WGS Statistics
Organism WGS Record. Vs Total IGHV IGLV IGKV TRAV TRBV TRGV TRDV
Panthera tigris altaica ATCQ00000000.1 (ATCQ01) 122 2 29 11 45 20 8 7
Vgene Table
Organism Vgene Locus contig Contig Pos. AA sequence
Panthera tigris altaica V0 trdv ATCQ01000825.1 2091 SRGRGEVVQVNDSMYGFIGTDVVLHCSFANPLPGVKITQVTWQKATNGSKQNVAIYNPAMGVSVLAPYRERVEFLRPSFTDGTIRLSRLELEDEGVYICEF
Panthera tigris altaica V133 igkv ATCQ01055518.1 11543 ARGAITMTQSPGFLAGSPGQQVTMNCRASESVSSYLAWYQQKPGQRPKLLIYSASTRASGVPDRFSGSGSRTDFTLTISNLQAEDVASYYCQQYYSSP
Panthera tigris altaica V136 iglv ATCQ01056719.1 3606 SWTQSVVTQPSEVSKPVNKSVTISCTGSSSNVGVGGVSWYQQLPGSVPKVLIYGSSARPAGVPSRFTGSRSGNVASLSISSLQAEDEADYYCSVG
Panthera tigris altaica V137 iglv ATCQ01056731.1 1352 SWAQSVLTQPPSVSGSLGQRVTISCTGSSSNIGSNYVNWYQQLSGTVPKLLIYRNSNRPSGIPDRFSGSKSGSTGTLTITGLQADDEADYYCSTWDNSLS
Panthera tigris altaica V142 trgv ATCQ01059818.1 1209 GLGQGKLEQPEISISRARGKSAHILCKMSTEVINGDIHWYRQKPDQEIEHLTLVSTHPVRVSLGGKSDKLEASKNAHTSTATLKINFLEQEDEAVYFCACWDW
Panthera tigris altaica V193 iglv ATCQ01077503.1 1968 SWAQSGLTQPSSVSGALGQRVTISCTGVGSYVYWYQQIPGMAPRTIIYGNRNRPSGVPDRFSGSKSGSTGTLTITGLQAEDEADYYCSSWDSSLSA
Panthera tigris altaica V259 trav ATCQ01105955.1 793 GVRGMDVEQTPAALSLQEGASSTLRCNFSSSVTYVQWFRQNPGGGSLTWLFYIASGMKQDGRLNCTVNTKDRHSSLHIRASQQEDSATYLCAVQ
Panthera tigris altaica V261 trbv ATCQ01106319.1 47786 PVDTVVTQTPKHLVAPTGSKGTLKCEQHLGHNAMYWYKQSAQRPPKLMFAYNYKELAENDSVPSRFTPECSDSSHLHLHVAALQPEDSAVYLCASSK
Panthera tigris altaica V262 trbv ATCQ01106320.1 2671 PVDSGLTQTPRHLVKARGQQVTLSCFPISGHLSLYWYQQAVGQGPQLLIQYYNREERGRGNFPERFSAQQFPDSHSELNMSSLELTDSALYLCASSP
Panthera tigris altaica V263 trbv ATCQ01106321.1 3298 PVNAGITQTPRFQILGTGQNMTLRCEQDKDHDYMSWYRQDPGHGLRLIHYSVSAGITERGEISNGYNVSRSNTKNFPLTLASATPSQTSVYFCASSD
Panthera tigris altaica V264 trbv ATCQ01106321.1 4941 HTGAGVLQSPRHKVTKRGRDVDLRCDPISGHAGLYWYRQAVGRGPEFLISFRNKDKVDSSGMPSNDRFQVDRPEGSYSILQIQRAEPGDSAVYLCASSP
Panthera tigris altaica V265 trbv ATCQ01106321.1 14601 PMEAGVTQTPRYLIKARGQQGTLRCSPISGHSSVSWYQQALNQGPQIIFEFFEYTQRTKGNFPDRFSGQQFQDYISELHVSSLEPTDSAMYLCASSL
Panthera tigris altaica V266 trbv ATCQ01106321.1 19847 HTGAGVLQSPRHKVTKRGRDVDLRCDPISGHAGLYWYRQAVGRGPEFLISFRNKDKVDSSGMPSNDRFQVDRPEGSYSILQIQRAEPGDSAVYLCASSP
Panthera tigris altaica V267 trbv ATCQ01106321.1 26529 PAGAGVTQSPRHLVKGSGGKAILKCRPMSGHRSVSWYQQAPGQGPQFLIELFDQETREKGNLPSRFSVEQFSDYSSQLNMSSLELGDSASYLCASSL
