WGS Statistics
Organism WGS Record. Vs Total IGHV IGLV IGKV TRAV TRBV TRGV TRDV
Ictidomys tridecemlineatus AQQ00000000.1 (AAQQ01) 257 55 34 71 61 19 6 11
Ictidomys tridecemlineatus AGTP00000000.1 (AGTP01) 332 14 55 131 79 33 11 9
Vgene Table
Organism Vgene Locus contig Contig Pos. AA sequence
Ictidomys tridecemlineatus V0 igkv AAQQ01574325.1 5533 ARCDNTMTQYPTSMSASPGDRVTITCRASQNINSWLAWHQQKPGQAPKLLIYKAYNLQSGVLSSFSGSGSGTDYSLTTSSLESEDIATYYCQQDSSLP
Ictidomys tridecemlineatus V1 igkv AAQQ01574335.1 930 VKRDITMTQSPSSLFVSRGGRATITCRVSEDIYGNLNWYQQKPGQPPKLLIYGTFNLQPGVASRFSGSGSETDYSLTISSLKPEDVGTYYCLQGSSYP
Ictidomys tridecemlineatus V2 trav AAQQ01587776.1 1528 GSGAQSVTQPDRHVLVSEGAPLQLRCSYSSSVSPYLFWYQQRPSQGLQLLLKYASGATLVTGINGFQAELRKNETSFHLRKPSAHWSDSAEYFCALS
Ictidomys tridecemlineatus V3 igkv AAQQ01608126.1 216 AKCDITMTQSPTSLSKSHGETVTISCQASQGSINYLNWYQQEPGQGPKLLIYYTNCLQSGVPLRFSGSGSGTDYSLSISSLEPEDFATYFCQQDYSSP
Ictidomys tridecemlineatus V4 trbv AAQQ01640513.1 2557 HLEPGVRQAPSHTVTEAGQDVALSCDPVAGQASLYWYRQTPGKGLEFLVSFYNKLPAGKADFFRDRFSAERPEGSWSTLKIQPTQLGDSATYLCSSPSE
Ictidomys tridecemlineatus V7 trav AAQQ01691534.1 334 VNSQQEESSQILSIQEGENATMNCSYKSSTTTLQWYRQDSGKGPALVILIRSNEREKHSGRLTATLDTSTQRSFLSITASQAADAATYFCATD
Ictidomys tridecemlineatus V8 trav AAQQ01691543.1 187 GSGAQSVTQPDRHVLVSEGAPLQLRCSYSSSVPPYLFWYQQRPSQGLQLLLKYMSGATLVTGINGFQAELRKNETSFHLRKPSAHWSDSAEYFCALS
Ictidomys tridecemlineatus V9 trdv AAQQ01691562.1 210 FSVAQKVIQVQPSTSGQEGGAVTLDCSYGTGWSAYNLFWYKQLPSGEIIFLIRQSSSGSNEIRGHYSVQFRKAAKSISLIILPLQREDSAKYFCALRE
Ictidomys tridecemlineatus V10 trav AAQQ01691566.1 1178 VSTQQLEQRPQFLNTQEGNNLTVHCNSSSVFTSFQWYRQKPGHGPILLLTLVKGGEVKEQKGLNARFDEARKGSSLHIATAQPRDEGIYICA
Ictidomys tridecemlineatus V11 trav AAQQ01691568.1 1008 VRSQQPEQSPQALIIQEREDVTINCSSSKTLYSVQWYRQKHAEGPMFLMMLLKSGEHKSHDKITAMFHEKKQQSSLYIRASRLSHSGTYFCAVE
Ictidomys tridecemlineatus V12 trav AAQQ01691580.1 5399 GSCRTEIIQSSNLAATMGTDVKFQCQYNNLKGNYDSVYWYLQRTNQRLTYIYHTFQGTVESERYQLSVDRKLSSSTLTIKQVQPRDRAVYYCAV
Ictidomys tridecemlineatus V13 trdv AAQQ01691580.1 11100 VCLEIILEPDTKTLTVLIGKPATFRCRVTGGDLKNYQMSWYKKNEDNSLFLIYKLNNSTGNLRNNLKGKIDTLKSEFILDIQKTTPQDAGTYYCGSD
Ictidomys tridecemlineatus V14 trav AAQQ01691586.1 320 VSSEDKVVQSPPSLVVHEGDSATLNCSYEMANFQSLHWYKQEEKAPTFLFILVSSGAETKLGRLSGSLNKKLSTLHTTATQPGDTATYLCAVE
Ictidomys tridecemlineatus V15 trav AAQQ01691587.1 5215 ASMAQTVTQSQPEMSVQEAETTTLDCTYDTRESNYYLYWYKQTASGQMIPIIRQEAYKQENATENRFSVNFQKAAKSLGLKISDSQLGDAAVYFCALQ
Ictidomys tridecemlineatus V16 igkv AAQQ01712664.1 4214 VRCDITMTQSPAFVSKSQGETVTIRCQASEGISNYLSWYQQKPGQAPNPLIYYTNRLQSGVPSRFNGSGSGSDYSLTISSLEPEDSATYFCLQNYKLP
Ictidomys tridecemlineatus V17 trav AAQQ01713818.1 771 SSFAQKVTQAQPVMWVQEKVAVTLHCSYDTSETSYGLLWYKQPSSGEMVFLILQNSYSQQNATEGRYSVNLQKASKSIQLVISASQLGDSAVYFCALRE
Ictidomys tridecemlineatus V18 iglv AAQQ01714088.1 197 STSQAVVTQETSLTTTPGGTVTLTCGSSTGAVTTSNYASWVQQKPYQVPQGVIGGTSNRVPGVPARFSGSLLGDKAALTITGAQTEDEATYYCVLWFSNH
Ictidomys tridecemlineatus V19 igkv AAQQ01728308.1 1098 SSGDVVMTQTPLSVPITPGHPASISCRSSQSLLDSDGNTYLNWVVHKPGQAPKRLIYKVSNRDTWTPDRFSGSGSGTEFTLTISRVEPEDAGVYYCLQG
Ictidomys tridecemlineatus V20 trbv AAQQ01741585.1 4353 HMESGVIQIPSHQVTKMGQMVILRCDPIFGHSFFYWFQQILEQRLEFLVSFYNGKTLEKSEILKDRFSVEKPDKSYFTLKIHLTKLEDSAMYLCASSL
Ictidomys tridecemlineatus V21 trgv AAQQ01744576.1 230 SQTSRSEGRMMSVTSSPGSYVPITCDLPEASIYIHWYQFKEGKAPRYLLYYDLFYCKVVVDSGIISEKYDANEGPNGKCKLEVRNVDESDSAVYYCAYWT
Ictidomys tridecemlineatus V22 trdv AAQQ01749048.1 721 FSVAQKVIQVQPSTSGQEGGAVTLDCSYGTGWSAYNLFWYKQLPSGEIIFLIRQSSSGSNEIRGHYSVQFRKAAKSISLIILPLQREDSAKYFCALRE
Ictidomys tridecemlineatus V23 trav AAQQ01751283.1 946 RTHGDSVTQMEGQVTISEGALLTINCTFSSTRYPTLFWYVQYPGEGPQLLLKAMKANDKVSNKGFEATYNKEATSFNLEKASIQESDSAVYYCALG
