFALSSTSMHWVRQAPGKGLQWLIYYYSSSSNSYSPTIQGRFTASKDSSNFYLHMTSLRAEDTAVYYCAR
Chrysemys picta bellii Vs1206 trdv AHGY01331096.1 1991 VGSDVVLEQGAQALSVREGEEVTFQCSVKGGEMSSYWMYWYRKGQRGPLTWIYREGDHYGEGFQGRFVGKVDSSNNRFTLRILSAELRDRAVYYCASS
Chrysemys picta bellii Vs192 iglv AHGY01182586.1 1325 SLAQYVLTQLPAVSVSLGQNAQLTCTGEKVDKQYVYWVQQKPGRAPVLVIYKDSERPSGIPERFSGASSGKTATLTITGVQAQDEADYHCQSGFKDSS
Chrysemys picta bellii Vs1204 ighv AHGY01330903.1 433 ARAQVVLTQSSPEIKKPGESTKLTCAVSGFALSSTNMYWIRQAPGKGLEWLIYYYSSSDNSYSPAIQGRFTASKDSSNFYLHMTSLRAEDTAVYYCAR
Chrysemys picta bellii Vs1205 ighv AHGY01331091.1 419 AQSQMQLVEYGGAVRNEGESIRLSCKCTGFTFSSSDMFWYRQSPGESPEFVSRIYYDGTGINYAPRVQGRFTISRDNAKSELYLAMSRLRLEDTARYHCAAR
Chrysemys picta bellii Vs401 igkv AHGY01291147.1 1008 ASGQIVLTQTPESLAVFPGDRVTINCKASSSASSWMSWYQQKSGQAPKILIHSASTRPSGVPDRFSGSGSGTDFTFTISRVESDDAGDYYCLQTNSWP
Chrysemys picta bellii Vs1369 igkv AHGY01432858.1 1078 SSGQTVMTQSPESLAVPVGGRVSINCKASTSIGTCLNWYQQKPGQAPKLLIYRASSLQSGVPARFSGSGSGTDFSFTISSVEADDAGDYYCQQCGSYP
Chrysemys picta bellii Vs189 iglv AHGY01182585.1 7399 SLAQYVLTQPPSVSVSLGQKAQLTCSGNNIGGKYVQWYQQKPGSAPLLVIYNDSNRPSGIPDRFSGASSGNTATLTITGVQAQDEADYYCQVYDSSSDQ
Chrysemys picta bellii Vs1365 ighv AHGY01428841.1 2520 GINLLGRWSAGYCKLHRQYREWMSLRLSCKASGFTFSSYYVGWVRQAPGKGLEWLTWIHGSSIYYSDSIKGRFTVSRDDPNSLLYLQMTGLKPEDTARYHCAR
Chrysemys picta bellii Vs1364 ighv AHGY01428157.1 994 VLSQVQLVQTGPGAVKPSETLSITCKVSGVSVSSNYWGWVRQPPGKGLEWMGRMRSTADGGTTDYSSAFSSRITITRDTSKDEVYLQLRSLTATDTGTYYCAR
Chrysemys picta bellii Vs1367 ighv AHGY01432054.1 1199 VLSPVQLIPSGPGAVKPGETLALTCAVSGVSIIDGSYAWDWVQQPPGKGLEWVTRIYPPDGGKWFAASLQSRTIISSDTSKNQFSLQLASLAAADTATYYCAR
Chrysemys picta bellii Vs1360 ighv AHGY01426425.1 483 AFSQAQLVESGEGVKKPGDSLRLSCQASGFTFTLDQTGPWEGIGVDQGNTPNFNYHQLRTALQGTLHHLQNNPKMAYLQLSSLRPEDTALYYCSRI
Chrysemys picta bellii Vs1363 ighv AHGY01427804.1 510 VRSQVKLLQTGAAQVKPSQTLRLTCSVSGFSLTSSGYGVSWVRQPPGKGLEWLSIVYWDEDKYYQESLKNRLTISRDTSKSEVYLEMRGMEARDSGTYYCTR
Chrysemys picta bellii Vs1362 ighv AHGY01427397.1 3327 AWSQVVLTQSGPELKKPGESTRLKCAVSGFAVSGDYMAWVRQEPGKGLEWLVSYWKPGQSDYYSPTIKGRFTASKDSSNFYLQMNSLKAEDTAVYYCAR
Chrysemys picta bellii Vs373 ighv AHGY01264817.1 268 AWSQSLVESGGDVKKPGDSLRLSCKASGFTFSTYGMSWVRQAPAKGLEWVAYIYSSSIHYSDSVKGRFTISRDNPNSLLYLQMNSLKPEDTARYYCTG
Chrysemys picta bellii Vs375 ighv AHGY01267924.1 643 GWTVEFVESGGDIRKPGDSLHLSCKTSGFKFSDYWMSWYRVSPGKGLEWVSSMEKSPTSDKYYTSSVKGRFTISRDNSKNTAYLQMNKLNPEDTAMYYCRD
Chrysemys picta bellii Vs183 iglv AHGY01182561.1 367 SLAQYVLTQPPSVSVSPGQNAQITCSGNNIGSKNVHWYQQKPGSAPLLVIYSDSSRPSGIPDRFTEANSGSTATLTITGVQAQDEADYYCQVRDSSSDQ
Chrysemys picta bellii Vs582 igkv AHGY01365013.1 6617 SNGQIVLTQTPESLAVSPGDTATIRCKASSSVTLGSLHLLGWYQQKSGQAPKLLIYRASTRPSGIPDRFSGSGSGTDFTLTISNIQAEDAGDYYCQQRYS
Chrysemys picta bellii Vs1137 trav AHGY01293756.1 581 GIYGADSVTQTDGSVIISRGEPVHLNCTYQFSASVTVAYPFWYVQSPNQPPKLFLRDLGREDSDEGIRKGFDATHDKKNKSFHLWKPSSELSDSGTYYCAAS
Chrysemys picta bellii Vs1097 igkv AHGY01283614.1 3276 SSGQIVMTQSPESLAVPVGGRVSINCKASTSIGSCIHWYQQKPGQAPKLLIYGASNLQSGVPARFSGSGSGTDFTFTISSVEAEDAGDYYCQQCSSYP
Chrysemys picta bellii Vs1096 igkv AHGY01283610.1 3150 SYGQIVLTQTPESLAVSPGERVTINCKASTSISNYLGWYQQKPGQAPKLLISDSTNRVSGIPDRFSGSGSGTDFALTISSIEAEDAGDYYCHQRLSYP
Chrysemys picta bellii Vs1095 igkv AHGY01283607.1 739 ASGQIVLTQTPESLLVSAGDRVTINCKASTSISSNIAWYQQKSGQAPKLLFYGTSSRPSGVPDRFSGSGSGTDFTFTISRVEADDAGDYYCQQYY
Chrysemys picta bellii Vs1093 ighv AHGY01282705.1 1794 VWSQVLMESGGDVKKPGDSLRLSCKASGFTFSSYYMSWVRQAPGKGLEWVAIIYPGGSSTDYLDSVKGRFTISRDDSKSELYLQMTGLKPEDTARYYCAG
Chrysemys picta bellii Vs1092 ighv AHGY01282702.1 512 VRSQVKLLQTGAAQVKPSQTLRLTCSVSGFSLTSSGYGVSWVRQPPGKGLEWLSIVYWDEDKYYQESLKNRLTISRDTSKSEVYLEMRGMEAGDSGTYYCTR
Chrysemys picta bellii Vs1091 ighv AHGY01282690.1 6496 VRSQALVESGGDVKKPGDSLRLSCKASGFTFSSYHMHWVRQAPGKGLEWVAYIRYDGSSTDYLDSVKGRFTISRDDSKSELYLQMTGLKPEDTARYYCAG
Chrysemys picta bellii Vs1090 ighv AHGY01282689.1 2233 ARSQVVLTQSGPALKKPGESHKLQCATSGFTLSSTWMGWIRQEPGKGLEWLTLYYSEGGKYYASSVQGRFTASKDSTNFYLQMTSLRAEDTAVYYCAK
Chrysemys picta bellii Vs1099 igkv AHGY01283618.1 881 SSGQIVLTQTPESLSVSPGDRVTINCKASSSASTGMAWYQQKSGQAPKLLIHSASTRPSGIPDRFSGSGSGTDFTFTISRVEADDAGDYYCQQYNSWP
Chrysemys picta bellii Vs1098 igkv AHGY01283614.1 586 SSGQTVMTQTPESLAVSPGDRVTINCKASTSISGAIGWYQQKSGQAPKLLIYGPSTRPSGIPDRFSGSGSGTDYTFTISRVEADDAGDYYCMQAASFP
Chrysemys picta bellii Vs482 iglv AHGY01328943.1 267 SLAQYVLTQPPSVSVSPGQNAKLTCSGNNIGSNIVHWYQQKPGSAPVLVIYSDSNRPSGIPDRFSGANSGNTATLTITGVQAQDEADYYCQVYDSNA
Chrysemys picta bellii Vs483 iglv AHGY01328953.1 25 SSSQTVVTQPPSVSVSPGNTVKLSCALSSGTSIGDYYVSWYQQKSGNSPRYLLYYYTDSSKGQGSGVPARFSGSKDTSSNAGYLTISGALAEDEADYYCSVIKS
Chrysemys picta bellii Vs480 iglv AHGY01328927.1 17 SLSQFTLTQPPSVSVSIGNTVKLSCALSSGSTFGDVMWYQKKDGNSPRYLLRYNKESDKYQGSGVPSRFAGSKDASNTTGYLTVTGVQAEDEADYYCTVWSGSA
Chrysemys picta bellii Vs481 iglv AHGY01328935.1 1395 SSSQSVVTQPPSVSVSPGNTVKLSCTMSSGTSISGYNVYWYQQKPGNSPRYLLRYKSDSDKHQGSGVPARFSGSKDTSSNAGYLTISGALAEDEADYYCAV
Chrysemys picta bellii Vs1222 trav AHGY01345840.1 6274 ASGQLSVEQSPEWRGVSEGQNGTVTCTYSSAIQSLHWYRQAPGERPLFLLMLFGKGSETQEPNFTADHDPGQKRSSLHIRGCRLGDTARYLCAVE
Chrysemys picta bellii Vs487 trav AHGY01334048.1 849 SSMEDAVTQTQPAVSGVERESVSLDCTYETAASSYYLYWYKQPPGESLNFLFRQYSGGTKRNEAGERFSVNLEKSKSSVSLRITALEFGDAAMYFCAFSR
Chrysemys picta bellii Vs484 iglv AHGY01328955.1 518 SSSQSVVTQPPSVSVSPGNTVKLSCTMSSGTSISDYHVRWFQQKPGNSPRYLLRYKSDSDKHQGSGVPARFSGSKDTSSNTCYLTISDTLAEDEADYYCVV
Chrysemys picta bellii Vs837 trgv AHGY01035777.1 28770 QLTQDQLSITRNLMKTVRIDCKVSGINVGDAYIHWYRQRPGEAPEWILYSKSHAQNEQSNFDKDKFSVDKTTEKSTCTPRVDKLTYNDMATYYCAYWD