Panthera tigris altaica V268 trbv ATCQ01106321.1 31483 PMDAEITQNPRYKVTGTGKRVTLKCDQTENYDYMYWYRQDPGHGLKLIYYSNGFDSINRGDVPDGYTVSRKNMENFPLVLESATSSQTSVYFCANSY
Panthera tigris altaica V269 trbv ATCQ01106321.1 43526 PTDAGVTQTPRHQVTMKGQTVTLRCEPISGHASLYWYRQTSGQGLKQLVYFNNQVSIDDSGMPSDRFSAKMPEKSSSTLEIQRTEPGDSATYLCASSL
Panthera tigris altaica V270 trbv ATCQ01106323.1 4435 PTDATVTQTPRHKVAMMGQTITLRCEPISGHEVLFWYRQTSVQGLKLLIHFNNQATIDDLGMPNGGFSAKMPDRSFSTLEIQGTEPGDSATYLCASSK
Panthera tigris altaica V271 trbv ATCQ01106323.1 11344 HTGARVIQSPRYQVTGIGKQASLSCSQNLNHDAMYWYQQKPNQAPKLLLYYYDSNLYTEKDTSDNFKASRTNSSFCSLDILLAGFEDTAVYLCASSK
Panthera tigris altaica V272 trbv ATCQ01106326.1 59 GSGLGALVSQDPRTAVCKSGTSVMIKCHSVGIQATTVFWYRQFPEQGLTLMATSNVDSKAAYEQGFSETEFSISHPNTTFSSLTVMSVKPADSSLYFCSAS
Panthera tigris altaica V273 trbv ATCQ01106326.1 7245 SMDTQVTQSPRYLVRGKKQTAKMNCIPVKGHSYVYWYRRKLEEFKFLAYLQNENILDKIEKFEDQFLAQCPKNSPCSLEIKSTEPGDSALYFCASSE
Panthera tigris altaica V274 trbv ATCQ01106326.1 24316 SVDAGITQTPRNGIIETGKSIVLECSQTMDHAYMYWYRQDPELRLQLVYLSYGTDNINKGEVSNGYSASRKEREKFSLFLETAIPKQTALYFCATRD
Panthera tigris altaica V275 trbv ATCQ01106326.1 30308 LVDASVSQTPRHYVSGTGKKITLECSQTMGHENMYWYRQDPGKALQLIHYSYGINTTEEVEASSGSTVSRIRKEHFPLTLESTSPSQTSLYFCASSE
Panthera tigris altaica V276 trbv ATCQ01106326.1 36375 LKDAVVTQFPRHKILGTGKKLILQCTQDMNHFSMYWYRQDPGSGLQLIYYSTGTEAFEKGDVPEGYHVSRNELPNFPLTLDSASTNQTSVYFCASSL
Panthera tigris altaica V277 trbv ATCQ01106326.1 46201 PMVARVTQTPRHVITGTGKQLTVRCSQDMNHDAMYWYRQDPGLGLKLIYYSRNVDFIEKGDVPDGYAVSQKEERNFPLTLESTSTSQTPLYLCASSKSS
Panthera tigris altaica V278 trbv ATCQ01106326.1 56017 FVDTQGTQTPRYLIEKVGMKVLMECLQNMDHERTYWYRQDPGLGLQLLHRSYNIDSTEKGDAPDGYRVSRKKKNAFPLTLDSASTNQTSVYLCASSK
Panthera tigris altaica V279 trbv ATCQ01106326.1 63610 TVFSALLSQKPHRDICQRGTSVTIHCEVDIQFTLMFWYHQLPGQSLVLMATTNQGLEATYEHGFTKDKFPISRPTLVFSTMTISNVSLEDSSFYFCSAG
Panthera tigris altaica V292 ighv ATCQ01114788.1 10349 VLSQLTLRESGPGLVKPSQSLSLTCIVSGGSVTSSYYWNWIRQRPGRGLEWLGYWSGSTSYNPAFQGRISITADTAQNQFSLQLSSMTTDDTAVYYCAR
Panthera tigris altaica V294 iglv ATCQ01115140.1 1323 SLSQPVVTQPASLSTSLGATARLTCTLSRDINVGGYYIYWYQQNPGSPPRYLLYYYSDSSTQLGPGVPSRFSGSKDASANSGLLLISGLQPEDEADYYCAI
Panthera tigris altaica V295 trgv ATCQ01115160.1 1209 GLGQGKLEQPEISISRARGKSAHILCKMSTEVINGDIHWYRQKPDQEIEHLTLVSTHPVRVSLGGKSDKLEASKNAHTSTATLKINFLEQEDEAMYFCACWDW