Ictidomys tridecemlineatus V24 trdv AAQQ01751284.1 651 SSFAQKVTQAQPAMWVQEKEAVSLLCSYDTSDTGYGLLWYKQPSSGEMVFLILQNSYSQQNATEGRYSVNLQKASKSIQLVISASQLGDSGVYFCALRE
Ictidomys tridecemlineatus V25 igkv AAQQ01756144.1 1555 VRGDITMTQSPSSLPVSPGDRVTINCKASQGIGSNLQWYQQKPGQPPKLLIYWATRLQSGVPSRFSGSGSGTDFTFTISSLEPEDGATYYCQQGYSYP
Ictidomys tridecemlineatus V26 ighv AAQQ01756557.1 3507 VQCEVQLVESGGGLVQPGGSLRLSCAASGFTFSNYWMHWVRQAPGKGLEWVALIRNKANSYTTEYAASVKDRFTISREDAKNTLYLKMSSLRTEDMATYYCTR
Ictidomys tridecemlineatus V27 ighv AAQQ01766277.1 1246 VLCQVQLQESGPGLVKPSQTLSLTCAVSGYSITSDYCWSWIRQPPGQGLEWIGCIGYDGNTYYSPSLKSRVSISRDTSKNQFSLQLSSLTSEDTATYFCAR
Ictidomys tridecemlineatus V28 iglv AAQQ01771444.1 12803 VDCQTTVIQEPSLSVSPGGTVTLTCGLSSGSVSTGHYPGWYQQNPGLAPRPLIYHTNNRFSGVPDRFSGSILGNKAALTITGAQSDDEADYYCLLYMGNG
Ictidomys tridecemlineatus V29 igkv AAQQ01778344.1 1142 SRCDIQMTQSPSSLSASQGDRVSLICRASQGISNNLHWYQQKPGQAPKLLIRYANTLQSWVPSRFSGSGSGTDFTLTISSLEPEDVAIYFCQ
Ictidomys tridecemlineatus V30 igkv AAQQ01782410.1 5858 VRCDFTMTQSPLFLSKSPGKRVTITCRASQSISNYLNWYQQKPGQAPKHLIYDASSLQSGVSTRFSGRGSGTDFTITISSVEPENFATYYCLQYDEFP
Ictidomys tridecemlineatus V31 igkv AAQQ01782411.1 893 ARCDIQMTQSSSSVSKSVGDRVTITCWVSQNIKNYLHWYQQKPGQAPKLLIHWATSMGYGVSSRFSGSGYGKNFTLTISSLEPEDVATYYCLQGYSSP
Ictidomys tridecemlineatus V32 igkv AAQQ01784521.1 22320 ASGSPGLTKSPDSLTVTGGESASITCIANESISDYLTWYQQKPGQAPKILIYDADNLWCGVSDRFSGKQSGTEFILKISRVEAEDAASYYCQQDYAVP
Ictidomys tridecemlineatus V33 ighv AAQQ01784784.1 6259 IQCDVQLVESGGGLVQPGGSLRLSCVASGFTFSDYYMHWFRQAPGKGLEWVALIRNKANSYSTEYAASVKDRFTISREDTKNTLYLQMSSLRTEDTATYYCTR
Ictidomys tridecemlineatus V34 ighv AAQQ01784785.1 1155 VLCQVQLQESGPGLVKPSQTLSLTCAVSGLFHHQWLLLELDPSAPRKGLEWVGYIHSGGSTYYSPSLKSRVSISRDTSKNQFSLQLSSLTTEDTATYYCAR
Ictidomys tridecemlineatus V35 trav AAQQ01785583.1 11674 GVRGQQVEQSPSVLRLQEGNNSTLRCNFSTTMTSVQWFLQNPEGGLINLFYLTPGTKQEGRLKATMNFQERYSTLHISTSQLEDSGTYLCAG
Ictidomys tridecemlineatus V36 trav AAQQ01785813.1 163 VKGGNQVEQSPPSLRLWEGDGTSMSCTHSVSGSTGLQWYRQDSGTGLRRLFSMYSAGDVQQKGRLRATLLKGGSSLNITAVQHGDSATYLCAV
Ictidomys tridecemlineatus V37 igkv AAQQ01786831.1 3416 AKCDITMTQSPASLSKSQGETITIRCQTSQGISNYLSWYQQKPGQAPKLLIYYTNRLQSGVPSRFSGSGSGTDYSLTISSLEPEDVATYFCQQGYLP
Ictidomys tridecemlineatus V38 iglv AAQQ01786862.1 2170 SWAQSVLTQQPSLSGTPGQTITISCTGSSNNIGGYYVQWYQKIPETAPKLIIYDYSKQNSGVSDRFSGSNSGNSASLTITGLQPEDEADYYCQAYDSSLDA
Ictidomys tridecemlineatus V39 iglv AAQQ01789675.1 672 FWAQSALTQPPSVSGTPGQAVTISCAGTSSDIGQYNLVSWYQHRPGTTHKLMIYDVSSRPSGIPDRFSGSKSGNTASLTISGLQLEDEADYYCCSYAGNNN
Ictidomys tridecemlineatus V40 trav AAQQ01790430.1 440 SSMSQKVTQDQAAISMLEMEAVTLNCVYNATSFSYYLFWYKQPPRGEMILLMDQESYREEKVTKGRFSLNLQKPVSSFSLTIWALELQDSAVYFCALRE
Ictidomys tridecemlineatus V41 iglv AAQQ01791205.1 277 VDCQSTVIQEPSLSVSPGGTVTLTCGLSSGSVSTGHYPGWYQQNPGLSPRQLIYYTNNRPSGVPDRFSGSILGNKAALTITRAQTDDEADYYCSLYMGSG
Ictidomys tridecemlineatus V42 iglv AAQQ01792736.1 1101 FWAQSALTQPPSVSGTPGQSVTISCAGTSSDIGKYNEVSWYQNRPGTTHKLMIYGVSSRPSGIPDRFSGSKSGNTASLTISGLQLEDEADYYCCSYAGNYN
Ictidomys tridecemlineatus V43 igkv AAQQ01793185.1 370 ARCDIMMTQSPSSLSASPGDRVTITCRASQNINSWLAWHQQKPGQAPKPLIYKASNLQPGVPSRFSGSGSGTDYTLTISSLEPEDTATYYCVQGYSSP
Ictidomys tridecemlineatus V44 trav AAQQ01797156.1 1630 GVRGEQVEQSPLALRLQEGTSPTLRCNFSATMTSVQWFLQNPGGSLISLFYLTPGTKQEGRLKATMNFQERYSTLHISTSQLEDSGTYLCAAE
Ictidomys tridecemlineatus V45 trav AAQQ01797157.1 4755 VKGGNQVEQSPPSLKPWEGEGTSMSCTYSVSIFNGLQWYRQDAGSGLRHLFSMYSAGDVQQKGRLQATLLKGRSSLNITAVQHGDSATYLCAV
Ictidomys tridecemlineatus V46 iglv AAQQ01023009.1 2061 SWAQSVLTQQPSLSGTPGQRVTISCTGSSTNIGTYSVNWYQQFPETAPKLLIYGNSNRPSGVSDRFSGSKTGNSASLTITGLQPEDEGIYYCQSPDSSFG