Chrysemys picta bellii Vs488 trav AHGY01334049.1 278 SCCEAQVVQSPEWLVTGEGKVSTMSCSFTSTYRTFYWYQQLPGQGPTHLLTASSNENVTVGQFIGERLENGKRSSLHITDSQLGDSGSYLCAVD
Chrysemys picta bellii Vs489 trav AHGY01334052.1 280 SCCEAQVVQSPEWLVTGEGKVSTMSCSFTSAFQTFQWYQQLPGQGPTHLLTASSNENVTLGRFIGERLESGKRSSLHITDSQLGDSGSYLCAVR
Chrysemys picta bellii Vs710 ighv AHGY01442847.1 2104 ALSQLQLVASGPGVGKVSEPLTLTCAVSGFSINTQYYYCYWLRQPPGEGLESMGWVYPYTGGTRYAPSLQGRVTISADTAKNQFSLQLRSLTATDTATYYCAWR
Chrysemys picta bellii Vs711 ighv AHGY01443449.1 1169 VLSQVQLVQTGPGTVKPGETLSITCKVSGVSVSDYYWSWVRQPPGKGLEWMGRIQSTADGGNTAYNSAFSSRITITRDTSKDEVYLQLRSLTAADTSTYYCAR
Chrysemys picta bellii Vs716 ighv AHGY01451023.1 337 VISQVQLVQTGLGTVKAGETLSITCKVSGVSVSNYYWSWVRQPPGKELEWMGFIRHTVNGGTTEYNSAFTPRVTITRDTSKDEVYLQLRSLTTADTGTYYCG
Chrysemys picta bellii Vs714 iglv AHGY01448019.1 635 SSYQFTLTQPLSMSVTPGETGKLACVLSSGDSISSRYIYWYQQKQGEKPRYLLYYKDDSTQGKGSGVPDRFTASKDTSRNTCFLTISRAEAEDDADYYCTGWD
Chrysemys picta bellii Vs718 igkv AHGY01451843.1 713 STGQKVLTQTPESLSVSPRDTVTIKCRASESVSSYLAWYQQKSGQAPKLLIYGATTRPSGIPDRFTGSGSGTYFTLTISRVEAEDAGDYYCQQGYIP
Chrysemys picta bellii Vs1330 trav AHGY01402854.1 1068 GSCQAEVQQNLSAVTWEGQSGSISCHYTTRNFGSLQWFRELPGGQPVSLLILVSDGKQTKEPNLTAELDKGKRLSSLHIRESQLGDAATYFCAVA
Chrysemys picta bellii Vs659 ighv AHGY01401414.1 2309 VRSQVLVESGGDVKKPGDSLHLSCKASGFPFSSYQMHWVRQAPGKGLEWVAYINPGGGSTYYLNSVKGRFTISRDDSKSELYLQMTGLKPEDTARYYCAR
Chrysemys picta bellii Vs1331 iglv AHGY01403678.1 403 CLAQYVVTQPPSMSVSPGQNAKLTCSGNNIGSNIVHWYQQKPGSAPVLIIYDDSSRPSGIPDRFSGANSGNTATLTITGVQAQDEADYYCLVYDSSSDQ
Chrysemys picta bellii Vs653 trav AHGY01398663.1 434 SCYEAQVDQSPEWLITGEGEVSTMSCSFTSTYRTFQWYQQLPGQGPTHLLTVTSNENVTLGRFIGERLESGKRSSLHITDSQLGDSGSYLCAVD
Chrysemys picta bellii Vs652 ighv AHGY01398631.1 902 VLCQVKLVQSGPGAVKPGETLTLSCAVSGVSITTQHYYWSWIRQFPGKGLEWMGYVYPYSSGSTSYAPSLQGRITISADTAKSQFSLQLRSLTAADTATYYCAG
Chrysemys picta bellii Vs651 ighv AHGY01398536.1 4523 VRSQVLVESGGDVKKPGDSLRLSCKASGFTFSSAYMHWVRQAPGKGPEWVAYINRGGDTILYLDSVKGRFTISRDNSKSELYLQMTGLKPEDTARYYCAR
Chrysemys picta bellii Vs650 ighv AHGY01398417.1 68 DPVRSREGETRRRSQTDLCRVRLLQSQRSLLELDLVPSRMRLEWMGGIRFNGEVVYAPSVRDRATISRDISKSEFYMPLSSLIPTDTATYYCVRE
Chrysemys picta bellii Vs657 iglv AHGY01399935.1 530 SLAQYVLTQPPSVSVSPGQNAQLTCTGEKVDKWYVSWYQQKPGHAPVLVIYKDSERPSGIPERFSGASSGKTATLTITGVQAQDEADYYCHHNFKDSS
Chrysemys picta bellii Vs656 ighv AHGY01399780.1 2740 PILGFTMTQSGLGEVTVSGSLSLTCAVSDSALSTGGDWWHWLRQPPGKGLVWLALIDRYGNTRYLPDIQNRTTITVDPSKDEFYLRVDSLSPQDTATYYCAR
Chrysemys picta bellii Vs654 ighv AHGY01399778.1 64 VRSQVKLLQTGAAQVKPSQTLRLTCSVSGFSLTSSGNAVSWIRQPPGKGLEWLCLVFWDDDKRYHESLKNRLTISRDTSKSEVYLEMRGMEAGDSGTYYCAAE
Chrysemys picta bellii Vs622 trav AHGY01384926.1 2940 APGRAEIRQPRSAEALEGAELNLTCSHPSASDDNILWYRQFPNRGPEFIVTGFSGTAHSPDPEGTLHISKDKENSTFALRRVLLADSAVYYCARR
Chrysemys picta bellii Vs429 ighv AHGY01296947.1 4198 VRSQIQLVPSAPGVVKPGESLTVTCTVSGDSIATHAWWNWVRELPGRGLQWVGRIHFSGSTNYAPDLQTRANIAKDDAKNEFYLQLRSLTAADTATYYCTRWD
Chrysemys picta bellii Vs1231 ighv AHGY01347553.1 10728 ARPQVQLVESGGDVKKPGDSLRLSCKASGFPFSSYLMDWIRLAPGKGLEWLARAAAQGSTYYADSVQGRFTISRDNANSLVHLQISSLREEDTALYYCVR
Chrysemys picta bellii Vs1145 iglv AHGY01305029.1 1312 SLAQYVLTQPPSVSVSLGQKAQLTCSGNNIGDKSVQWYQQKPGSAPVLVIYHDSNRPSGIPDRFSGANSGNTATLTITGVQAQDEADYYCQVYDSSSDQ
Chrysemys picta bellii Vs1147 ighv AHGY01306700.1 664 VLCQVQLVQSGPGAVKPGETLTLTCAVSGFSITSSGYGWNWVRLPPGEGLQWLGYIGASGGTGYTPSLHCRLSFSRDTAKNALSLQLRSLTATDTATYYCTR
Chrysemys picta bellii Vs1069 igkv AHGY01274678.1 616 SNGQIVMTQTPESLAVSPGDTVTIRCKASSSLTSGSYHYLAWYQQKSGQAPKLLIYLASTLQSGVPARFSGSGSGTDYTLTISKVEAEDAGDYYCQQSRS
Chrysemys picta bellii Vs1140 iglv AHGY01295898.1 1150 CYAQVTQPPSEFVSPGGNVQLSCTLEGSYTVSANRVIWIQQRPGSVPRYLMYFYTESNKGMGSGVPSRFAGSRSGSDKIGYLTITGAQAEDDAVYYCVTWTGSA
Chrysemys picta bellii Vs430 ighv AHGY01296948.1 1594 VISQVQLVQSGPGAVKPGETLALTCTVSGVSITSSSYTWNWVRQPPGKGLEWVARIYPHDGGKWFAASLQSRTTISSDTSKNQFSLQLASLTAADTAMYYCARE
Chrysemys picta bellii Vs1063 iglv AHGY01267931.1 356 TSSQYVVTQEPSLLVSPEGTVKLSCSVSIVSDITSIYPYWFQQRGGGVPRLLIYNANVKVSGTPERFSGSSSGNTAYLTIKGALAEDEADYYCL
Chrysemys picta bellii Vs1149 ighv AHGY01311983.1 5568 ARPQVQLVESGGDVKKPGDSLRLSCKASGFPFSSYLMDWIRLAPGRGLEWLARAAAQGSTYYADSVQGRFTISRDNANSLVHLQISSLRVEDTALYYCVR
Chrysemys picta bellii Vs439 ighv AHGY01305384.1 1004 ARSQVQLVESGGDVKKPGDSLRLSCKASGFTFSSYDMNWVRQAPGKGLEWVAYISSSGGTIYYLDSVKGRFTISRDNSKSELYLQMTGLKPVDTARYYCAR
Chrysemys picta bellii Vs438 ighv AHGY01305375.1 1678 VLCQVQLVQSGPGAAKPGETLTLSCAVSGVSITTQFYYWSWIRQLPGKGLEWMGYVYPYSSGSTSYAPSLQGRITISADTAKSQVSLQLRSLTAADTATYYCAG
Chrysemys picta bellii Vs349 trdv AHGY01258146.1 10893 APRWALAQVFQLPQITRVEGERILIPCSQNATSHDMMSWYKQPQQGRGAPSFLGTGHDGSSTAGEFTMAVHKASRSTNLTQDGASLSDAGIYYCAVR
Chrysemys picta bellii Vs348 trdv AHGY01258135.1 925 APRWALAQVFQLPQITRVEGERILIPCSQNATSHDMMSWYKQPQQGRGAPSFLGTGHDGSSTAGEFTMAVHKASRSTNLTRDGASLSDAGIYYCAVR
Chrysemys picta bellii Vs54 trgv AHGY01036516.1 1032 ALWAIHLEQEQISVTKQPLQGSSATFTCKVFDGSDSTYIHWYRARAGEAPHRLLYLTLSGSELKREAGFSGDKFLAYARQSTCSLVVYKLEETDSGCYYCATWDF
Chrysemys picta bellii Vs55 trgv AHGY01036517.1 3543 LWAIYLEQVPISITKEPHVGSTAVFTCKVSGMSESTYIHWYRAPTRGAPQRLLYLSYSKPDPSWDAGFSSKKLTAHFQDRDICKLLVYKLEKADSGHYYCAAWDY
Chrysemys picta bellii Vs52 trgv AHGY01036493.1 3078 GCAQIHLRQAQLSITRAENKTARIVCEASGIQNFGSAVIHWYRHRPGEAPERILYISPEKLKFDKDSDENKFNCEKKPDQPISTLTVNEIAPNDGATYYCAYWD