Panthera tigris altaica V296 trgv ATCQ01115160.1 8434 TNGGIFITQFIPSITKKKGNTAFLECQVKTGVLKKNVNIHWYRQRPDQPLKRILYISSNENVVHEQGVSEEKYEARKRQRDLPASLRIHKISEDDAGLYYCACWD
Panthera tigris altaica V307 iglv ATCQ01119683.1 8609 SWVQSVLIQPPSVSGALGQTVTISCTGSANNIGIVGVIWYQQLPGKAPKFLISANSFQPSEVSGRFSGSMSGNTGSLTITGLQAEDEADYYCQSIDMTQGA
Panthera tigris altaica V308 iglv ATCQ01119688.1 12472 ATSQEVVTQETSLSTTPGGTVTLTCGSSTGAVTTSNYATWVQQKPYQRFQGLIGETSYRNPGVPARFSGSLVGQKAVLTITGAQSEDEAEYYCVLWFSNH
Panthera tigris altaica V310 iglv ATCQ01119694.1 18671 SWAQSALNQPPSVSGDLGRTVTISCAGSSNDIGRYNYVSWYQQLEGTSPRLLIYSVNSRPSGIPDRFSGSKSGNTASLTISGLQAEDEADYYCCSYARSNT
Panthera tigris altaica V311 iglv ATCQ01119694.1 26693 SMASYVLTQPPSVSMNLGKTARITCGGNNIGSKYAYWYQQKPGRAPMMIIYDDSKRSSRTPDRFSGTNSGNTATLTISGAQAEDEANYYCQVWGGNSD
Panthera tigris altaica V312 iglv ATCQ01119695.1 30661 SVASYVLTQPPSVSVNLGQTARIMCGGNNIGNKYAYWYQQKSGQTPVLIIYKDSNRPSGIPDRFSGTNSGNTATLTISGARAEDEADYYCLSADSSSN
Panthera tigris altaica V313 iglv ATCQ01119698.1 7483 CPDSVSLSVWALGQTITISCSGSNNDIQGYKDVPWYQQLSATSPKLLFYHVHSQASGIPDHFSGSKSGNTATLTISGLQAEDKADYYCCLYTDS
Panthera tigris altaica V314 iglv ATCQ01119698.1 21969 SWAQSALNQPPSVSGDLGRTVTISCAGTSNDIGRYNDISWYQQLEGTSPRLLIYSVNSRPSGIPDRFSGSKSGNTASLTISGLQAEDEADYHCSSYAGSSI
Panthera tigris altaica V315 iglv ATCQ01119698.1 43872 SVAASELTQPPAVSVALGQTARITCEAGSFESSIINWYQQKPGQAPVLVIYEDSEQPTGIPNRFSGSSSGDAATLTITGAQAEDEADYYCQSYDNSGD
Panthera tigris altaica V316 iglv ATCQ01119698.1 55315 SVASYELTQPPSVSVNLGQTARITCGGNNIGSKYAYWYQQKSGQAPVLVIYKDSERPSGIPDRFSGTNSGNTATLTISGAQAEDEADYYCQVWDSSSD
Panthera tigris altaica V317 iglv ATCQ01119701.1 5402 SVASYVLTQPPSVSVSLGQTARITCGGNNIESKSVQWYQQKSGQTPVLIIYNDSNRPSGIPDRFSGTNSGNTATLTISGARAEDEADYYCQVWDSSSD
Panthera tigris altaica V318 iglv ATCQ01119701.1 24925 SVTSNRLTQPPSISVALGEMARITCEGNNIGNTYVSWYQQKLNQVPLMIIYQDSNRPSGIPDRFSGSNSGNTATLTISGARAEDEADYYCLSADSSSN
Panthera tigris altaica V319 iglv ATCQ01119701.1 34179 SMASYMLTQSPSILVTLTQTARITCRGNNSGSKSVYWCQQKPGQAPMLVICYGRNRPSRTPDRFSGTNSGNTATLIISGAQTEDEADYYCQVWDSGN
Panthera tigris altaica V320 iglv ATCQ01119702.1 14572 SVASSGLIQPPSVSVALGQMATITCSGDVLRERYAYWYQQKPGQAPVLLTTKNTERPSGIPDRFSGSNSGNTATLTISRTRAEDEADYYCQSYDSSGN
Panthera tigris altaica V321 iglv ATCQ01119702.1 29276 FMASYVLTQPPSVSVNLGQTARITCGGNNIGSKNAYWYQQKPGQAPMLVIYYSSNRPSGIPDRFSGTNSGNTATLTISGAQAEDEADYYCKVWDGSSD
Panthera tigris altaica V340 iglv ATCQ01128632.1 409 SWAQSVLTQPPSVSGALGQTVTISCAGSVTNIGRISVNWYQQLPGKAPKLLIYANNRRPSSVTDRFSGSKSGTTGSLTITGLQAEDEADYYCQSLDITQGA