Ictidomys tridecemlineatus V47 igkv AAQQ01032237.1 1064 TSGDIVMTQTPLSEPVTPEKSASISCRSSQSLLHSDGKTYLSWVMHKPGQAPQGLIYLASNHVSGVPERFSGSGSGTDFTLRISRVEPEDAGVYYCWQG
Ictidomys tridecemlineatus V48 igkv AAQQ01101312.1 1221 PRCDITMTQSPYFMSKSHGDSFTITCQASESIGTSLHWYQHKPGQAPRLMINYATSLESGVPSRISGTGSWTDFTLTISSLEPEDAATYYCQQSWDSL
Ictidomys tridecemlineatus V49 igkv AAQQ01101333.1 539 ARCDIMMTQSPSSLSASSGDRVTITCRTSQSINSWLAWNQQKPGQAPKLMLYKASNLQSGVPSRFIGRGSGTDYSLTISNLEPEDASTYYCLQGSIW
Ictidomys tridecemlineatus V50 trgv AAQQ01107631.1 1580 SQTSSSLEGRMMSLKRTTGSTAVITCDFAEERNFIHWYQFKEGKAPQHLLFHDFYNSKIVMDSGLDPVKYHVYEGTGQRYKFIVRNLEESDSAEYYCAYWSA
Ictidomys tridecemlineatus V51 trgv AAQQ01107634.1 680 SHTSSGLKRGMISVTSKPGSNVPITCDFNEASNYIHWYQFKEGQAPRHILYYNFLQSKIVVSSGIISGKYNANKGPDGRCTFVVQNVEESDSAVYYCAYWM
Ictidomys tridecemlineatus V52 ighv AAQQ01153014.1 93 VQCEVQLVESGGGLVQPGGSLRLSCAASGFTFSDYGMSWVRQAPEKGLEWVSYISGGSSTIYYADSVRGRFTISRDNSKNTLYLQMSSLRVEDTATYYCAR
Ictidomys tridecemlineatus V53 ighv AAQQ01153019.1 2023 VQCEVQLVESGGGLVQPGGSLRLSCAASGFTFSDYWMSWVRQAPGKGLEWVAQINKNGGSTYYPDSVKGRFTISRDNSKNTLYLQMSSLRTEDTATYFCAR
Ictidomys tridecemlineatus V54 ighv AAQQ01153023.1 2112 VLCQVQLKESGPGLVKPSQTLSLTCSVSGFSITTSGYDWSWIRQPPGKGLEWIGNVWYNGNTYYSPSLKSRVSISRDTSKNQFSLQLSSLTSEDTATYFCA
Ictidomys tridecemlineatus V55 iglv AAQQ01193038.1 433 SMASYVLTQPPSVSVTPGQTAIITCSGDKLSEKYIHWYQQKSAQSPVLVIYEDSERPSGIPDRFSGSSSGNTATLTISRVQAEDEADYYCQSWDSNAE
Ictidomys tridecemlineatus V56 trbv AAQQ01234838.1 4102 PLHSDVSQSPKYLLAQTGKKQFLKCEQNLGHNAMYWYKQDSTQSLKMMFTYFNKEMTVNEMVPSRFSPESPDKAHLNLHVKFLEPEDSALYLCASSQ
Ictidomys tridecemlineatus V57 ighv AAQQ01236204.1 563 VQCEVQLVESGGGLVQPGGSLRLSCAASGFTFSDYWMQWVRHAPGKGLEWVGEINHNGGTTNYVESVKGRFTISRENSKNLLYLQMSSLRAEDTATYYCAR
Ictidomys tridecemlineatus V58 iglv AAQQ01256506.1 321 SWSQSALNQPLSASGSAGQTVTISCTGTSNDIGRYNYVSWYQNLPGSSPTLLIYGVTNRPSGIPDRFSGSKSGNTASLTISRLQPEDEADYYCCSYTSS
Ictidomys tridecemlineatus V59 iglv AAQQ01256508.1 2105 TVASYVLTQPSSVSVTPGQTARITCEGNSIGSYSVYWYQQKPAQAPVLVIYRDSNRPSGISDRFSGSNSGNTATLTISGAQAGDEADYYCQVWDNPV
Ictidomys tridecemlineatus V60 trav AAQQ01338414.1 1152 DSRAQSVTQPHRQVTISEGNSLELACNYSYGGSFSLFWYVQYPNQGLQPVLRYISGNTLVQGIKGFEAEAKKSESSFNLRKPSVHWSDTAEYFCVLV
Ictidomys tridecemlineatus V61 trav AAQQ01338417.1 1944 GSNGDSVTQTEGQVIISEGTSVTVNCSYETSRYPALFWYVQYTGEGPQLLFRVSKANEKGSNKGFEATYNKETSSFHLKKASIQESDSAVYYCALG
Ictidomys tridecemlineatus V62 trav AAQQ01338419.1 662 GVRGQQVEQSPSALRLQEGDSSTLRCNFSITMRSVQWFRQNAGHGLISLFLLTQGTKQEGRLKATLNFQERYSTLHISTSQLEDSGTYLCAAE
Ictidomys tridecemlineatus V63 trav AAQQ01338421.1 527 GTHGDSVTQIEDKMTVSEGSFLTINCTYTATGYPSLFWYFQYPGEGLQLLFRVSKANEKGSNRGFQAMYNKEATSFHLEKDCVQGSDSAVYYCALS
Ictidomys tridecemlineatus V64 trav AAQQ01338435.1 950 NTMAQKVAQDQTAISVMEKEAVTFNCTYEISDDIYYLFWYKQPPRGKPTFLIRQDSYNEQNAMEGRYSLNFQKASSSIQLTITASQLMDAAVYFCALRE
Ictidomys tridecemlineatus V65 trav AAQQ01338445.1 1345 VRGMQVEQSPPALILQEAASSTLLCNFSTSANNVQWFRQNPGGRLINLFYIPSGTKQSGRLTSTTVSKERRSSLYISSSQTTDSAVYFCAVDARCSP
Ictidomys tridecemlineatus V66 trav AAQQ01338450.1 231 GVRGQQVDQSPSALRLQEGTSPTLRCNFSTTMTRVQWFRQNPGGGLISLFYLTSGTKQEGRLKATMNFQERYSTLHISTSQLEDSGTYLCAAE
Ictidomys tridecemlineatus V67 trav AAQQ01338451.1 334 RTLGQSVTQAEGQVTISEGSFLTINCTYSSIGYAYLFWYVQYPGEGPQLLLKALNVNDKGSEKGFEATYKKETTSFHLEKASIQESDSAVYYCALG
Ictidomys tridecemlineatus V68 trav AAQQ01338455.1 28 VRSQQKTVEQSPEALSVPEGAVASLNCTYSDSASQNFRWYQQYSGKGPKLLISIFSNGEKGEGRFTVQLDTAKRHLFLHIRGTQLSDSATYLCAVSTQCSP
Ictidomys tridecemlineatus V69 trdv AAQQ01338472.1 1319 FSVAQKVIQVPPAISGQEGGAVTLDCSYETSWSVYFLFWYKELPSGKMMLLIHQSSSGANRREGRYSVQLRRADKSISLTISPLQREDSAKYFCALRE