Chrysemys picta bellii Vs53 trgv AHGY01036496.1 1939 ALWAIHLEQEQISVTKQPLQGSSAKFTCKVFDGSDSTYIHWYRARAGEAPQRVLYLTLSGSDLKREAAFPLEKFSAYGTKSISNLLVHKLEKTDSGRYYCATWDF
Chrysemys picta bellii Vs50 trgv AHGY01036472.1 866 GCAQIHLRQTQLSITRANDKTARIDCEASGIQNFESAVIHWYRHRPGEALEWILYFKTQADKSSFDKKFSVDKTIEKSTCILRVIKLSYNDMATYYCAYW
Chrysemys picta bellii Vs583 igkv AHGY01365014.1 2282 ASGQIVMTQTPESLAVFPGDRVTINCKASSSVGSYMTWYQQKSGQAPKLLIHSASTRPSGIPDRFSGSGSGTDFTFTISRVEADDAGDYYCLQGYSLP
Chrysemys picta bellii Vs341 ighv AHGY01255604.1 5324 VKAQIQLVQSGAEVKKLGESVKMSCKGSGYTFTSYAISWVRQAPGKGLVYIGWTNTNTGEPTYADSFKGKVTMTLDTSLSTAFLQVNSLKAEDTAVYYCAR
Chrysemys picta bellii Vs342 ighv AHGY01255622.1 365 VQAQVRFVESGGDVRKPGDSLQLSCRGSGFSFGDHWLSWLRLSPSKGLEWVATISFWAGDTKRYAASVTGRFSISRSNGQNMLYLQMNNLKPEDTGIYFCSQ
Chrysemys picta bellii Vs347 trav AHGY01258134.1 2068 VMAQTTVHQLEGPVTAKEGDAFQINCTYQTANFYGLAWYQQWEGKAPGLVSYQVAAGQEEYGRFTAFLSTAGKYSLLHLKETWVSDAASYLCAVR
Chrysemys picta bellii Vs1320 ighv AHGY01397875.1 3245 AADPDRPGAVKAGETLSITCKVSGVSVSSYYWSWVRQPPGKGLEWMGIIRHTVNGGSTEYNSAFTPHVTITRDTSKDEVYLQLGSRTAADTSTYYCA
Chrysemys picta bellii Vs1325 iglv AHGY01402137.1 1674 SLSQYTLTQPPSVSMSIGNTVKLSCAIDSGYTFGDVAWYQQKDGKSPRYLLRYNKETNKQQGSGVPSRFAGSKDASNTTCYLTITSVQAEDEADYYCGTGGGGA
Chrysemys picta bellii Vs1324 iglv AHGY01402135.1 1921 SNSQPTLTQPSSASVSPGNTVKLSCTVSSSMNTIAWIQQKPGQAPRFVLYGTTNRGDGIPDRFTGSTSGNVGYLTITNAQAEDDADYYCSMWYSSGSV
Chrysemys picta bellii Vs1327 igkv AHGY01402771.1 5321 SSGQIVLTQTPESLAVSPGDRVTINCKASSSVGSWMAWYQQKSGQAPKLLIHQASTRPSGIPDRFSGSGSGTDFTFTISRFEADDAGDYYCQQYSS
Chrysemys picta bellii Vs1326 ighv AHGY01402228.1 2902 QLKETGPGAVKPGGSLTLTCTISGDSVSSTSVTWDWIRQPVGKGLEWVGRIYYRPSQWYTNYASSLQSRTTIAQDTSKNQFSLQLRSLTAADTAMYYCARE
Chrysemys picta bellii Vs1329 trav AHGY01402849.1 1449 GIYGADSVTQTDGSVIISRGEPVHLNCTYQFSASVTVAYPFWYVQSPNQPPKLFLRDLGREDSDEGIIKGFDATHDKKNKSFHLWKPSSELSDSATYYCAAS
Chrysemys picta bellii Vs1328 igkv AHGY01402771.1 599 SSGQTVMTQTPESLSVSVGETATIKCKASASISNYIAWYQQKPGQAPKLLIYYASSRPTGIPDRFSGSGSGTDYTFTVSRVEADDAGDYYCLQGASFP
Chrysemys picta bellii Vs502 trav AHGY01338750.1 655 ASGQLSVEQSPEWRGVSEGQNVTVTCTYSSAIQSLHWYRQAPGERPLFLLMLHGKGSETQEPNFTADHDPGQKRSSLHIRGCRLGDTARYLCAVE
Chrysemys picta bellii Vs500 iglv AHGY01337724.1 19 ASSQPVLTQPSSESVSPGQTAKLSCAMSSGYSLSSYNLYWYQQRSGQAPRFVLSGTSSRGDGIPDRFTGSSSGNVGYLTITNIQAEDEADYYCAIWHGSGGV
Chrysemys picta bellii Vs507 ighv AHGY01341191.1 777 VRSQVQLVESGGDVKKPGDSLRLSCKASGFTFSSNYMSWVRQAPGKGLEWVAYIAGSGGDIQYLDSVKGRFTISRDNSKSELYLQMTGLKPEDTARYYCAK
Chrysemys picta bellii Vs506 ighv AHGY01339569.1 5949 ALSQVQLVESGGDVKRPGDSLRLSCKASGFTLSSNWMHWVRQAPGKGLEWIARIHGSSINYSDSVKGRFTISRDDSKSELYLQMTGLKPEDTARYHCAK
Chrysemys picta bellii Vs505 ighv AHGY01339569.1 1357 ARSQIVLTQSGPEMKKPGESTQLKCAVSGFTVSGYYMAWFRQEPGKELEWLVSYYTPSSTNYYSDSIKGRFTASKDSSNFYLQMTSLKAEDTAMYYCAR
Chrysemys picta bellii Vs504 ighv AHGY01339565.1 5954 CGAAVTLTQPSSAQAEPGSSLSLDCVVSGYNINDHHLSWIRQAPGKGPVWLAAFRTGYTTYITDEFKGRVTPRTSGATARLNINSLTAADTATYYCARN
Chrysemys picta bellii Vs509 ighv AHGY01341947.1 7 VRSQIQLVESGGDVKKPGDSLRLSCKASGFTFSNHWITWFRQAPGKGLQWVSEISKDGSSTNYADSVKGRFTISRDNSNSLAYLQMTGLRAEDTARYYCARDTV
Chrysemys picta bellii Vs564 igkv AHGY01364944.1 449 SSGQILLTQTPESLAVSLGDRVTINCKASTSIVSAIAWYQQKTGQAPKLLIYNASTRPSGIPDRFSGSGSGTDFTFTISRVEAEDAGDYYCQQGFPP
Chrysemys picta bellii Vs1499 ighv AHGY01550357.1 882 VQSEVQLVQSGAEIKKPGESVKISCKTSGFTLTDYYMSWIRQTPGKGLVWLGRIDPEDGDTSYDDSVKNSVTISTDNSISTVYLQLRSLRTEDTAVYYCAR
Chrysemys picta bellii Vs1498 ighv AHGY01550357.1 4963 VQSEVQLVQSGAEIKKPGESVKLSCKTSGFTFTSVFMHWIRQAPGKGLDWVGRIDPADSETKYSESFKGRFTITTDNSISTAYLQLRSLRLEDTAVYYCAR
Chrysemys picta bellii Vs1493 ighv AHGY01550346.1 1565 VRSQVLVESGGDVKKPGDSLRLSCKASGFTFSSYYMSWVRQAPGKGLEWVSGIYTDGSQQFYADSVKGRFTISRDNSNNLLYLQMTGLKPEDTARYYCA
Chrysemys picta bellii Vs1492 ighv AHGY01550341.1 2335 ASSQIQLTQSGAQIKKPGESEKLTCKTAGYTFTSYYIQWLRHVPGKGLQWIGLISPNNGGTHYAQAFQGRFTITRDTSISTAYLQLGSLRTDDTATYYCAR
Chrysemys picta bellii Vs1491 ighv AHGY01550338.1 9957 VSSQIQLTQSGAEIKKPGESVKVTCKTSGYTFTSYDISWVRQAPGKALEWIGYINPSTGSTGYAQAFQGRFTITRDTSISTAYLQLGSQRTDDTATYYCAR
Chrysemys picta bellii Vs1490 ighv AHGY01550336.1 3158 VSSQIQLTQSGAEIKKPGESVKVTCKTSGYTFTSYYIHWVRQAPGKGLEWVGYIDPSDGETGYAQAFQGRFTITRDTSISTAYLQLGSLRTDDTATYYCAR
Chrysemys picta bellii Vs1497 ighv AHGY01550357.1 7115 VQSEVQLVQSGAEIKKPGESVKISCKTSGFTLTDYYMSWIRQTPGKGLVWLGRIDPEDGATIYDDSVKNSVTISTDNSISTVYLQLHSLRTEDTAVYYCAR
Chrysemys picta bellii Vs1496 ighv AHGY01550349.1 874 AFSQAQLVESGGGVKKPGDSLPLSCQASGFTFTDYWMQWIRQAPGKGLEWIGEIHPTSTTINYAQPFKGRFTISRDNPNNLLYLQMTGLKPEDTARYYCSRI
Chrysemys picta bellii Vs1495 ighv AHGY01550349.1 2740 VRSQALVESGGDVKKPGDSLRLSCKASGFPFSSAYMNWVRQAPGKGLEWVSSINYDGSQQFYADSVKGRFTISRDNSNNLLYLQMTGLKPENIARYHCAG
Chrysemys picta bellii Vs1494 ighv AHGY01550349.1 11393 ARSQVVLTQSGPALKKPGESHKLQCATSGFTLSSTWMSWVRQEPGKGLEWLVSYYDPSNKHYASSVQGRFTASKDSTNFYLQMTSLRAEDTAVYYCAR
Chrysemys picta bellii Vs1394 ighv AHGY01452947.1 835 VWSQIQLVETGGGIETSGGSLRLSCKASGFTFRNYCVNWVRQAPGKGLEWVSEIHNPAHNSAAYYSDAVKGRFTSSRDESRSSVYLQMNSLRAEDTARYYCVRR
Chrysemys picta bellii Vs1259 iglv AHGY01358331.1 514 SLAQYVLTQPPSVSVSPGQNAQLTCSGNNIGSKYVHWYQQKPGSAPLLVIYENSNRPSGIPDRFSGANSGNTATLTITGVQAQDEADYYCKVWDSSSDQ
Chrysemys picta bellii Vs1391 iglv AHGY01450742.1 1143 SLSQFTLTQPPSVSVSIGNTVKLSCALSSGYTFGSVRWYQQKDGNSPRYLLRYNKESDKHQGSGVPSRFAGSKDASNTTGYLTITSVQAEDEADYYCTAWSGSA
Chrysemys picta bellii Vs1392 igkv AHGY01451668.1 2054 GTLLTQTPESVAVSPGDTIIINCKASSSMMGLLTWYQQKPGQAPKVLLYNASTLLPGVPAQFHGSQAGSSVTDYSLLVSTVQTEDEGDYYCQPFYGTP