Panthera tigris altaica V341 iglv ATCQ01128633.1 634 SWAQSVLTQPPSVSGSLGQRVTISCTGSSSNIGSNYVSWYQQLPGTTPKTIIYWDNSRPSGVPERFSGSKSGSTGTLTITGLQAEDEADYYCSAWDDSLR
Panthera tigris altaica V342 iglv ATCQ01128633.1 9948 SWAQSMLTQPPSVSGALGQRVTISCSGSTNSIGIYGVNWYQQLPGEAPKLLIYGNSNRPSGVPDRFSGSKSGSTGSLTIPGLQAEDEADYYCQT
Panthera tigris altaica V343 iglv ATCQ01128634.1 12860 SWAQSVLTQPPSVSGALGQRVTISCTGSSSNIGGGNYVSWYQQLSGTAPKLLIYGNSNRPSGVPDRFSGSKSGSTGSLTIAGLQAEDEADYYCSAWDDSLSA
Panthera tigris altaica V344 iglv ATCQ01128635.1 8549 SWAQPTLTQEASMSGSVGQKVTLTCTGNSNNVGSYYVGWYQQISHGVPKTVMLGSTRPSGIPARFSGSDSGNTASLIISGLQPEDEADYYCSTWDKSIKA
Panthera tigris altaica V345 trgv ATCQ01129933.1 2205 GVAAISVEQPAVVVARAGSWATLPCKTSASVSYIHWYRHQEGTAPKRILMLDMSSSHVTRDGVLTADKVHAKKGKDSTSSNLSLVKLAKSDEGVYYCAVWEVQ
Panthera tigris altaica V346 trgv ATCQ01129936.1 3803 GVAAISLTQQAVAVGRVGSSTTLSCQASASVSYIHWYLHQEGTAPKRILMLDMSRLYVQRYGGLKADKIDAKKGKESNSCELSVKKLQKSDEGVYYCAAWE
Panthera tigris altaica V347 trgv ATCQ01129937.1 36601 SWAAISLEQPSMVMAQAGRSATLWCKASTKVSYIHWYHHQEGAAPKRLLRLDMSGTFVQRDGGLKADKVNAKRGKGSNSCDLSVLKLEKSDEGVYYCAAWE
Panthera tigris altaica V373 ighv ATCQ01145381.1 257 VHSQVLLVQSGAEVRKPGASVKIFCKASGYSFIDYYMHWVRQAPAQGLEWMGSIDPEDDSTSYAQKFQGRLTLTADTSTNTAYMELSSQRSADTAMYYCAR
Panthera tigris altaica V379 trdv ATCQ01149151.1 928 SSNTQSITQSPSSVQEKEGESVTLDCRFTLNFDYYVMSWYQQLSNGKMTEIIYLVSTSTNTRKGRYSVSHWARDKTLRLTITGLMPTDSGIYFCAVREA
Panthera tigris altaica V380 trav ATCQ01149287.1 190 GTGAQSVTQPDAQVLVSEGARLELKCNYSSSATTYVFWYVQYPNQGLQLLLKYISGDTLVKGINGFKAEFKKSETSFHLRKSPALGSDAAKYFCAVS
Panthera tigris altaica V381 trav ATCQ01149288.1 46 QSTQQLEQSPRFLSIQEGENFTAYCNSTSTFTSFQWYRQKPGEGPVHLMTLSRRGEIKQKSLVAQFGEARKDSSLFIIAAQAEDAAIYICAGPQC
Panthera tigris altaica V382 trav ATCQ01149289.1 3581 VRVQMNVEQSPGVLNLQEGRNTSMMCNYSSIITTVQWFQQNPEGRLVSLSYITSGMQRKGRLIFMLNFQERNSHLYITDLQPGDSGTYFCTVE
Panthera tigris altaica V383 trav ATCQ01149289.1 9214 VNSQQNADQQQVKQTPSLSVQEREISILNCDYNNNMFDYFIWYKKYPAKSLEFVISIRSIVDKKEDERFTVYLNKSAKHLSLHIAASQPGDSALYFCAAN
Panthera tigris altaica V384 trav ATCQ01149289.1 30266 IMSDAKTTQPNAMESTEEEPVRLPCNHSTISGSEYIHWYRQIPHHGPEYLIHGLKDNVTNGMASLTIAKDRKSSALILPRVTLRDAAVYYCITR
Panthera tigris altaica V385 trav ATCQ01149289.1 40161 VSSQELEQSPRSLIIQEGEDFTINCSSSKTLYTLGWYRQKNGEGLSSLMMLQKSGEEKSHEKITAKLDEKKQQTSLHITASQPSHSGIYLCAGD