Ictidomys tridecemlineatus V70 trav AAQQ01338474.1 2015 VSKGEKVEQHPSFLSVQEGDSAVIHCTYTDSASTYFFWYKHKPGARLQLLMQILSSMERKQDQRLTVLLSKKDKHLSLNITAAHPRDSATYFCAAR
Ictidomys tridecemlineatus V71 trav AAQQ01338476.1 996 VNSQQEEDSPRILSVQEDENATMNCSYKTSTTTLQWYRQDSGKGPALVILIRSNEKEKHSGRLTATLDTSTQRSVLSITASQAADAATYFCATD
Ictidomys tridecemlineatus V72 trdv AAQQ01338477.1 685 TSMAQKVIQAQTAISVVEKEAVTLDCVYETNDPSYYLFWYKQLPSGKLTFLIRQDSYNQQNATEGRYSLNFQKASSSMQLTITASQLMDAAVYFCVLR
Ictidomys tridecemlineatus V73 trdv AAQQ01338486.1 1552 FSVAQKVIQVQPSTSGQEGGAVTLDCSYGTGWSAYDLFWYKQLPSGEIIFLIRQSSSGANEIRGRYSVQFRKATKSIKLTISPLQWEDEAKYFCALWA
Ictidomys tridecemlineatus V74 trav AAQQ01338491.1 914 GVRGQQVEQSPSALRLQEGTSTTLRCNISTTMNRVQWFRQNPGGGLISLFFLTSGTKQEGRLKATMNFQERYSNLHISTSQLEDSGTYLCAG
Ictidomys tridecemlineatus V75 trav AAQQ01338494.1 1501 VNGEQLKQIPPSLHIQEGEDFTIYCNYSSTIDSLQWYKQKPGGSPVFLMIIVKDGDVKKQGRLTAQLGKTRKDSSLHIVATQATDVGTYFCAV
Ictidomys tridecemlineatus V76 trav AAQQ01338502.1 431 VRRAQMKVEQSPQVLNLQEGMSSSLLCNYSLSMTSIQWFQQNPGGQLISLFYIASGAQQNGRMKSTVNSKERYSQLFIRDSQLGDSASYFCAVE
Ictidomys tridecemlineatus V77 trav AAQQ01338509.1 430 VRGQQLNQSPRSLSIQEGENVSMICNSLSTFNIFLWYRQDPGKTLVLLITLYKSGELVRSGKLTAQLGGARKESFLNISSFMPDDSGTYFCSG
Ictidomys tridecemlineatus V78 trav AAQQ01338517.1 500 ASMAQSVTQSQPEMSVQEAETATLDCTYDTKDSNYYLYWYKQTASGQMIPIIRQEAYKQENATENRFSVNFQKAAKSLGLQISDSQLGDAAVYFCALQ
Ictidomys tridecemlineatus V79 trav AAQQ01338520.1 982 ITGGVVVEQNPRYLSTQEGEDHTIYCNYSFTSTDRLHWYRQDPGKSLEFLFVLLSNGAVKQEGPLTASLDTMARLSTLHITDTQYVLSATYFCAL
Ictidomys tridecemlineatus V80 iglv AAQQ01346158.1 1588 SLSQPVLTQSPSVSASLGASVKLTCTLSSQHSTYFISWYKQQPGKAPMYVMYVNSDGSHGKGDGIPDRFSGSSSGADRYLSISNIQNEDEADYLCGV
Ictidomys tridecemlineatus V81 iglv AAQQ01380761.1 1054 SWAQFELTQPHSVLASPGKTVTISCARSSGNIGSNYVHWYQQRQGNAPSTVIYADDQRPSGVPDRFSGSIDSSSNTASLSISDLQIEDEADYYCQSYGSNY
Ictidomys tridecemlineatus V82 igkv AAQQ01381161.1 4391 TSGDIVMTQTPLSQPITPGQSVSFSCRSSQSLLYSNGNTYLYWVVHKPGQAPQGLIYLVSNRYTGVPDRFSGSESGTDFTLRISRVEPDDAGVYYCVQSLHVP
Ictidomys tridecemlineatus V83 ighv AAQQ01381292.1 1084 VQCEVQLVESGGGLVQPGGSLRLSCAASGFTFSDYYMNWVHQAPGKGLEWISSISSGGSNTYYAESVKGRFTISRDNSRNTLYLQMSSLRAEDTATYYCAR
Ictidomys tridecemlineatus V84 trav AAQQ01381812.1 476 VSQGEKVEQHPSTLSVQEGDSAVINCTYSISGSEYFPWYKQEVGKGPQRIIDIRSNKEINQVQRFIVVLDKKAKHFSLNITATQPGDSAVYFCAAD
Ictidomys tridecemlineatus V85 ighv AAQQ01407358.1 2641 VQCEVQLVESGGGLVQPGGSLRLSCAASGFTFSDYWMHWVRQAPGKGLEWIGQIDPDSGSTYYPDSVKGRFTISTDNSKNTMNLQMSSLRVEDTAIYFCAR
Ictidomys tridecemlineatus V86 igkv AAQQ01412592.1 138 ASGSPGLTQSQDSLTVSGGESASITCIANESISDYLTWYQQKPGQAPKILIYDADNLWSGVSDRFSGKQSGTEFILKISRVEAEDAASYYCQQDYAVP
Ictidomys tridecemlineatus V87 iglv AAQQ01414517.1 678 SWAQFELTQPHSVSASPGKTVTISCARSSGNIGSNYVHWYQQRRGSAPSTVIYADDQRPSGVPDRFSGSIDSSSNTASLSISDLQIEDEADYYCQSYGSNY
Ictidomys tridecemlineatus V88 trav AAQQ01414724.1 1919 GVRGQQVEQSPSALRLQEGTSPTLRCNFSTTMQSVQWFRQNPGGGLINLFYLASGTKQEGRLKATADAKERYSTLHISTSQQEDSGTYLCAAE
Ictidomys tridecemlineatus V89 iglv AAQQ01421527.1 1118 SVSSYVLTQPSSVSVTPGQTAGITCGGNNIGSKSVHWYQQKPAHSPLLIIYEDSKRPSGIPDRFSGSNSVNTATLTISGAQAGDEADYYCQVGYSSA
Ictidomys tridecemlineatus V90 iglv AAQQ01422197.1 306 SLSQLVLTQPPSASAPLGQTVKLTCTLSSGYNSYWVAWYQQSPGKSPRFVMRVGTSGIVGSKGDGIPDRFSGSGSGLDRYLTIQSIQEEDENVYYCGTDY
Ictidomys tridecemlineatus V91 trav AAQQ01422402.1 798 VSSQVLQQSPRSLSIQEGENLTINCNSSQSLYALHWYRQNYDGEFIFLMLFRKGEEEKSHEKLTAKLDAKMQQSSLSITAAQPSHSGTYFCGGE
Ictidomys tridecemlineatus V92 ighv AAQQ01430183.1 1962 VLCQVQLQESGPGLVKPSKTCTVSGFSITTSNYYWNWIRHSPGKGLEYIGLITSGGSTYYSPSLKSRVSISRDTSKNQFSLQLSSLATEDTATYYCAR