Chrysemys picta bellii Vs1393 trav AHGY01452555.1 577 AVLGESIQSNKPEVSAGEGDNVTLSCSYNTSYSDVSLYWYRQFPGQGPQYVLRTGAKAYSSVRDFAEFARKRFTPQADDRSTALSITLALADTAVYYCALQR
Chrysemys picta bellii Vs1254 ighv AHGY01354018.1 362 VRSQVQLVESGGDVKKPGDSLRLSCKASGFTFSSNYMSWVRQAPGKGLEWVAYIAGSGGDIQYLDSVKGRFTISRDNSKSELYLQMTSLRSEDTARYYCAK
Chrysemys picta bellii Vs1251 ighv AHGY01353477.1 5038 ARSQVVLTQSGPEMKKPGESTQLKCAVSGFTVSDYYMAWVRQEPGKELEWLVSYYTPSSTNYYSDSIKGRFTASKDSSNFYLQMTSLKAEDTAVYYCAR
Chrysemys picta bellii Vs1250 ighv AHGY01353477.1 10445 VRSQVLVESGGDVKKPGDSLRLSCKASGFTFSSYWMYWVRQAPGKGLEWVTAINTGGSSTYYLDSVKGRFTISRDNSKSELYLQMTGLKPEDTAHYYCAR
Chrysemys picta bellii Vs1252 ighv AHGY01353477.1 3527 VYSQVSLVESGGGIKKPGETLTLTCTVSRFCLTSDGVHWARQPALKGLEWMGGIWAGGGNNYNDALKSRLPITRDTSKSQVSLQAGDTVVYYCARD
Chrysemys picta bellii Vs566 igkv AHGY01364951.1 3133 SSGQIVMTQSPESLAVPVGGRVSINCKASTSISDYLHWYQQKPGQAPKILITYTSILQSGVPARFSGSGSGTDFTFTISSVEAEDAGVYYCQQGNSFP
Chrysemys picta bellii Vs1192 iglv AHGY01325053.1 1917 SNSQPTLTQPSSASVSPGNTVKLSCTVSSSMNTIAWIQQKPGQAPRFVLSGTTNRGDGIPDRFTGSTSGNVGYLTITNAQAEDDADYYCSMWYSSGSI
Chrysemys picta bellii Vs1191 iglv AHGY01325045.1 1570 VSSQPVVTQEPSVSVTPGGAVTLSCSLSSGAITSSNAPGWFQQKPGSAPRTLIYSTNSRPSGIPARFSGSISGNNAALTITGVQAEDEADYYCIVWASSV
Chrysemys picta bellii Vs1196 iglv AHGY01325073.1 2649 SLSQFTLTQPPSVSVSIGNTVKLSCTISSGYTFGPVFWYQQKDGNSPRFLLRYNTDSDKHQGSGVPSRFSGSKDASKTTGYLTVTGVQAEDEADYYCAAGVSGA
Chrysemys picta bellii Vs1197 trav AHGY01325862.1 485 LTQGQTVIQPVGETKVKEGEFVTLDCSYNSGFPTLLWYRQESGGSPQFILHEGSRQEDLEERFRNRFKAKINKTSRVFPLDISSVQLSDSATYYCALR
Chrysemys picta bellii Vs1194 iglv AHGY01325072.1 3384 SLSQYTLTQPPAESVSIGNTVKLSCALSSGYTFGSVVWYQQKNGNIPRYLLRYKTDSDKHQGSGIPSRFAGSKDASNTIGYLTITSVQAEDEADYYCATGT
Chrysemys picta bellii Vs1195 iglv AHGY01325072.1 591 VSSQPVVTQEPSMSVTPGGAITLSCSLSPGAITTGSYPAWFQQKPGSAPRTLIYSTNSRPSGIPARFSGSISGNNAALTITGVQAEDEADYYCILWTGRV
Chrysemys picta bellii Vs617 igkv AHGY01379272.1 378 SSGQIVMTQSPESLAVPVGGRVSINCKASTSVGSSVQWYQQKPGQAPKLLIYLATNLQSGVPARFSGSGSGTDFTFTISNVEAEDAGDYYCQQSSSYP
Chrysemys picta bellii Vs616 igkv AHGY01379270.1 229 SSGQIVLTQTPESLSVSPGERVTINCKAGTSISNYLGWYQQKPGQAPKLLISDSTNRVSGIPDRFSGSGSGTDFTLTISSVEAEDAGDYYCQQRQSYP
Chrysemys picta bellii Vs615 igkv AHGY01379264.1 416 SSGQIVMTQTPESLSVSVGETATIKCKASTSISNEIAWYQQKPGQAPKLLIYYASSRPTGIPDRFSGSGSGTDFTFTISRVESDDAGDYYCQQHY
Chrysemys picta bellii Vs614 igkv AHGY01379263.1 434 SSGQIVMTQSPESLAVPVGGRVSINCKASTSVGNRVHWYQQKPGQAPKLLIYLATNLQSGVPARFSGSGSGTDFTFTISSVEAEDAGDYYCQQGYNIP
Chrysemys picta bellii Vs613 trav AHGY01377800.1 161 GEVDTKVSQPAALSFLAGGGADLPCNHSVAGYDKIIWYYQSPGSAPRAVISGYNSAETSGRFELSIDSPSRSAPLRITRVAVQDSGVYYCAVR
Chrysemys picta bellii Vs611 ighv AHGY01376732.1 343 WVAAITLTQPSSAQAEAGNSITLDCTVSGYNVNDRHMQWLRLPRGKNLVRIASFRPGYTIYIADEFKGRVTPSTSGSTGKLKIDGLTAADTATYYCATD
Chrysemys picta bellii Vs610 ighv AHGY01376620.1 4316 VLSQVQLVQSGPGAAKPGETLTLTCAVSGVSISAQNSVWHWNRQPPRKGMEWMGYVYPYNGVTGYASSLQGRATISGDTSKNQVSLQLRSLTAADTATYYCTRE
Chrysemys picta bellii Vs499 iglv AHGY01337719.1 2314 ASSQPTLTQLPSESVSPGNTVKLSCTLSSQHSGYVISWYQQRDGQVPQFLWYNASTKGDGVPDRFTVSSSAAVRYLTITKVQPEDEATYYCGV
Chrysemys picta bellii Vs491 trav AHGY01334059.1 314 APGSAEIRQPPSAEALGGAELNLTCSHGSLTTETIFWYRQFPSRGPQYIVSGYQGIFNSIDPEGALHIPEDRKSSTLSLRRVRLADAAVYYCALS
Chrysemys picta bellii Vs358 trav AHGY01258204.1 1356 GVNGESVTQPDDRVTVSQGEPVLVKCTYDTSYGTPTLWWYEQHPNEAPRLLLTQYEASDEEARRSRRGFSATPDNQGKTFHLKKSSSELRDSAVYYCSMS
Chrysemys picta bellii Vs51 trgv AHGY01036477.1 362 GEAQVLVQSQLSITRAENKTARIDCHVSGITLSSAYIHWYRRRPDAALERILYFLSGKPDFDRDSEKAKFEAEKQLSESICVLTVKKISKNDAATYYCAAW
Chrysemys picta bellii Vs1421 trav AHGY01494120.1 563 SVTQPKGTVPIQEGKHVVLHCTYDYSGSTPILFWYEQYPHEAPRLLLTQYEASDEEEKRRRRGFSAKLEKDSKSFHLEKNSSEVSDSAVYYCAMRDTASK
Chrysemys picta bellii Vs490 trav AHGY01334056.1 1498 SIYGADSVTQTQGSVTISQGEPVRLNCTYQFSVTPYPLWYVQFPSQALTLFLRDVGRDESDEGIRKGFDATHDKKHKSFHLWKPSSDMSDSGTYYCAAS
Chrysemys picta bellii Vs1109 igkv AHGY01283648.1 2610 SSGDTVMTQSPASLSVSAGESVSISCKASSGITNDIAWYQQKSGKAPKLLIYEASSRDTGIPTRFSGSGSGTDFTFTISSVEVDDAGDYYCQQYNSWP
Chrysemys picta bellii Vs569 igkv AHGY01364961.1 1537 SSGQIVMTQTPESLSVSVGETATIKCKASTSINSYIAWYQQKPGQAPKLLIYYASSRPTGIPDRFSGSGSGTDFTFTISRVEADDAGDYYCLQYNNFP
Chrysemys picta bellii Vs568 igkv AHGY01364959.1 93 TSGQTVMTQSPESLAVPVGGRVSINCKASTSVGSRVHWYQQKPGQTPKLLIYGASNLQSGVPARFSGSGSGTDFTFTISNIEAEDAGDYYCQQGNSFP
Chrysemys picta bellii Vs1101 igkv AHGY01283626.1 1044 SSGQIVMTQTPESLAVSPGDRVTINCKASSSTGNHLTWYQQKSGQAPKLLIYHGSTLASGVPARFSGSQSGSGYTDYTLTISSAEIEDAGDYYCQQGYSSP
Chrysemys picta bellii Vs1100 igkv AHGY01283622.1 2051 GTLLTQTPESVAVSPGDTIIINCKASSSMMGLLTWYQQNPGQAPKVLLYSASTLLPGVPAQFHGSQAGSSVTDYSLSGSTIQTEDEGDYYCQPFYGPPF
Chrysemys picta bellii Vs1103 igkv AHGY01283631.1 4068 SYGQTVLTQTPESLSVSPGERVTINCKVSTSINNYLDWHQQKSGQSPKLLISDSTNNYSGIPARFSGSGSGADFTLTISRVEVQDAGDYYCQQCNSYP
Chrysemys picta bellii Vs1102 igkv AHGY01283629.1 1583 ASGDIVMTQTPESLAVSPGDRVTINCKASTSIGSDIAWYQQKSGQAPKLLFYGSSSRPSGIPDRFSGSGSGTDFTLTITSFQADDAGSYYCQQDYDWP
Chrysemys picta bellii Vs1105 igkv AHGY01283640.1 8896 SNGQIVLTQTPESLAVSPGDRVTINCKASSSAGGWMAWYQQKSGQAPKLLIHSASTRPSGIPDRFSGSGSGTDYTFTISRVEADDAGDYYCQHGANLP
Chrysemys picta bellii Vs444 ighv AHGY01306980.1 1615 VRSQVQLVESGGDVKKPGDSLRLSCKASGFTFSSYGMSWVRQAPGKGLEWVSHIYSDGSEQYYADSVKGRFTISRDNSNNLLYLQMSGLKPEDTARYHCAR
Chrysemys picta bellii Vs1107 igkv AHGY01283644.1 4441 SSGQSVMTQSPESLAVPVGGRVSINCKASTSISNYLNWYQQKPGQAPKLLIYRASSLQSGVPARFSGSGSGTDFTLTISSVEADDAGDYYCQKGNDVP