Panthera tigris altaica V387 trav ATCQ01149290.1 13413 VSSEDKVIQSPPSLVVQEEDSATLNCSYQVTNFQSLLWFQQQENAPTFLFRQISDGIQKSGRLKGTLDKKALLSTLHITATQLGDSATYLCAVE
Panthera tigris altaica V388 trav ATCQ01149291.1 9812 SSMAQKVTQTQPEMSVHEAETVTLDCTFDTRVSNYYLFWYKQPPSGEMVLIIRQEANNKQENATNNRFSVNFQKADKSFSLRISAAQLGDAAMYLCALME
Panthera tigris altaica V389 trav ATCQ01149291.1 17206 SSMAQKVTQTQPEMSVHEAETVTLDCTFDTSDSNYYLFWYKQPPSREMVLIIRQEANKQENATNNRFSVNFQKADKSFSLRISDAQLEDAAMYLCALME
Panthera tigris altaica V390 trav ATCQ01149293.1 17744 ASGKNGVEQSPQSLTAQEGNFVTINCSFSVGMTALHWLQQNPGGGIVSLFILSLEMKKKGRIRATINTEELHSSLYITASQPRDSAIYLCAVE
Panthera tigris altaica V391 trdv ATCQ01149294.1 21173 SSNTQSVTQTPGTVNKQEGESVTLHCSFTLSYTYYVMSWFRQLPNGKMTEIINLYSTSTNTKKGRYSVSHQKGNKALSLTITGLMPTDSGVYFCAVGEA
Panthera tigris altaica V392 trdv ATCQ01149295.1 9938 SSNTQSVTQSPSSVHKQEGESANLFCRFTLSYTYYVMSWFQQPSNGKMTEIIYLYSDSTNTKKGRYSVSYQARDKALRLTITGLMPTDSGVYFCAVGEA
Panthera tigris altaica V393 trdv ATCQ01149297.1 18901 SSNTQGITQSPSLVQEKEGESVTLNCRFTLSYTYYVMKWYQQLSNRKMTEIIYLYSASTNTRTGRYSASHQKGNKAVSLTITGLMPTDSGIYFCAVGEA
Panthera tigris altaica V394 trav ATCQ01149298.1 17837 GSCKTEIIQSSNITAIIGTDVEFPCQYNIPDKNFESVYWYLQRADQRFTYIGHTSQGTVELEHYQLFVNRKLLSSTLTIKHVQPRDKAIYYCAV
Panthera tigris altaica V395 trdv ATCQ01149298.1 24287 VSLDIVLKPDTETLTVLVGEPATFRCSITGGDWKNYQVSWYKKNENNSLTLVYRLSNSSNANISSNFKGNIDALKGQCILDIQRATIKDTGTYYCASD
Panthera tigris altaica V404 iglv ATCQ01152946.1 1032 SWAQSGLTQPSSVSGALGQRVTISCTGVGSYVGWYQQILGMTPKTIIYSNSNRPSGVPDRFSGSKSGSTGTLTITGLQAEDEADYYCSSWDNSLH
Panthera tigris altaica V528 igkv ATCQ01055520.1 20113 SSGDVVMTQTPLSLSVTPGEPASISCRASQSLLHSNGNTYLSWYLQKPGQSPRRLIYLVSNRDSGVPDRFSGSGSGTDFTLRISRVEADDVGVYYCYQA
Panthera tigris altaica V529 igkv ATCQ01055520.1 7139 SSGDVVMTQSPLSLPITPGEPASISCRASQSLLHSNGNTYLSWYLQKPGQSPRRPIYQVSNRASGVPDRFSGSGSGTDFTLRISRVEADDIGVYYCYQG
Panthera tigris altaica V530 igkv ATCQ01055520.1 1082 AGGTAELTQSPTHLSVSLKDSVSVICRANESVRDYLSWYQQKPGQPPKLIIYDADNLESGVSDRFSGIQSGTEFILKISTVEADDTAAYYCQQGYALP
Panthera tigris altaica V531 igkv ATCQ01055521.1 24005 SRGWHVLTQAPETLAASRDSFVSITCRSSTEVGTSMAWYQQKPNEAPRLLIFGASARAAGTPSRFRGSGSGSDFSLTIHGVEAEDIGIYYCQ
Panthera tigris altaica V532 igkv ATCQ01055521.1 19270 ASCEIQMTQSPSSLSASPGDRVTITCRASQNVNTWLAWYQQKPGKVPKLLIYHASTLQTGVPPRFSGSGSGTDFTLTISSLEPEDAATYYCQQHNSG