Ictidomys tridecemlineatus V93 ighv AAQQ01430184.1 2313 VQCEVQLVESGGGLVQPGGSLRLTCVASGFTFSDYWMYWFRQAPGKGLEWVGHIRNKANSYSTVYAASVKDRFTISREDAKNTLYLQMSSLRTQDTATYYCTR
Ictidomys tridecemlineatus V94 trbv AAQQ01431132.1 261 PTKAGITQSPKSQILKTAQRMTLTCAQDMNHDSMYWYRQDPGLGLRLIHYSHNVRNEEKGEVPDGYTASRSSKENFLLTLESPTPSQTSVYLCATSY
Ictidomys tridecemlineatus V95 igkv AAQQ01433767.1 756 AGVRCDIMMTQSPSSLPVSHGDRVTITCRASQGISNNLHWYQQKPGQAPKVLIKYENTFGVPSRFGGSGSGTDFTLIISSLEPEDVADYYCQQSNSFP
Ictidomys tridecemlineatus V96 trav AAQQ01437182.1 1327 VNSQQGEASPQFLSIQEGENATMNCSYKIDITNLLWYRQDSGKGPALVILIRSNEREKHSGRLTATLDTSTKRSILSITASQAADAATYFCATD
Ictidomys tridecemlineatus V97 iglv AAQQ01439304.1 1015 SQAQSKLIQESSMSASKGEKVSLSCVGNSNNVGTYYAGWYQQILGSAPKTVMLGTSRPSGIPDRFSGSRSGNTATLTITGLQEEDEADYYCSTRKKGLI
Ictidomys tridecemlineatus V98 trav AAQQ01449722.1 460 GVRGQQVEQSPSALRLQEGTSPTLRCNFSTTMNRVQWFLQNPGGGLINLFYLASGTKQEGTLKVTADAKEHYSTLHISTSQLEDSGTYLCAVE
Ictidomys tridecemlineatus V99 trav AAQQ01449724.1 3123 FSQGEKVDQHPSNLSVQDGDSAVINCSYSESTWDYFSWYKQETGKGLQRIIDIRSNKEISQIQRFIVVLDKKAKHFFLNITATQPGDSAVYFCAAS
Ictidomys tridecemlineatus V100 ighv AAQQ01455821.1 7465 VLCQVQLQESGPGLVKPSQTLSLTCAVSGFSITTSGYGWSWIRQPPGKGLEWIGNVWYNGNTYYSPSLKSRVSISRDTSKNQFSLQLSSLTSEDTATYFCA
Ictidomys tridecemlineatus V101 ighv AAQQ01455822.1 459 VQCEVQLVESGGGLVQPGGSMRLSCVASGFTFSDYWMHWVRQAPGKGLEWVSFISEHSLYINYADSVRGRFTISRDNSKNTLYLQMSSLRTKDTATYYCAR
Ictidomys tridecemlineatus V102 iglv AAQQ01456952.1 1148 SLSQPVLTQLPSLSASPGASSKLTCTLTSGFSVGSYSIYWYQQKPGSPPKYLLRYYSESNKHQGSGVPIRFSGSKDTSANAGVLQISGLQLEDEADYYCAL
Ictidomys tridecemlineatus V103 igkv AAQQ01464313.1 310 AKCDITMTQSPISLSKCQGETVTISCQASEGIGNELSWYQQKTGKAPKLLIYYANRLQFGVPLSFSGSGSGTEYSLTISSLDPEDLGTYYCQQYDECP
Ictidomys tridecemlineatus V104 igkv AAQQ01465061.1 894 VRCDITMTQSPSSLLVSRGDRVTITCRASQGISNYLHWYQQKPGQAPKRLIYGANTLESGVPSRFSGSGSGTDFTLTISSLEPEDVATYYCQQGSSVP
Ictidomys tridecemlineatus V105 ighv AAQQ01465367.1 1071 VLCQVQLQESGPGLVKPSQTLSLTCAVSGYSITSGYGWSWIRQPPGKGLEWIGYIWYDGSTNYSPSLKSRVSISRDTSKNQFSLQLSSLTTEDTATYYCAR
Ictidomys tridecemlineatus V106 trav AAQQ01467630.1 1351 SSFAQKVTQAQPAMWVQEKEAVTLHCSYDVSGTTYDLLWYKQPSSGEMVFLILQNSYSQQNATEGRYSVNLQKASKSIQLVISASQLGDSAVYFCALRE
Ictidomys tridecemlineatus V107 trav AAQQ01468590.1 745 TSMAQKVIQAQTAISVMEKEAVTFNCTYEISDDIYYLFWYKQPPRGKPTFLIHQDSYNEQNAMEGRYSLNFQKASSSIQLTIKASQLMDAAVYFCALKE
Ictidomys tridecemlineatus V108 ighv AAQQ01470386.1 429 VQCEVQLVESGGGLVQPGGSLRLSCAASGFTFSNYGMSWVRQAPGKGLEWVSYISDDSSYKNYADSVRGRFTISRDNSKNTLYLQMSSLRVEDTATYYCAR
Ictidomys tridecemlineatus V109 ighv AAQQ01475724.1 603 VQCEVQLVESGGGLVQPGGSLRLSCAASGFTFSDYYMSWVRQAPGKGLEWVSYISDDSSYKKYADSVRGRFTISRENSKNTLYLQMSSLSAEDTATYYCAR
Ictidomys tridecemlineatus V110 ighv AAQQ01477088.1 387 VQCEVQLVESGGGLVQPGGSLRLSCAASGFTFSDYYMSWVRQAPGKGLEWVSYISGGGSNIYYADSVRGRFTISRDNSKNTVNLQMSSLRVEDTATYYCAR
Ictidomys tridecemlineatus V112 ighv AAQQ01480781.1 3355 VLCQVQLQESGPGLVKPSQTLSLTCAVSGFSITTSGYRWHWIRQPPGKGLEWIGYITSGGSTNYSPSLKSRVSISRDTSKNQFSLQLSSLTTEDTATYYCAR
Ictidomys tridecemlineatus V113 trav AAQQ01484489.1 571 SSFAQKVTQAQPAMWVQEKEAVSLLCSYDTSETSYGLLWYKQPSSGEMVFLILQNSYSQQNATEGRYSVNFQKASKSIQLVISASHPGDSAVYFCALRE
Ictidomys tridecemlineatus V114 trav AAQQ01485774.1 2971 GVRGQQVEQSPSALRIQEEASSTLRCNFSTTMTRVQWFRQNPGGGLISPSFLTPGTKQEGRLKATMNFQEWYSTLIISTSQLEDSGTYLCAAE
Ictidomys tridecemlineatus V115 igkv AAQQ01486921.1 702 DKCDITMTKSPTSLSKSQGETVTIRCQASQGISNYLSWYQQNPGQAPKLLIYYNNSLQSGVPLRFSGSVSGTDYSLTISTLEPEDAATYFCQQHYSY
Ictidomys tridecemlineatus V116 igkv AAQQ01494121.1 655 VRCDIMMTQSPSSLPVSRGDRVTITCRASQGISNNLHWYQQKPGQAPKLIIKYANTLESEVPSRFSGSGSGTDFTLIISSLEPEDVAVYYCQQSNSFP