Chrysemys picta bellii Vs1106 igkv AHGY01283641.1 1291 SSGQIVMTQSPESLAVPVGGRVSINCKASTSICTCLNWYQQKPGQAPKLLIYYASSLQSGVPARFSGSGSGTDFTFTISSVEADDAGDYYCQQCGSYP
Chrysemys picta bellii Vs1475 ighv AHGY01550326.1 2723 VRSQALVESGGDVKKPGDSLRLSCKASGFTFSSYYMSWTRQAPGKGLEWIGEIHPTSTTINYAQSFKGRVTISRDNPNNLLYLQMTGLKPEDTARYYCA
Chrysemys picta bellii Vs1474 ighv AHGY01550326.1 4728 TVQLVESGGGIQTPGGSLRLACKASGFTFSSYHMNWVRQAPGKGLEWVAQILTPVNNLTAYYSDSVKGRFTISRDESSSSAYLQMNSLRAEDTAWYYCVR
Chrysemys picta bellii Vs1477 ighv AHGY01550329.1 3617 VSSQIQLTQSGAEIKKPGESVKVTCKTSGYTFTSYYIHWVRQAPGKGLEWIGYISAYSGGTSYAQAFQGRFTITRDTSISTAYLQLGSLRTDDTATYYCAR
Chrysemys picta bellii Vs445 ighv AHGY01306981.1 2424 VRSQALVESGGDVKKPGDSLRLSCKASGFTFSSYYMDWVRQAPGKGLEWVADINPSLGIVYLDSVKGRFTISRDNSKSELYLQMTGLKPEDTARYYCAAG
Chrysemys picta bellii Vs684 ighv AHGY01413184.1 3974 VRSQALVESGGDVKKPGDSLRLSCKASGFTFSSYGMSWVRQAPGKGLEWVAYISYDGSAIYYLDSVKGRFTISRDNSKSELYLQMTGLKPEDTARYYCA
Chrysemys picta bellii Vs1473 ighv AHGY01550324.1 2334 ARSQVVLTQSGTAVKKPRESHRLQCAVSGVSSMGNMHWIRQDPGKGLEGLIYYHSLSDNSYYPTNQGRFTASKDSSNFYLQMTSLKAEDTVVYYCAR
Chrysemys picta bellii Vs1472 ighv AHGY01550315.1 1556 VLSQVQLVQSGLGTVKPGETLTLTCAVSGVSITDSSYAWNWVRQPPGKGLEWMGYVYPYSSGSTSYAPSLQGRITISGDTAKNQFSLQLRSLTAADTATYYCARQ
Chrysemys picta bellii Vs1478 ighv AHGY01550330.1 9546 VQSQIQLVQSGAEIKKPGESVKLTCKASGYTFTDYSMSWVRQAPGKGLEWVARIRTDNFNTFYPETLKGRTTISVDTSISTTYLQMNSLKSEDTAVYYCAR
Chrysemys picta bellii Vs268 ighv AHGY01251513.1 4218 VRSQVQLVESGGDVKKPGDSLRLSCKASGFTFSSYYMSWVRQAPGKGLEWLAWIHGSSINYSDLVKGRFTISRDDSKSELYLQMTGLKSEDTARYYCAR
Chrysemys picta bellii Vs269 ighv AHGY01251513.1 12082 VLSEVVLTQSGPEVRKPGEATILKCAVTGADHSTSIMTWIRQAPGKGLEWLVYYYSQASIFYSPAIQGRFTASMDSSSLYLQMYSLKEEDTAVYYCVRLGV
Chrysemys picta bellii Vs92 ighv AHGY01071044.1 3446 VLSQVQLVQAGPGAVKPGETLTLTCAVSGYSIASSCCWSWIRQAPGKGLEWMGYVYPYNSGETSYAPSLQARITISADTTKNQVSLQLRLLTAADAAAYYCAR
Chrysemys picta bellii Vs263 ighv AHGY01248452.1 1558 VRSQVQLVESGGDVKKPGDSLRLSCKASGFTFSSSSMNWVRQAPGKGLEWIAYIKYDGSTINYLDSVKVRFTISRDDSKSELYLQMTGLKPEDTARYYCA
Chrysemys picta bellii Vs91 ighv AHGY01071044.1 429 VLSQVQLVQSGPGAVKPGETLTLTCAVSGVSITDSSYGWDWFRQPLGGRLEWVVGIYPHGGVTNYAPSLQSRTTVSAHTAKNQVSLQLRSLTAADTAAYYCA
Chrysemys picta bellii Vs266 ighv AHGY01251505.1 168 VYSQINLVESGGGLKKPGDTLRLTCTVSGFSLTSFEVHWVRQPVGKGLDWMGVIWTGGGTAYSNALKNRLTITKDNSKSQVFLQLTGLQRGDTSVYYCAR
Chrysemys picta bellii Vs267 ighv AHGY01251510.1 322 VLSEVQLVQSGPGSVKPGETLTLTCTVSGYSITSGDTWHWIQQPPGTGLEWLGRGYYSSSTWNTNYGSSFQSRITISPDSSKNQFSLQLRSLTAADTGTYYCAR
Chrysemys picta bellii Vs561 igkv AHGY01364917.1 433 SSGQIVLTQTPESLVVSPGDRVTINCKASSSVSYMAWYQQKSGQAPKLLIYNASNRPSGIPDRFSGSGSGKDFTFTISRVEADDAGDYYCQQYTS
Chrysemys picta bellii Vs560 igkv AHGY01364913.1 324 SYGQVTMTQSPESLSVSPGEKVTIRCTASSSLDRYAVSWYQQKPGQAPKLLIHQASLLASGVPARFSGSQSRTVYTLTISSIEADDAADYYCLQIQS
Chrysemys picta bellii Vs492 trav AHGY01334060.1 190 APGRAKIQQPVSAEALEGAELNLTCSHPSARDDNILWYRQFPNRGPEFIVTGFSGTAHSPDPEGTLHMSKDKENSTFALHRVRLADAAVYYCARS
Chrysemys picta bellii Vs563 igkv AHGY01364925.1 557 SYGQITMTQSPESLSVTPGEKVTIRCTASSSISSSYVSWYQQKPGQAPKLLIYQASTLASGIPARFSGSGSGTAYTLTISSVEADDAADYYCFQWDSSP
Chrysemys picta bellii Vs545 iglv AHGY01358585.1 931 FSSQQLQSLKASEFVSPGGTVTLSCSLSSGAIADNNHPLWVQQRLGNVPRLIMHSTSTRPSGIPERFTGSRSGNTMSLTIKGALAEDDADYYCCVWAGSA
Chrysemys picta bellii Vs562 igkv AHGY01364921.1 558 SYGQVTMTQSPEFLSVSPGEKVTIRCTASSSLDRDYVSWYQQKSGQAPKLLIYRASTLASGVPARFSGSGSGTDYTLSISSVEANDAADYYCFQRDSSP
Chrysemys picta bellii Vs768 ighv AHGY01506384.1 104 VLSQVQLIQSGPGAVKPRETLSITCKFSGVSISSYHWSWARQPAGKGLQWMGIIRSSAAGGTTEYNLVFKPCVTMTRDTLKDEVYLQLGSLTAADTGTYYCAR
Chrysemys picta bellii Vs541 iglv AHGY01357779.1 160 ASSQPTLTQPPADSVSLGNSVKLSCTLSSEHSSYNVGWYQQRDGQAPRFLWYGSSIKGDGVPDRFTVSSSGAIRYLTITNIQPEDEATYYCGTGD
Chrysemys picta bellii Vs540 iglv AHGY01357776.1 2299 VSSQPVVTQEPSMSVTPGGAVTLSCSLSTGAITSSNYPSWYQQKPGSAPQMLIYNTNSRPSGIPDRFSGSISGNNAALTITGVQAEDEADYYCAVWASSV
Chrysemys picta bellii Vs565 igkv AHGY01364948.1 1283 SSGQTVMTQSPESLAVPVEGKVSINCKASTSIGSKINWYQQKPGQAPKILIYAASNLQSGIPARFSGSGSGTDFTFTISSVEAEDAGDYYCQQDSNYP
Chrysemys picta bellii Vs549 igkv AHGY01364881.1 3306 SSGQIVMTQTPESLAVSVGETVTIKCKASTSISNNVAWYQQKSGQAPKLLIYYASNRPTGIPDRFSGSGSGTDFTFTISRVEADDAGDYYCQKHYSTP
Chrysemys picta bellii Vs548 igkv AHGY01364881.1 351 SSGQIVMTQSPESLAVPVGGRVSINCKASTSISNNLNWYQQKPGQAPKLLIYGASNLQSGVPARFSGSGSGTDYTFTISSVEAEDAGDYYCQQGYS
Chrysemys picta bellii Vs448 ighv AHGY01306984.1 1653 VWSQVQLVESGGDVKKPGDSLRLSCKASGFTFSSYAMNWVRQAPGKGLEWVAYIDTYGSPIYYPDSVKGRFTISRDDSKSEVYLQMTGLRSEDTARYYCAR
Chrysemys picta bellii Vs449 ighv AHGY01306986.1 4572 TLCASPANPQGDVKKPGDSLRLSCKASGFTFSSYNMNWVRQAPGKGLEWVSFIGSRGRNIYYSDAVKGRFTISRDNSNNLLYLQMTGLKPEDTARYHCAGE
Chrysemys picta bellii Vs461 iglv AHGY01312119.1 494 SLAQYELTQPPSVSVSPGQNAQLTCSGDNITIYHVHWYQQKPGSAPVALIYQNSKRVPGIPDRFSGANSGNTATLTITGVQPQDEADYYCQVWSNP
Chrysemys picta bellii Vs463 ighv AHGY01314050.1 315 ARSQVQLVESGGDVKKPGDSLRLSCKASGFDFSSSSYGMNWVRQAPGKRLEWVAYISSSGGTIYYLDSVKGRFTISRDNSKSELYLQLTGLKPEDTARYYCAR
Chrysemys picta bellii Vs316 trav AHGY01255516.1 805 SCCEAQVDQSPQSLVTGEGKVSTMSCAFTSKYQTFHWYQQLPGQGLTHLLAVSPQGNTTEQRFVGQPLEDGKRSSLHITDSQLGDSGSYLCAVD
Chrysemys picta bellii Vs317 trav AHGY01255528.1 2904 QTYGNSVTQTEGTITVREGKPVLLNCTYKTSRSPVPFWYVQYPHAAPRLLLAAYEATDEEERKRRRGFSAKHERNPISFHLNKNSSEVSDSAVYFCALG
Chrysemys picta bellii Vs314 trdv AHGY01255513.1 450 ALGQYTVTQDQPQAAAHEGEPTQLNCSYTGTESSVHWYRQPQGGQPRFVALLSSSGRDTRENFTMSLDTKTKSSFLYLNSSRLEDSAVYLCAL