Panthera tigris altaica V533 igkv ATCQ01055521.1 14370 SSGDVVMTQSPLSLPITPGEPASISCRASQSLLHSNGNTYLSWYLQKPGQSPRLLIYRVSNRASGVPDRFSGSGAGTDFTLRISRVEADDFGVYYCLQG
Panthera tigris altaica V534 igkv ATCQ01055522.1 3604 SSGDIVMTQTPLSLPITPGEPASISCRASQSLLHSNGNTYLSWYLQKPGQSPRRLIYLVSNRDPGVPDRFSGSGSGTDFTLRISRVEADDVGVYYCGQALQYP
Panthera tigris altaica V535 igkv ATCQ01055523.1 28755 AGGTAELTQSPTHLSVSLKDSVSIICRANESVSDYLSWYQQKPGQPPKLIIYDADNLESGVSDRFSGIQSGTEFILKISTVEADDTAAYYCQQGYALP
Panthera tigris altaica V536 igkv ATCQ01055523.1 7706 SGADVVMTQTPLSLPVTPGEPASISCRASQSLLHSNGNTYLHWYLQKPGQSPRLLIYKVSNRASGVPDRFSGSGSGTDFTLRISRVEADDVGVYYCYQSTKNP
Panthera tigris altaica V537 igkv ATCQ01055524.1 8665 SGGWHVLTQAPETLAASRDSFVSITCRSSMEVGTSMAWYQQKPNEAPRLLIFGASARAAGTPSRFRGSGSGSDFSLTIHGVEAEDIGIYYCQ
Panthera tigris altaica V670 trbv ATCQ01106330.1 2226 VSAQTIHQWPPVKVQLVGSPLSLECIVKGESNPYLYWYRQAEGGPPQLLFRSLNIGQVDPEAPRNFTASRPQDGQFILSSQKLLLSDSGFYLCAWS
Panthera tigris altaica V682 trav ATCQ01109335.1 53193 VSSKQEVMQSPEALNVQEGDSVVLNCSYTGSTFYSLQWFRQDPGKGLTVLLLIQSAQREETSGRIKASLDKLSKHSALYIAASQPSDSATYLCAIR
Panthera tigris altaica V683 trav ATCQ01109335.1 37430 GTGAQSLTQPDGHITVSEGAHLELSCNYSSSGTTYLFWYVQHPNQGLQLLLKYSSGPSDALVQGIKGFEAEFKKSEKAFHLRKHSAHWSDSAKYFCAVS
Panthera tigris altaica V684 trav ATCQ01109335.1 31563 VTGLMVKQSPPDLSLQEGLSCTLQCNFSTSVNRVQWFRQNPGGHLIHLFYIPSGTKQNGRLRSTTVVEDRRSLLYISSSSTTDSAIYFCAGAE
Panthera tigris altaica V685 trav ATCQ01109335.1 23647 KSGQEQVKQGPPSLIVQEGAFSTLNCTYENTAFDYFVWYRQYPGQGPALLLAVFSVKHTKEDGRFTVFVSESAKQFSLHIMASQPGDSATYFCAAS
Panthera tigris altaica V686 trav ATCQ01109335.1 8925 VCSVLDVNQYPLSLHVHEGENTNFTCHFPTSNFYGLQWYRWEPAKSPKFLFTIALNGDEKEEGRVKVTLDTKKGSSSLYIKGSQPEDAATYICALT
Panthera tigris altaica V687 trav ATCQ01109335.1 1469 VNGQEIKQIPQFLLLQEGENFTIYCNSSRTLNSLQWYKQRPGGSPVLLITLVKSGDVKQKRLTAWFGDTRKNSLLHMVATETADSGVYFCTGAQCSQ
Panthera tigris altaica V688 trav ATCQ01109337.1 63738 RTHGDGDSVTQMEGPVTIPERKSLTIDCTYSTTWTPTLFWYVQYPRESPQLLLKALRDKETGSHKGFEATYDSKSKSFHLEKSSVQASDSAVYYCAVS
Panthera tigris altaica V689 trav ATCQ01109337.1 56218 VSGKNQVEQHPPSQIIQEGENCTFHCNYTVSPFSHLKWYKQGTGRSPAFLIIMTYDDSKNPSGRYTGTLDATSKHSSLHITAAQLSDSAVYICVVS
Panthera tigris altaica V690 trav ATCQ01109337.1 44061 MRRSHQNEVKQSPVPLTVLEGLTAFLNCSYSDSASQYFVWYRQYSGKGPEFLMHMYSNGEKEEGRFIGLLNKASRYLSLFIRDSQLSDSATYFCAV
Panthera tigris altaica V691 trav ATCQ01109337.1 40114 GMGAQSVTQPDAQVLVSEGARLELKCNYSSSATTYVFWYVQYPNQGLQLLLKYISGDTLVKGINGFKAEFKKSETSFHLRKSPALGSDAAKYFCSVS