Ictidomys tridecemlineatus V117 ighv AAQQ01495164.1 417 VQCEVQLVESGGGLVQPGGSLRLSCAASGFTFSSYWMNWVRQAPGKGLELVGEINLSGGSTYYPDALKGRFTISRDNSKNTLYLQMSSLRVEDTAIYFCAR
Ictidomys tridecemlineatus V118 ighv AAQQ01495165.1 2518 FLCQVQLQESGPGLFKPSQTLSLTCAVTGYSITSGYWWSWIHQSPGKGLEYIGYVSYGGSTNYSPSLKSRVSIFRDTSKNQFSLQLSSMTTEDTATYYCAR
Ictidomys tridecemlineatus V119 iglv AAQQ01495717.1 2152 SWAQSVLTQQPSLSGTPGQRVTISCTGSSNNIGSYNVHWYQQLPEKVPKLLIYDNSNRPSGVSDRFSGSKSGNSASLTITGLQPEDEADYYCQSYDNSLG
Ictidomys tridecemlineatus V120 igkv AAQQ01497090.1 2093 IRCDIKMTQSPSSLPVSRGDRVIITCRASQDIGSYLNWYQQKPGQAPKVLIYVANSLQSRVPLRFSGSGCGTDFTLTISSLEPEDVTTYYCQQYNSL
Ictidomys tridecemlineatus V121 igkv AAQQ01498097.1 5441 FIGDVVQTQTPLSEPITPGQPASISCRSSQSLLHSNANTYLHWVVHKRGQAPQGLICGVSNRYTGVPDRFSGSRSGTEFTLRINRVEPEDDGVYYCWQD
Ictidomys tridecemlineatus V122 igkv AAQQ01498990.1 1029 SIGDTVMTQSPLSLSITTGKPASISCKSSQSLLHSNGNTYLRWVVHKLGQSPQNLIYKVSNQYTGVPDRFSGSGSGTDFTLRISRVEAEDAGVYYCLQ
Ictidomys tridecemlineatus V123 igkv AAQQ01499443.1 8200 SRCDVQMTQSPSSLSASQGNRVSLTCRASQGISNNLHWYQHKPGQAPKLLIRYTNTLQSGVPSRFSGSGSGTDFTLTISSLEPEDVSIYFCQ
Ictidomys tridecemlineatus V124 ighv AAQQ01500531.1 2070 VQCEVQLVESGGGLVQPGGSLRLSCAASGFTFSDYWMSWVRQAPGKGLEWISRISHTSHTTNYADSVKGRFTISRDNSKNTLYLQMSSLRVEDTATYYCAR
Ictidomys tridecemlineatus V125 igkv AAQQ01501004.1 941 ARCDIMMTQSPSSLSASPGDRVTITCRASQNINSWLAWHQQKPGRAPKPLIYKASNLQPGVPSRFSGSGSGTDYTLTISSLEPEDTATYYCVQGYSFP
Ictidomys tridecemlineatus V127 ighv AAQQ01503096.1 1147 VQCEVQLVESGGGLVQPGGSLRLSCAASGFTFSSYGMSWVRQAPGKGLEWVGEINPSGGSTYYPDSVKGRFTISRDNSKNTLYLQMSSLRAEDTATYYCAR
Ictidomys tridecemlineatus V128 trdv AAQQ01503201.1 622 SSFAQKVTQAQPAMWVQEKEAVSLLCSYDTSDTSYSLLWYKQPSSGEMVFLILQNSYSQQNATEGRYSVNLQKASKSIQLVISASQLGDSGVYFCALTE
Ictidomys tridecemlineatus V129 trav AAQQ01503637.1 55 GSNGDSVTQTEGQVIISEGTSVTVNCSYETSRYPALFWYVQYTGEGPQLLFRVSKANEKGSNKGFEATYNKETSSFHLKKASIQESDSAVYYCALG
Ictidomys tridecemlineatus V130 trbv AAQQ01505032.1 508 ARAQTIHQRPTSKVQLVGSPLSLECTVKGASNPNLYWYRQTAGGALHQLFYSVSVGQVEPEMFQSLSASRPQSGQFFLSSKKLLLEDSGFYFCAWS
Ictidomys tridecemlineatus V131 trav AAQQ01505290.1 794 GVRGQQVEQTPSALRLQEGASSILKCNFSTSMDRVQWFRQSPGGSLISLFFLASGTKQEGRLKATADAKERYSTLHISTSQLEDSGTYLCAG
Ictidomys tridecemlineatus V132 trav AAQQ01505292.1 1993 MSRGNKVEQHLSMLSIQEGDSAVINCTYSDSGSSYFTWYKQEAGKGLQMIIDIRSNKEINQIQRFIVVLDKKAKHFSLNVTAAQNGDSAVYFCAAD
Ictidomys tridecemlineatus V133 iglv AAQQ01505542.1 1930 VDSQTTVIQEPSLSVSPGGTVKLTCGLSSGSVSTGHYPGWYQQNPGLAPRQLIYDTNNRPSGVPDRFSGSILGNKAALTITGAQTDDEADYYCSLYMGSG
Ictidomys tridecemlineatus V134 iglv AAQQ01505553.1 1138 SWAQSVLTQPPSLSGTPGERVTISCTGNSNNIGGNYVHWYQQLPETAPKLFIYGNSNRHSGVPDRFSGSKSGNSGSLTITGLQPEDEAVYYCQSYDDSLDV
Ictidomys tridecemlineatus V135 igkv AAQQ01505704.1 2890 SIVSSGEIVLMQSPGSLAASQGERVTMTCTASSSISTSYLHWYQQKPGSSPCLLIYRTSTLSSGVPERFSGSGSGTSYTLTISSMEAEDVATYYCQYWGSS
Ictidomys tridecemlineatus V136 igkv AAQQ01505705.1 2218 VKMGNALTQSPALLAVYPGERTTIICTTNPKENSKFSWYQQKPGQAPKLLVHGTSTLASGVPAWFSGSHSGADFTLTISNVETNDAGTYYCVEWPW
Ictidomys tridecemlineatus V137 igkv AAQQ01508904.1 112 VRCDITMTQSPSSLPVSRGDRVTITCKASQDISNSLHWYQQKPGQAPKLLIRYANTLESGVPSRFSGSGYGTDFTLTIISLEPEDAATYHCQQSSFYP
Ictidomys tridecemlineatus V138 igkv AAQQ01509215.1 8095 STGDIVLTQTPLSEPITPGQSASISCRASQSLLHSNGKTYLNWFVHKPGQAPKHLIYQVSNRDTGVPDRFSGSGSVTDFTLGISRMEPEEAGVYYCSQG
Ictidomys tridecemlineatus V140 ighv AAQQ01509559.1 1420 VLCQVQLQESGPGLVKPSQTLSLTCAVSGYSITSGYYWNWIRQPPGKGLEWIGYIHSGGSTNYSPSLKSRVSISRDTSKNQFSLQLSSLTTEDTATYYCAR
Ictidomys tridecemlineatus V141 ighv AAQQ01509697.1 760 VLCQVQLQESGPGLVKPSETLSLTCAVSGFSITTSGYGWSWIRQPPGKGLEWIGYIWYNGNTYYSPSLKSRVSISRDTSKNQFSLQLSSLTSEDTATYFCA