Chrysemys picta bellii Vs315 trav AHGY01255515.1 841 SSMEDAVTQTQPAVSGVERESVSLDCTYETAASSYYLYWYKQPPGESLNFLSWQHSGGAKKNEAGERFSVSLEKSKSSVSLRITALELGDAAMYFCAFSR
Chrysemys picta bellii Vs312 trav AHGY01255494.1 998 FVQGDSVFQSLPEVTVSEGHDVLLPCNFTTISNTPNLFWYRQYPNHPPQHILTAYKSAAEKNTFTAGKFSTVLIDDNKTVPLKIGAVSLQDRAVYYCALR
Chrysemys picta bellii Vs313 trav AHGY01255495.1 1656 AALGDSVQSKEPHVSGVEGGSVTFSCSYNTTDSRGVYLYWYRQSPNRAPQYILRRGTKLFASDSENAYFAQERFSSQADGSATILNITALELADTAVYLCALQR
Chrysemys picta bellii Vs310 trav AHGY01255487.1 105 AVLGDSVQPREPQMSGVEGGSVTLSCSYESSYTAGVYLYWYLQSPNRAPQYILRRGTKGARSGSDTADFAQERFSSQADGNSTALSIAALELADTAVYYCALQR
Chrysemys picta bellii Vs311 trav AHGY01255490.1 867 SALGDSVQSKEPHVSGVEGGSVTFSCYYNTTDFSGVYLYWYRQSPNRAPQYILRRGTKVYATYRENADFAQERFSSQADDSSTVLTITALELADTAVYLCALQR
Chrysemys picta bellii Vs318 trav AHGY01255528.1 5533 ANGNSVTQTEGSVTICEGEPVLLNCTYETTGYPTLFWYVRYGSQAPRLFLREGSADPEEGNRKDFSAHHKDRTYHLRKLSSQLSDSGVYYCAMS
Chrysemys picta bellii Vs319 trav AHGY01255528.1 8107 RTCANTIMQPERITTIHEGKPVLLHCTYNSSVVQSLFWYEQCPQEAPRLLLTQYEASDEEEKRRRRGFSATLEKDSKSFHLEKNSSEVRDSVVYYCALR
Chrysemys picta bellii Vs907 igkv AHGY01110889.1 6622 ASGDTVLTQTPESLAVFPGESVTIKCKASKSLSYQGKEYLAWYQEKMGQAPKCLIYQASTRTSGIPDRFSGSESGTDFILTISRLEAEDAGNYYCLQSYDAP
Chrysemys picta bellii Vs1212 ighv AHGY01340285.1 1846 IQSKLEFVASGGEIKMLGDSLQISCKTSGFTFGDYGMAWYRIMPGKGLEWVSTISYGAGNTKNYASSVQGRFTISRDNSRSLLYLHMTNLRREDAAEYYCMW
Chrysemys picta bellii Vs1217 ighv AHGY01343674.1 897 VLSEIRLEQWGPDQVKPTESARLTCAVYGTSVDGNHWSWIRQPPGRGLEWLGVIWISGVTGYSSGIKDRIRITRDSSKGQVYLQLNNMKAADTATYYCTR
Chrysemys picta bellii Vs906 igkv AHGY01110886.1 679 SSGQIVMTQTPESLAVSPGDRVTINCKASSSADGWVAWYQKKTGQAPKRLIYDASSRVSGIPDRFSGSGSGTDFTFTISRVEAEDAGDYYCHQYNS
Chrysemys picta bellii Vs1219 trav AHGY01345835.1 2751 GANGESVTQPDDRVTVSQGETVLLKCIYDTSYGTPTLWWYEQHPNEAPRLLLGDYEASNDEERRSRRGFSATPDKQGKTFHLKKSSSELRDSAVYYCAMS
Chrysemys picta bellii Vs1358 trav AHGY01424546.1 3713 APGRAKIQQPVSAEALEGAELNLTCSHPSARADNIFWYRQFPNRGPEFIVTGFSGTAHSPDPEGTLHISKDKENSTFALRRVRLADAAVYYCARS
Chrysemys picta bellii Vs1359 ighv AHGY01426143.1 5236 VRSQVQLVESGGDVKKPGDSLRLSCKASGFTFSSYWMNWVRQAPGKGLEWVATITSSAGSTYYPDSVKGRFTISRDDSKSELYLQMTGLKPEDTARYYCAR
Chrysemys picta bellii Vs1350 trav AHGY01422593.1 1272 SALGDSVKSNEPEVSGSVGGSVTLSCSYTTSDSYVYLYWYRQYPNQAPQYILWRGAKSYSGQSHTANFAQKRFSSQADDSSTVLSIAALELADSAVYYCALWR
Chrysemys picta bellii Vs1351 trav AHGY01422820.1 683 SCCEAQVVQSPEWLVTGEGKVSTMSCSFTSAYQTFQWYQQLPGQGPTHLLTASSNENVTLGRFIGERLENGKRSSLHITDSQLGDSGSYLCAVD
Chrysemys picta bellii Vs1352 igkv AHGY01423476.1 829 SYGQVTMTQSPESLSVTPGEKVTIRCTASSIISSSYVSWYQQKSGQAPKLLIYRASTLASGVPARFSSSGSGTAYTLSISSVEADDAADYYCLQTHSSP
Chrysemys picta bellii Vs1353 ighv AHGY01423727.1 1333 ARSQVQLLESGGDVKKPGDSLRLSCKASGFTFGDYWMSWVRQAPGNGLEWVAAISYWAGSTIHYANAVKGRFTISRDNANSLLYLQMTGLKPEDTALYYCA
Chrysemys picta bellii Vs1354 iglv AHGY01424143.1 312 SLAQYELTQPPSVSVSPGQNAQLTCSGDNITIYHVHWYQQKPGSAPVALIYQNSKRVPGIPDRFSGANSGNTATLTITGVQAQDEAVYYCRVWNNP
Chrysemys picta bellii Vs1355 iglv AHGY01424151.1 921 ASSQPTLTQPPADSVSLGNTVKLSCTLSSQHSSYTVEWYQQRDGQVPRFLWYGSSTKGDGVPDRFTVSSSGAIRYLTITSVQPEDEATYYCGAGYSDE
Chrysemys picta bellii Vs1356 iglv AHGY01424152.1 787 SLSQVTLTQPPSVSVSIGNTVKLSCAFDNRYTFGSVLWYQQKDGNSPRYLLSYNSDSDKHQGSGVPSRFSGSKDASNTICYLTITSVQAEDEADYYCAAYASGA
Chrysemys picta bellii Vs1357 trav AHGY01424173.1 317 GANGESVTQPDDRVTVSQGEPVLLRCTYNTTLIPTLWWYEQRPNEAPRLLLTQYEASDEEARRSRRGFSATPDKQGKTFHLKKSSSELRDSAVYYCAMS
Chrysemys picta bellii Vs1046 trav AHGY01250492.1 681 ALGQYTVTQDRSQAAAHEGEPTQLNCSYTGTEYSVHWYRQPQGGQPRFLSSLSSSGRDTRENFTMSLDTKTKSSFLYLNSSRLEDSAVYLCAL
Chrysemys picta bellii Vs388 ighv AHGY01279070.1 458 VRSQVQLVESGGDVKKPRETLRLSCKASGFTFSSYWMGWVRQAPGKGLEWLTWIHGSSIYYSDSIKGRFTISRDDPNSLLYLQMTGLKPEDTARYYCAR
Chrysemys picta bellii Vs384 trav AHGY01274806.1 799 VTTPEPWHPFVAQIPAKEKAKEGETVVLNCQFHSPWGPSLSKLTVKWYKVDEKGQRDLLENNVTVLTNYSRAFIHGNLSQGDASLTILNVTASDHGIYFCQV
Chrysemys picta bellii Vs382 ighv AHGY01274150.1 56 ARPQVVLTQSGPELKKPGESTRLKCAVSGFTITDYYMDWVRQEPGKGLEWLVHYWKPGSEYYSPTIQGRFTASKDSSNFYLQMNSLKPDDTAVYYCTRRE
Chrysemys picta bellii Vs420 ighv AHGY01296942.1 10130 GVRSQIQFVQSGAEIKKPGESMKLTCKASGYTFNEYRMNWVRQAPGKGLEWVASIRTDTFETSYPQNLKGRVTISVDVPRSTAYLQMNGLKSEDTAVYYCAR
Chrysemys picta bellii Vs421 ighv AHGY01296942.1 12524 VRSQIQFVQSGAEMKKPGESIKLTCKASGYTFTDYSMSWVRQAPGKGLEWVATIRTDNFNTFYPETLKGRTTISVDTSISTTYLQMNSLKSEDSAVYYCA
Chrysemys picta bellii Vs665 trgv AHGY01402867.1 362 GEAQVLVQSQLSITRAENKTARIDCHVSGITLSSAYIHWYRQRPDAALERILYFLSGKPDFDRDSEKAKFEAEKQLSESICVLTVKKISKNDAATYYCAAW
Chrysemys picta bellii Vs422 ighv AHGY01296942.1 16424 VWSQIQLIQSGAEVKKPGDSAKLSCKVSGYTYTSYGMHWARRAPGEGLEWVSSITHGAGDTTYYTDSVKGRFTISRDNTQNLLFLQMTGLKPEDTAVYYCARWG
Chrysemys picta bellii Vs496 iglv AHGY01337700.1 242 WSSQSALNQTSSVAVKPGETAELHCTLQGVEYISKSNPSWYQQRSGMVPRLLIYKSRSRASGIPERFSGETNGNRASLTITGAQAEDDADYYCAVWTGSA
Chrysemys picta bellii Vs423 ighv AHGY01296942.1 21671 VSSQVTLVQSGQGLLKPSESLKLTCTVSGVSITDGCCWWHWIRQRPGRAWEWLGLIKNDGSVVYSQSFQSRLTVSRDTAKNAYYLQISSMTNEDTATYYCMR
Chrysemys picta bellii Vs424 ighv AHGY01296942.1 24934 ARSQVVLTQSGPALKKPRESHTLQCATSGFTLSSTWMSWVRQEPGKGLEWLVSYYDESSTKYYASSVQGRFTASKDSTNFYLQMTSLRAEDTAVYYCT
Chrysemys picta bellii Vs425 ighv AHGY01296943.1 789 VRSQALVESGGDVKKPGDSLRLSCKASGFTFSSYYMNWVRQAPGKGLEWVADIYTGGSSTAYLDSVKGRFTISRDDSKSELYLQMTGLKPEDTARYYCAAG
Chrysemys picta bellii Vs1339 igkv AHGY01409921.1 682 SNGQIVMTQTPESLAVSPGDTVTINCKASEGITGAYTYLAWYQQKSGQAPKLLIYDASTRATGIPDRFTGSGSGTDFTLTISNVQAEDVGDYYCQQYHS