Panthera tigris altaica V692 trav ATCQ01109337.1 34528 GTRAQTVTQPEDHLSVFKGDPVQVKCNYSYSGSPVLFWYVQYPKQGLQLLLKHISGGSVKGFTASLNKGEMSFHLKKPSAQEEDSAMYYCVLG
Panthera tigris altaica V693 trav ATCQ01109337.1 29955 VNSQQEQDHQTLSIQEGENATMNCSYKTTINYLQWYKQDSGRGLVLLILIRLNEREKTSGRLRVTLNTSLKSSSLSITASQTADTATYFCATD
Panthera tigris altaica V694 trav ATCQ01109337.1 23730 GINGDSVTQTEGSVTLFEGTPLTLNCTYQSSYTVFVFWYVQYQNKAPQLLLKGLSENQRAEHHGFHASLVKSDSSFHLQKRSVRMSDSAVYYCVLG
Panthera tigris altaica V695 trav ATCQ01109337.1 8982 ASMAQKVTQAQPAISMPEKEAVTLDCVYEASGYTYYLFWYKQPPSGEMILLIYQESYSDQNATEGRYSLNFQKPDRSISLTITGLQLRDSAVYFCALR
Panthera tigris altaica V696 trav ATCQ01109339.1 9303 LSRGENVEQSPSTLSVQEGNSSVITCSYSDSASNYFPWYKQELGKGPQLIIDIRSSVAKKEDQRLTVLLNKTAKHLSLHIAATQPADSAVYFCAAS
Panthera tigris altaica V697 trav ATCQ01109339.1 4699 SSISQKVTQAPPAMLVQEKEAVILECTYDTSDPNYSLLWYKQPSRGEMIFLVRQDSHNQQNATEGRYSLNFQKARKSIHLVISASQLEDSAVYFCALGS
Panthera tigris altaica V698 trav ATCQ01109340.1 40424 DTGAQSVTQPDVHVTVSEGAPLELRCNYSYSGTPYLFWYMQHPNQGLQVLLKYFSGDTLVKGIKGFEAEFKNHETTFHLRKSRALGSDEAKYFCAVR
Panthera tigris altaica V699 trav ATCQ01109340.1 30667 GVRGMDVEQTPAALSLQEGASSTLKCNFSSSVTNVQWFRQNPGGGGLTRLFYIVSGMKQDGRLNCTVNTKDRHSSLHIRASQQEDSATYLCAVQ
Panthera tigris altaica V700 trav ATCQ01109340.1 25200 LSRGENVEQSPSTLSVQEGNSSVIACSYSDSASVYFTWYKQELGKGPQLIIDIRSSVAKKEDQRLTVLLNKTAKHLSLHIAAAQPADSAVYFCAAS
Panthera tigris altaica V701 trav ATCQ01109340.1 14723 QTHGDSVTQMEGPVTLSEGEPLTINCTYSATGYPNLFWYVQYPGEGPQLLLKALRDKEKGSHKGFEATYDAKSKTFHLVKSLVQASDSAVYYCALS
Panthera tigris altaica V702 trav ATCQ01109340.1 2562 GVRGMDVEQTPAALSLQEGASSTLRCNFSSSVNNVQWFRQNPGGGSLTWLFYIASGMKQDGRLNCTVNTKDRHSSLHIRASQQEDSATYLCAVE
Panthera tigris altaica V703 trav ATCQ01109341.1 536 QTHGDSVTQMEGPVTLSEGEYLTINCTYSTTGTPTLFWYVQYPREGPQLLLKAFRDTEKGSHKGFEATYNRKSKTFHLEKSSVQVSDSAVYYCALT
Panthera tigris altaica V704 trav ATCQ01109342.1 2341 GVRGMDVEQTPAALSLQEGASSTLRCNFSSSVTYVQWFRQNPGGGSLTWLFYIASGMKQDGRLNCTVNTKDRHSSLHIRASQQEDSATYLCAVQ
Panthera tigris altaica V705 trav ATCQ01109347.1 425 RTHGDSVTQMEGPVTLSEGEPLTINCTYSTAVSPTLFWYVQYPGEGPQLLLKALRDKEKGSHKGFEATYDGKSKSFHLEKSSVQASDSAVYYCALS
Panthera tigris altaica V706 trav ATCQ01109348.1 8555 LSRGENVEQSPSTLSVQEGNSSVIACSYSDSASVYFTWYKQELGKGPQLIIDIRSSVAKKEDQRLTVLLNKTAKHLSLHIAAAQPADSAVYFCAAS
Panthera tigris altaica V707 trav ATCQ01109351.1 2203 DTGAQSVTQPDVHVTVSEGAPLELRCNYSYSGTPYLFWYMQHPNQGLQVLLKYFSGDTLVKGIKGFEAEFKNHETTFHLRKSRALGSDEAKYFCAVR