Ictidomys tridecemlineatus V142 ighv AAQQ01510287.1 534 VLCQVQLQESGPGLVKPSQTLSLTCAVSGFSITTSGYGWSWIRQPPGKGLEWIGNVWYNGNTYYSPSLKSRVSISRDTSKNQFSLQLSSLTSEDTATYFCA
Ictidomys tridecemlineatus V143 ighv AAQQ01510288.1 7278 FQCEVQLVESGGDLVQPGGSLRLSCAASGFTFSSYGMHWVRQAPGKGLEWVSYINSDSSAINYVDSVKGRFTISRDNSKNTVYLQMSSLKSEDTATYYCAR
Ictidomys tridecemlineatus V144 ighv AAQQ01512692.1 638 VQCEVQLVESGGGLVQPGGSLRLSCAASGFTFSDYYMSWVRQAPGKGLEWVSYISDDSSYKKYADSVRGRFTISRDNSKNTLYLQMSSLRVEDTATYYCAG
Ictidomys tridecemlineatus V145 iglv AAQQ01513183.1 2209 VDCQSTVIQEPSLSVSPGGTVTLTCGLSSGSVSTGHYPGWYQQNPGLSPRQLIYYTNNRPSGVPDRFSGSILGNKAALTITRAQTDDEADYYCSLYMGSG
Ictidomys tridecemlineatus V146 iglv AAQQ01513497.1 171 SLAEVVFTQPQHVSGSLGQKVTISCTRSSGDIGNNYVYWYQQHLGSPPTLLIYNYNQRPSGIPDRFSGSKDSSSNSASLTITGLQPEDEADYHCLSGYGNYY
Ictidomys tridecemlineatus V147 igkv AAQQ01517676.1 21454 ASGSPGLTQSQDSLTVSGGESASITCTANESISDYLTWYQQKPGQAPKILIYDADNLWSGVSDRFSGKQSGTEFILKISRVEAEDAASYYCQQDYAVP
Ictidomys tridecemlineatus V148 igkv AAQQ01518238.1 395 SRCDIQMTQSSSSLSASQGDRVTLTCRASQGINNNLHWYQQKPEQAPKLLIRYANTLQSGVPSRFSDSGSGTNVTLTVSSLKPAIYFCQQG
Ictidomys tridecemlineatus V149 igkv AAQQ01519904.1 1042 ARCAIKMTQSPSSLSASPGDRVTITCRASQSINSWLAWYQQKPGQAPKCLICKASSLESGVLSRFSGRGSQTDYTLTISSLEPEDVANYFCLLYYSYP
Ictidomys tridecemlineatus V150 igkv AAQQ01521493.1 742 TNGDIVMTQIPVSEPVTPRQSASISCRSSQSLLHCNGNTYLHWVVHKPGQAPQGLIYFVSNRCTGVPDRFSGSGTGTDFTLRISRVEPEDAGVYYCYQGIQVP
Ictidomys tridecemlineatus V151 ighv AAQQ01522199.1 1604 VQCEVQLVESGGGLVQPGGSLRLSCVASGFTFSDYYMHWVHQAPGKGLEWVGRIRNKANSYTTEYAASVKDRFTISREDAKNTLYLQMSSLRTEDTATYYCAR
Ictidomys tridecemlineatus V152 ighv AAQQ01522200.1 3311 VLCQVQLQESGPGLVKPSQTLSLTCAVSGYSITSGYCWHWIRQPPGKGMEWIGYINSGGSTNYSPSLKSRMSISRDTSKNQFSLQLSSLTTEDTATYYCAR
Ictidomys tridecemlineatus V153 igkv AAQQ01522420.1 1524 VRCDFTMTQPPFFLSKSPGKRVTITCKASQGISNYLNWYQQKPGQAPKHLIYDASSLQSGVSTRFSGRGSVTDFTITISSLEPEDFATYYCLQYDEFP
Ictidomys tridecemlineatus V154 igkv AAQQ01522421.1 1757 AICDIQMTQSSSSLSKSVGDRVTITCWVSQNIKNYLHWYQQKPGQAPKLLIHWATSMGYGVSSRFSGSGYGKNFTLTISSLEPEDVATYYCLQGYSSP
Ictidomys tridecemlineatus V155 trav AAQQ01525100.1 415 TVSLAKTTQRISMDAYEGQEVNISCNHTNIATNEYIFWYRQVPRQGPHFVIQGYKTNVANEVASLFIPVDRKSSTLSLHRVTLRDSAVYYCTVG
Ictidomys tridecemlineatus V156 trav AAQQ01525103.1 840 GVRGQQVEQSPSALRLQEGASSTLRCNFSTTIYKVQWFQQNPGGSLRSLFFLTSGTKQEGRLKATVDTKESYSTLHISTSQLEDSGTYLCAAE
Ictidomys tridecemlineatus V157 iglv AAQQ01525551.1 363 SWAQSVLTQPPSLSGTPGQKVTISCTGSSSNIGSDNVHWYQQFPETAPKLLIYADNNRHSGVPDRFSGSKSGNSGSLTITGLQPEDEAVYYCQSYDYSLNA
Ictidomys tridecemlineatus V158 trdv AAQQ01561692.1 1212 FSVAQKVTQVPPAISAQEGGAVTLDCSYETSRSAYDLFWYKELPSGKMMLLNSSELFWWNRREGRYSVQVRRAEKSISLTISPLQREDSAKYLCALRE
Ictidomys tridecemlineatus V159 igkv AAQQ01574332.1 1977 VRCDIMMTQSPFSLPVSPGDRVTLTCRASEDIRSYLNWYQQKPGQAPKLLMYLANSLESGVPLRFSGSGSRKDYSLTISSLEPEDVSIYFCQQGYH
Ictidomys tridecemlineatus V160 igkv AAQQ01608126.1 4153 SSGDVVLTQSPLSEPVTPGQPASISCRSSQSLLHSNGNTYLNWVVHKPGQAPQGLIYQVSNRYTGVSDRFSGSGSGTDFTLRISRVEPEDAGVYYCWQA
Ictidomys tridecemlineatus V161 trav AAQQ01614764.1 678 RSNGDSVTQTAGLVTLIEGARMILNCTYQTSYSGSFLCWYVQYLDKAPQLLLKSATDNQKTESQGFHATLVKKENSFHLQKPAVQPSDSAVYYCAVR
Ictidomys tridecemlineatus V162 trav AAQQ01645269.1 621 GVRGQQVEQSPSALRLQEGASSTLRCNFSTTIYKVQWFQQNPGGSLRSLFFLTSGTKQEGRLKATVDTKESYSTLHISTSQLEDSGTYLCAAE
Ictidomys tridecemlineatus V163 trav AAQQ01680156.1 2780 GVRGQQVEQSPSALRLQEGTSPTLRCNFSTTMNRVQWFRQNPEGGLISLFYLASGTKQEGRLKATVNFQERYSTLHISTSQLEDSGTYLCAA
Ictidomys tridecemlineatus V165 igkv AAQQ01713947.1 3742 ARCDITMTQSISSLSKSLGESVTIMCQANQFISNYLNWYQHKPGQFPKRLIYGAFSLQSWVPLRISGSGSGTDFTIISSSLEPEDAATYFCLQDTVPL
Ictidomys tridecemlineatus V166 trbv AAQQ01718768.1 871 SGLGAHVSQHPSRAICESGTSVKIECRFVDFQATTVFWYRQFPKQSFVLMATSNVGSEGTYEQGFDKEKFPISHPNASFASLVVTSAHSADSSFYFCEGS