Chrysemys picta bellii Vs426 ighv AHGY01296944.1 5101 VSSQIQLTQSGAENKKPGESVRVTCKTSGYTFTGYTINWLRQTPGKGLEWIGLIYPSTGGTVYAQAFQGRFTITRDNSISTTYLQLGSLRTDDTATYYCA
Chrysemys picta bellii Vs427 ighv AHGY01296945.1 3921 PILGFTMTQSGLGEVTVSGSLSLTCAVSDSALSTGGDWWHWLRQPPGKGLVWLALIDRYGNTHYLPDIQNRTTITVNPSKDEFYLRVDSLSPQDTATYYCAR
Chrysemys picta bellii Vs1501 ighv AHGY01550359.1 26709 CVAAITLTQPSSAQAEPGSSLTLDCVVSGYNINDHHLSWIRQAPGKSLVWLAAFRTGYTTYITDEFKGRVTPRTSGSTGKLKINSLTAADTATYYCATD
Chrysemys picta bellii Vs1500 ighv AHGY01550359.1 32599 SVAAVSLTQPSSAIAKAGSSVTLECVASGYNINDHHMHWTRQSPGKGLVWIAAFKTGATTYISNDFKGRVTPSTSGSTGKLKIDGLTAADTATYYCS
Chrysemys picta bellii Vs1503 ighv AHGY01550929.1 434 VRSQVQLVESGGDVKKPGDSLRLSCKASGFTFSSSSMNWVRQAPGKGLEWIAYIKYDGSTINYLDSVKGRFTISRDDSKSELYLQMTGLKPEDTARYYCA
Chrysemys picta bellii Vs1502 ighv AHGY01550359.1 417 GQSQVQLVQSGAEIKKPGDSLKISCKTSGFPLSHYYMSWLRQAPGKGLVWVGRIDPANGATIYSQSFKDRLTITTDNSISTMYLQLSNLRAEDTAVYYCA
Chrysemys picta bellii Vs428 ighv AHGY01296946.1 2720 ILSQVQLVPSGPGAVKPGETLALTCAVSGVSITESSYAWDWVRQPPRKGLEWVASIYPPDGGKWFATSLQSRTTISSDTSKNQFSLQLASLTAADTAMYYCVRD
Chrysemys picta bellii Vs1274 ighv AHGY01369108.1 3250 AADPDRPGAVKAGETLSITCKVSGVSVSSYHWSWVRQPPGKGLEWMGFIRHTVNGGSTEYNSAFTPRVTITRDTSKDEVYLQLGSWTAADTGTYYCA
Chrysemys picta bellii Vs1448 ighv AHGY01527373.1 2317 ARSQIQLVQSGPGVVKPGETLSLTCTVSGYSISSGYNWAWIQQAPGKGLEYMGNVYAASGSTYYAPTFQGRITISADTAKNQFSLQLRSLTAADTATYYCA
Chrysemys picta bellii Vs1072 trav AHGY01277059.1 1337 ALGQYTVTQDQPQAAAHEGEPTQLNCSYTGTEDSVHWYRQPQGGQPRFVALLSSSGRDTRENFTMSLDTKTKSSFLYLNSSRLEDSAVYLCAL
Chrysemys picta bellii Vs913 igkv AHGY01110891.1 4147 SSGQIALTQTPDSLTVSLGDRVTIKCKASSSLTHSSTGKELLAWYQQKSGQAPKLLIYYATTLQSGVPARFSGSGSGTDFTLTISRVEAEDAGDYFCQQGKSDA
Chrysemys picta bellii Vs567 igkv AHGY01364953.1 1050 SSAQIVMTQSPESLAVPVGGRVSINCKASTSISNNLNWYQQKPGQAPKLLIYGASSLQSGVPARFSGSGSGTDFTLTISSVEAEDAGDYYCQQGNSFP
Chrysemys picta bellii Vs640 ighv AHGY01394310.1 1318 VRSQVKLMQTGAAQVKPSQTLRLTCSVSGFSLTSSGNAVSWVRQPPGKGLEWLSAVDWEDDKYYQESLKNQLTISRDTSKSEVYLEMRGMEAGDSGTYYCAAE
Chrysemys picta bellii Vs641 ighv AHGY01395190.1 310 WVAAITLTQPSSAQSEPGNSITLDCTVSGYNVNDRHMQWLRLPRGKNLVRIASFRPGYTIYIADEFKGRVTPSTSGSTGKLKIDGLTAADTATYYCATD
Chrysemys picta bellii Vs642 iglv AHGY01395521.1 542 SSYQFTLTQPLSMSVTPGESVQLACVLSSGVSISGSYIRWYQQKQGEKPRYLLYYKDDSTQGKGSGVPDRFTASKDTSRNTCFLTISRAEVEDDADYYCLDWD
Chrysemys picta bellii Vs643 trav AHGY01395852.1 7905 AALGDSVQSREPHLSGREGDAVTLTCSYDTSSTGYVYLYWYRQFPGQAPQYILYRGAKFASELSDTAGFAQERFSSQADDSSTALNITALELTDTAVYLCALRL
Chrysemys picta bellii Vs724 igkv AHGY01457545.1 3579 SSGDILMTQTPESLAVSPGDRITINCKASSNVYSYMAWYQQKSGQAPKLLIHSASTRPSGVPDRFSGSGSGTDFTFTISRVEGDDAGDYYCQHYY
Chrysemys picta bellii Vs723 ighv AHGY01456065.1 2931 VRSQVQLVESGGDVKKPGDSLRLSCKASGFTFSSYWMHWVRQAPGKGLEWIARIHGSSIYYSDSVKGRFTISRDDSKSELYLQMTGLKPEDTARYYCAR
Chrysemys picta bellii Vs721 trav AHGY01453225.1 287 ASGQLSVEQSPEWRGVSEGQNVTVTCTYSEVITSLHWYRQAPGERPLFLLMLHGKGSETQEPNFTADHDPGQKRSSLHIRGCRLGDTARYLCAVE
Chrysemys picta bellii Vs720 ighv AHGY01452544.1 199 VQSSYEFVASGGEIKMLGDSLWISCKTSGFHFGGTWLSWVRHAPGKGLQWVATISKDGDVIYYSESVKGRFTISRDNDWNVLYLHMTELRREDAAEYYCTW
Chrysemys picta bellii Vs1431 ighv AHGY01504096.1 1238 ARSQVVLTQSGPEVKKPGESTQLKCAVSGFVPNDWWMDWVRQLPGKGLEWLVHYRQSSVTNYYSSSIQGRFTASKDSANFYLQMTGLKPEDTAMYYCA
Chrysemys picta bellii Vs1433 iglv AHGY01507202.1 543 SLAQYVLTQPPAVSVSPGQNAQLTCSGNNIGSKDVQWFQQKPGSAPLLVIYGSGSGPSGIPERFSGANSGNTATLTITGVQAQDEADYYCQVWDSSAQ
Chrysemys picta bellii Vs1434 ighv AHGY01507205.1 689 VRSQVKLLQTGAAQVKPSQTLRLTCSVSGFSLTEYGYRVSWVRQPPGKGLEWLSAADWEDDKYYQESLKNRLSISRDTSKSEVYLEMRGMEAGDSGTYYCARS
Chrysemys picta bellii Vs1436 igkv AHGY01510567.1 2156 ASGQIVMTQTPESLLVSPGDRVTINCKASANAYSFMAWYQQKSGQAPKLLIYLASNRASGVPDRFSGSGSGTDFTFTISRVEADDAGDYYCQQY
Chrysemys picta bellii Vs1108 igkv AHGY01283648.1 10622 TSGQVVLTQSPESLSILPGETVTIKCQSDTDIDDDMNWYQQKSGAAPKLLLSEGSSRQTGVPARFSSSGYGTDFTFTISSVENDDAGDYYCQQSDRT
Chrysemys picta bellii Vs1170 ighv AHGY01321120.1 4013 ARSQVVLTQSGPEVKKPGESTQLKCAVSGFVPNDWWMDWVRQLPGKGLEWLVHYRQSSVTNYYSPSIQGRFTASKDSSNFYLQMTGLKPEDTAVYYCA
Chrysemys picta bellii Vs1171 ighv AHGY01321121.1 2232 VRSQVQLVESGGDVKKPGDSLRLSCKASRFIFSSYAMSWVRQAPGKGLEWVSYIYTDGSQQFYRDSVKGRFTISRDNPNNLLYLQMTGLKPEDTARYHCA
Chrysemys picta bellii Vs1172 ighv AHGY01321122.1 358 ESGGDVKKPGDSLRLSCKASRFTFSSCLMHWVRQAPGKGLEWVAEIRPDGSSQSYSPAVKGRFTISRDNSKSELYLQMTGLRAEDTARYYCG
Chrysemys picta bellii Vs1173 ighv AHGY01321124.1 441 VWSQVQLVESGGDVKKPGDSLRLSCKGSGYTFSSHQMSWVRQAPGKGLEWIAFIDVTTIYYADSVKGRFTISRDNSNSLLYLEMTGLKPEDTARYHCA
Chrysemys picta bellii Vs1174 ighv AHGY01321126.1 1839 AFSQAQLVESGEGVKKPGDSLRLSCQASGFTFTLDQTGPWEGTGVDQGNTPNFNYHQLRTALQGTLHHLQNNPKMAYLQLSSLRPEDTALYYCSRI
Chrysemys picta bellii Vs1175 ighv AHGY01321127.1 3630 VQSQVLLVESRGGIQKPGGSLRLSCKASEFTFTSYHMSWVRQAPGKGLEWVSRIYNPANSHSTFYSDADKGRFTISRDDSSSSVYLQMTILKAEDTARYYCAR
Chrysemys picta bellii Vs1176 ighv AHGY01321127.1 418 VRSQVQLVESGGDVKKPGDSLRLSCKASGFTFSDYSMNWIRQAPGKGLEWVSRIYYDGSQQFYADSVKGRFTISRDNSNNLLYLQMTGLKPEDTARYYCAR
Chrysemys picta bellii Vs1177 ighv AHGY01321136.1 1215 VLSQVQLVQTGPGAVKPGATLSITCKVSGVSVSDHYWSWNRQPAGKGLEWMGFIRNTANGGTTEYNAALKPRVTITRDTSKDEVYLQLGSLTAADTSTYYCAR
Chrysemys picta bellii Vs1178 ighv AHGY01321137.1 1022 VLSQVQLVESGPGVMKPGQTLTLTCTVSGVSITDSSYLWCWVRQPPGKGLEWVARIYPHDGRKWFAASLQSRTTISSDTSKNQFSLQLASLAAADTTTYYCAR
Chrysemys picta bellii Vs1179 ighv AHGY01321138.1 663 VLCQVQLVQSGPGAVKPGETLTLSCAVSGFSITSSGYGWNWVRLPPGEGLQWLGYIGASGGTGYTPSLQSRLSFSRDTAKNALSLQLRSLTATDTATYYCTR