Panthera tigris altaica V708 trav ATCQ01109352.1 8016 DTSAQSVTQLDGHVTVSEKAHLELRCNYSYGATPNLFWYVQYPNQGLQLLLKYFSGPPNVLVQGIKGFQAEFRKNETSFHLRKHSAHWSDSAKYFCAAS
Panthera tigris altaica V709 trav ATCQ01109352.1 3319 GSKGDSVTQMEGQMTLSERASLTVNCSYETTQYPALFWCVQYPGEGPQLLLKASKANEKGSSKGFEATYHKEPNSFHLKKSSVQVSDSAVYYCALR
Panthera tigris altaica V710 trav ATCQ01109353.1 3016 VSSQKMEQSPRSLNIQEGEKAVLTCNCTNFSPVVFQWYRQDPGRGLVFLLLIRENESKKQTGRLKATFDNTIKQSSFYITEPQPADSATYLCAA
Panthera tigris altaica V711 trav ATCQ01109354.1 18612 GTGAQSVTQPDVHITVSEGAPLELRCNYSSSVQVYLFWYVQHPNQGLRLLLKYISGDILVKGTKGFEAEFRKSEKAFHLRKPAVQWSDAAKYFCAVS
Panthera tigris altaica V712 trav ATCQ01109354.1 13345 TLSLAKTTQPVFIESYEGQEVNIPCNHTNIATNEYIHWYRQFPNQGPQFVIQGFKTNVENEVASLFISADRTSSTLSLPQAALRDTAVYYCTVSD
Panthera tigris altaica V713 trav ATCQ01109354.1 11616 GVRGMDVEQTPAALSLQEGASSTLRCNFSSSVNNVQWFRQNPGGGGLTRLFYIVSGMKQDGRLNCTVNTKDRHSSLHIRASQQEDSATYLCAVE
Panthera tigris altaica V714 trav ATCQ01109354.1 5742 MSRGEEVKQHPSFLSVWEGDSFVINCTYTDSASTYFFWYKQEPGKGLQSLIYTLSSMDKKQEQRLTVLLNKKDKHLSLQVTRTHPGDSATYFCAVR
Panthera tigris altaica V724 trgv ATCQ01115156.1 3568 GGAAIRVEQPAVVVARAGSWATLPCKTSASVSYLHWYRHQEGTAPKRILMLDMSSSHVISDGVLTVDKVHAKKGKDSTSSNLLLLKLAKSDEGVYYCAVWEEQ
Panthera tigris altaica V749 iglv ATCQ01126467.1 5537 SWAQSVLTQPPSVSGALGQTVTISCAGSANNIGIAGVNWYQQLPGKAPKLLIYDSSDRPSGVPDRFSGSSSGNTGSLTITGLQAEDEADYYCQSVDITQGA
Panthera tigris altaica V762 trgv ATCQ01129938.1 15866 GLAETRLEQPALIMKRTGSSAILSCRARTKVSYIHWYRHQEGKAVQRLLIVALYRSYVQTDSILKGDKVTAKRGTDGSSCNLLLQKLEKSDEGVYYCAAWE
Panthera tigris altaica V779 iglv ATCQ01138656.1 454 IWAQSGPNQPSSVSGALGQRVTISCTGVGSYVGWYQQIPGMAPKTIIYNNSNRPSGVPDRFSGSKSGSTGTLTINGLQAEDEADYYCSSWYSSGSA
Panthera tigris altaica V805 iglv ATCQ01146105.1 709 SWAQSGLTQPSSVSGALGQRVTISCTGVGSYVYWYQQIPGMAPRTIIYGNRNRPSGVPDRFSGSKSGSTGTLTITGLQAEDEADYYCSLWDSSLSA
Panthera tigris altaica V808 iglv ATCQ01147023.1 2953 SLSQPVVTQPASLSTSLGATARLTCTLSRDINVGGYSIYWYQQNPGSPPRYLLYYYSDSSTQLGPGVPSRFSGSKDASANAGLLLISGLQPEDEAEYYCAI
Panthera tigris altaica V809 iglv ATCQ01147024.1 1862 SWAQSVVTQPSAVSKPVNKTVTISCMGSSNVGAGGVFWYQQLPGSVPNVVIYGSSAQPAGVPSRLSGSRSGNVASLSISCLQVEDEADYYCSVW
Panthera tigris altaica V812 trdv ATCQ01149299.1 29400 RGVLCDQVTQSPPYQTVASGSKVTLFCTYHTTYSNPDLYWYRIRPDRSFQFILYRDNTRSKDADFTQGRFWVWHSQSQKTFHLVISVEPEDSATYYCAIY