Chrysemys picta bellii Vs581 igkv AHGY01365013.1 3435 ASGQIVMTQTPESLAVSPGDRITINCKASSSATNKMSWYQQKSGQAPKLLIYRASTRPSGIPDRFSGSGSGTDFTFTISQVEVDDAGDYYCQQGKSSP
Chrysemys picta bellii Vs580 igkv AHGY01365010.1 24009 SEGQIVMTQTPEFLAVSPGGRVTINCKASSSVGSYMAWYQQKSGQAPKRLIHSASTRPSGIPDRFSGSGSGTDFTFTISRVEADDAGDYYCQQGQSFP
Chrysemys picta bellii Vs586 igkv AHGY01365030.1 1422 SSGQLVLTQTPESLAVSPGDRVTINCKTSSSATSGSTHYMAWYQQKSGEAPKLLIYGASNRATGIPDRFTGSGSGTDFTLTISNVQTEDAGDYYCQQGYTAEV
Chrysemys picta bellii Vs585 igkv AHGY01365023.1 4095 SSGQIVMTQTPESLAVFPGDRVTINCKASSSVNNYIAWYQQKSGQAPKLLIYSASTRPSGIPDRFSGSGSGTDYTFTISRVEAEDAGDYYCQQGWS
Chrysemys picta bellii Vs584 igkv AHGY01365014.1 4908 SNGQIVLTQTPESLAVSPGDTVTIRCKASSSVTIGSLHLLGWYQQKSGQAPKPLIYDASTRASGIPDRFTGSGSGTDFTLTISNVQAEDAGDYYCQQYRS
Chrysemys picta bellii Vs1344 trav AHGY01413198.1 795 AVLSDSVRSNEPEVSGSEGDTVTLGCSYETSYTAGVYLFWYRQYPNRAPQYILRRGAKGITFSDTADFAQERFSSQADDSSTVLNITSLELADTAVYYCALQR
Chrysemys picta bellii Vs1343 trav AHGY01413197.1 5860 SALGDSVKSNEPEVSGSVGGSVTLSCSYTTSDSYVYLYWYRQYPNQAPQYILQRGAKSYSGQSHTANFAQKRFSSQADDSSTVLNITALELADSAVYLCALRL
Chrysemys picta bellii Vs210 trbv AHGY01190167.1 9478 QTDAKIMQTPSLVLERGQTAYLRCEQTYGHDSMFWYRQDPGQGLQLLFNFYYKEEREKGTNSSHFQADQLQDDLFRLNISSVQPEHSAVYFCASSS
Chrysemys picta bellii Vs1383 ighv AHGY01442815.1 4717 AQTQVVLIQSGPEMKKPGEYTRRKCTVSGFTVTSYYMAWVRQEPGKGLERLVRYHTPTATNYYSDSIQGRFTASKDSSNFYLQMTSLKPQDTAMYYCAR
Chrysemys picta bellii Vs782 igkv AHGY01522621.1 1898 SNGQIVMTQTPESLAVSPGDTVTIRCKASSSLTSGSYHYLAWYQQKSGQAPKLLIYRASTLQSGVPARFSGSGSGTDYTLTISKVEAEDAGDYYCQQYRSDP
Chrysemys picta bellii Vs1416 trav AHGY01488587.1 2201 GIYGADSVTQTEGSVTISQGEPVSLNCTYQFSVTPYPLWYVQFPSQALTLFLREVGRDDSDEGIRKGFDATHDKKNKSFYLWKPSSELSDSGTYYCPAS
Chrysemys picta bellii Vs322 trav AHGY01255548.1 1467 AMLGNSIRSNEPDVSVIEGDAVTLSCSYSTSYSGVSLQWYHQNPSQAPPYVLRRGAKGSTISDHAEFARKRFTSETNATATVLIITGLELADGAVYYCALNE
Chrysemys picta bellii Vs637 ighv AHGY01394304.1 854 VLCQVQLVQSGPGVVKPGETLTLTCAVSGFSITSSGYGWNWVRLPPGEGLQWLGYIGASGDTGYTPSLQSRLSFSRDTAKNALSLQLRSLTATDTATYYCAR
Chrysemys picta bellii Vs639 ighv AHGY01394308.1 1943 VRPQVQLVESGGDVEKPRDSLRLSCKASGFTFSSSAMSWVGQAPGKGLEWVTEIYTDGSSQWYSPAVQGRFTISRDNPNNLLYLQMTGLKPEDTARYYCA
Chrysemys picta bellii Vs1307 trav AHGY01393654.1 897 AALGDSVQSKESEVPGSVGESVALSCSYTSSDSYVYLHWFRQYPNQAPQYILQRGAKSYSGRSHTADFAKTRFSSQADDSATVLKITALEPADRALYYCALQR
Chrysemys picta bellii Vs24 ighv AHGY01021019.1 2944 VISQVQLVQSGPGAVKPGETLALTCVVSGVSITSSSYAWSWVRQPPGKGLEWVARIYPHDGRKWFATSLQSRTTISSDTSKNQFSLQLASLAAADTAMYYCAG
Chrysemys picta bellii Vs498 iglv AHGY01337704.1 1031 SDAQFVLTQPPSVSASPGQTVTISCARSSGSITASWNSWYQQSPGRAPVLIIYEDSNRPSGIPSRFSGAIDSSAKTITLTISGVQADDEADYYCASYAGSGN
Chrysemys picta bellii Vs1121 ighv AHGY01285930.1 1143 VLSQVQLVESGPGVVKPGQTLTLTCAVSGVSITSSSYVWNWVRQAPGKGLEWVAHIYPHDGRKWFAASLQSRTPISLDTSKNQFSLQLASLAAADTATYYCA
Chrysemys picta bellii Vs1080 ighv AHGY01282664.1 1790 VWSQVQLVESGGDVKKPGDSLRLSCKASGFTFSSYYVGWVRQAPGKGLEWLTWIHGSSIYYSDSIKGRFTVSRDDPNSLLYLQMTGLKPEDTARYYCAR
Chrysemys picta bellii Vs661 ighv AHGY01401415.1 1782 AGAQARLVESGGDVKKPGQSLRLTCKGSGFDFTQAGMHWLRQAPGKGLEWVSVIFFDGSKEYYAASVKGRFTTSRDNSQNLAYLDMSSLKPEDTARYYCAA
Chrysemys picta bellii Vs404 igkv AHGY01291169.1 593 SSGDIVMTQTPESLAVSPGDTVTIRCKASSSLTGGSNHYLAWYQQKSGQAPKLLIYLASTLQSGVPARFSGSGSGTDYTLTINKVEAEDAAVYYCQQTYDTP
Chrysemys picta bellii Vs539 iglv AHGY01357775.1 759 SLSQYTLTQPPAESVSIGNTVKLSCALSGGYTFVSVVWYQQKNGNIPRYLLSYKTDSDKHQGSGVPSRFSGSKDASNTTGYLTITSVQAEDEADYYCTAGT
Chrysemys picta bellii Vs1488 ighv AHGY01550336.1 11620 AWSQVQLVESGGDVKKPGDSLRLSCKASGFTFSSYGMHWVRQAPGKGLEWIAYIYSTSIYYSDSVKGRFTVSRDDPNSLLYLQMTGLKPEDTARYYCAR
Chrysemys picta bellii Vs1051 trdv AHGY01255617.1 4815 KGVLCNQITQTPSALTAEIGNQAKIFCNYATTYSNPDLYWYRQISDHTLQFILHRDNSRSRDADFAKGRFAVERDLAGKTFHLVISPVGSEDAASYYCAIR
Chrysemys picta bellii Vs1054 trav AHGY01258751.1 1075 SSMEDAVTQTQPAVSGVERESVSLDCTYETATSSYYLYWYKRPPGESLNFLIRQHSGGTKRNEAGERFSVNLEKSKSSVSLRITALELGDAAMYFCAFSR
Chrysemys picta bellii Vs911 igkv AHGY01110891.1 15550 SSGQIVMTQTPESLAVFPGDRVTINCKASANITGTYTYLAWYQQKSRQAPQLLIYHASTRPSGIPDRFIGSGSGTDFTLTINSVQAEDAGDYYCQQGYGWT
Chrysemys picta bellii Vs285 ighv AHGY01251541.1 2123 TVQLVESKGGIQTPGGSLRLSCKASGFTFSSYRMDWVRQAPGKGLEWVAEILEPANNLAAYYSDAVKGRFTISRDESSSSVYLQMNSLRAEDTTRYYCAR
Chrysemys picta bellii Vs1209 ighv AHGY01337271.1 920 AQAQVRLEGSGGGAANTGGSRRLSCTGSGFTFKSYDMFWYRQRPGEGLEWVSRITSSGASRDYPDPVKGRFTVTRDNAKNQLYLQMSRLGPEDTARYHCAAR
Chrysemys picta bellii Vs717 ighv AHGY01451458.1 396 VRSDVQLVESGGGVKKPGDSLRLSCKTSRFTFADYNMHWIRQAPGKGLDWVAYISGSSGTTIYYSQAVKGRFTISRDNSNSLLNLQMSDLKAETTGLYYCARQ
Chrysemys picta bellii Vs340 ighv AHGY01255597.1 321 AQSQMQLVESGGAVRNEGESTRLSCKGSGFTFSSSDMFWYRQSPGTGPEFVSSIYDDGSSPYYAAWVQGRFTISRDNAKSELYLAMSRLRRGDTARYHCAARE
Chrysemys picta bellii Vs59 trgv AHGY01036542.1 13927 GAAQVQLTQDQLSITRNLMKTVRIDCKVSGINFGDAYLHWYRQRPGEAPEWILYFKTQTEKSNFDKEKFSIHKTTEKSTCTLTVDKLTYNDTATYYCAYW
Chrysemys picta bellii Vs1193 iglv AHGY01325054.1 1919 SNSQPTLTQPSSASVSPGNTVKLSCTVSSSMSTIAWFQQKPGQAPRFVLYGTTSRGDGIPDRFTGSTSGNVGYLTITNAQAEDDADYYCSMWYSSGSV
Chrysemys picta bellii Vs1190 ighv AHGY01323191.1 2855 ARSQVVLTQSGPELKKPGESTQLKCTVSGFAVSGDYMDWVRQEPGKGLEWLVHYWKPGSEYYSPTIKGRFTASKDSSNFYLQMNSLKAKDTAVYYCTR
Chrysemys picta bellii Vs1479 ighv AHGY01550331.1 10205 VSSQIQLTQSGAEVKKPGESVRVTCKTSGYTFTDYIMHWVRQAPGKALEWIGYINPRSGDTSYAQAFQGRVTITRDTSITMAYLQLGSLRTDDTATYYCV
Chrysemys picta bellii Vs1214 ighv AHGY01341955.1 964 VLSEIRLVQWGPDQVKPTESARLTCAVYGTSVDGNNWSWIRQPPGRGLEWLGVIWSSGGTGYSSGIKDRIRITRDSSKGQVYLQLNNMKAADTATYYCAR