Ictidomys tridecemlineatus V167 ighv AAQQ01719254.1 1417 VQCEVQLVESGGGLVQPGGSLRLSCAASGFTFSDYYMSWVRQAPGKGLEWVSYISDDSSYKKYADSVRGRFTISRDNSKNTLYLQMSSLRVEDTATYYCAG
Ictidomys tridecemlineatus V168 igkv AAQQ01729341.1 1396 VRCDITMTQSPSSLPVSSGDRVTITCIASEDVSSYLHWYQQKQGQAPKLLIRYANTLESGVPSRFSGSGSGTEFTLTINSLEPEDVATYYCQQGSSYP
Ictidomys tridecemlineatus V169 igkv AAQQ01734376.1 1223 SNGDIVLTQSPLSLSVTPVQPASISCRSTQSLLHSDGKKYLKWHQQKPGQAPKLLIYKVPSRFTGVPDRFIGSGSGTEFTQRISRVEAEDAGVYYCFQGKVYP
Ictidomys tridecemlineatus V170 igkv AAQQ01735202.1 1532 TTGDIVLTQSPLSEPITPGESASISCRASQSLRHSDGKTYLYWFVHRPGQAPQSLIYQVSNRDTGVPDRFSGSGSGTDFTLRISRVEPEDAGVYYCWQL
Ictidomys tridecemlineatus V172 igkv AAQQ01747169.1 1880 YKCDIIMTQSQTSLSKSQGETVTFRCQASQGISNYLSWYQQKPGQAPKPLIYYTNSLQSGVLWRFSGSGSGTDYSLTITSLEPKDVADYFCVQSYSSP
Ictidomys tridecemlineatus V173 ighv AAQQ01756076.1 5643 VQCEVQLVESGGGLVQPGGSLRLSCAASGFTFSDYWMSWVRQAPGKGLELVGEINPSGGSTYYPDSVKGRFTISRDNSKNTLYLQMSSLRVEDTAIYFCAG
Ictidomys tridecemlineatus V174 ighv AAQQ01756077.1 2014 VLCQVQLQESGPGLVKPSQTLSLTCAVSGFSITTSSYRWSWIRQPPGKGLEYIGYIHSGGSTYYSPSLKSRGSISRDTSKNQFSLQLSSLTTEDTATYYCVR
Ictidomys tridecemlineatus V175 igkv AAQQ01758934.1 3011 VRCDITMTQSPSSLPLSHGDRVTINCKASQDIGGYLHWYQQKLGQAPKLLIRHATSLQSGVPSRFSGIGSGTDFTLTISSLEPEDAATYFCQQGYSFP
Ictidomys tridecemlineatus V176 trgv AAQQ01770580.1 1053 GLGLSKVEQSEISVSKEIKKSVSINCKISSTSFDTEVIHWYWKKPNKTVEHLIQVSSIKSPARGSLNGKDNKIEAKKYSLTSSSVLTIFSIEKEDAAMYYCAGW
Ictidomys tridecemlineatus V177 ighv AAQQ01771581.1 4858 VLCQVQLQESGPGLVKPSQTLSLTCAVSGYSITSGYCWHWIRQPPGKGMEWIGYINSGGSTNYSPSLKSRMSISRDTSKNQFSLQLSSLTTEDTATYYCAR
Ictidomys tridecemlineatus V178 igkv AAQQ01775200.1 1038 TSGDIVMTQTPVSEPVTPGQSAYISCRSNQSLLHSNGNIYLHWVVHKPGKAPQGLIYFVSNRYTGVPDRFSGSGSGTDFTLRISRMEAEDAGEYYCWQE
Ictidomys tridecemlineatus V179 ighv AAQQ01778711.1 2747 VQCEVQLVESGGGLVQPGGSLRLSCAASGFTFSNYGMSWVRQAPGKGLEWVSYISDDSSYKNYADSVRGRFTISRENSKNTLYLQMSSLRVEDTATYYCAR
Ictidomys tridecemlineatus V180 ighv AAQQ01784249.1 549 VQCEVQLVESGGGLVQPGGSLRLTCVASGFTFSSYYMDWVRQAPGKGLEWVALIRNKANSYSTVYAASVKDRFTISREDAKNTLYLQMSSLRTEDTATYYCAR
Ictidomys tridecemlineatus V181 iglv AAQQ01784339.1 525 VDPQNMVTQEPSLSVSSNGTVTLTCGLSSGSVSTGYYPKWCQQMPGHAPYTIIYNTNTRPSGVPDRFSGSILGNKAALTITGAQIDDEADYYCALFMGSG
Ictidomys tridecemlineatus V182 trbv AAQQ01786592.1 5921 FVSSVLLYQKPSRSICQHGTSVTIQCQVDSQVSLMFWYRQPPGQGLMLIATANQGSEATYESGFDKDKFPISRPNLTFSTLAVNNVSPKDSSLYLCSAG
Ictidomys tridecemlineatus V183 trav AAQQ01791133.1 2204 VHSQQKAVEQRPAALSVPEGAVASLNCTYSDSASQNFMWYQQYSGKGPKLLMFIFSNGEKGEGRFTTQLDTAKRHLFLHIRGSQLSDSATYFCAL
Ictidomys tridecemlineatus V184 trbv AAQQ01088125.1 1020 HAHAGVSQSPRHRVTKTGENIALRCDPVPGHISLYWYRQTPGQGLEFLISFQYERAADKSGMRSERFSAERPQGSYSTLVIKLTEPGDSAVYLCASSS
Ictidomys tridecemlineatus V185 trbv AAQQ01088130.1 1189 SLGQEVTQTPRHLIKGKGQRVKMFCVPIKGHNYLFWYQQILAKQFKFLVSFQYNKVSDPSGMPKERFSAECTQNSSCSLEIQPTELQDSATYLCASSE
Ictidomys tridecemlineatus V186 trbv AAQQ01088141.1 336 HTDAGVIQTPRYEVTEKRQAVTLRCEPISGHTHLFWYRQTAGKEPEFLIYFSSRSVVDDKGMPKDRVSAEMPSASSSTLKIQPTEPKDSAVYLCASS
Ictidomys tridecemlineatus V187 trbv AAQQ01088144.1 828 NAGITQTPKYQILKVGQPVTLRCAQDMNYGSMYWYRQDPGLGLRLVHYSHKIDNMEKGEVPEGYSVSRSRKEDFPLTLPSATYSQTSVYICASS
Ictidomys tridecemlineatus V188 trbv AAQQ01088149.1 4674 PLHSDVSQSPKYLLAQTGKKQFLKCEQNLGHNAMYWYKQDSKQSLKMMFTYNNKEMIANETVPSRFSPESPDKAHLNLHVKSLEPEDSALYLCASSQ
Ictidomys tridecemlineatus V189 igkv AAQQ01100895.1 8558 ARCDIMMTQSPSSLSASPGDRVTITCRASQNINSWLAWHQQKPGRAPKPLIYKASNLQPGVPSRFSGSGSGTDYTLTISSLEPEDTATYYCVQGYSSP
Ictidomys tridecemlineatus V190 igkv AAQQ01178839.1 6253 VRCDITMTQSPSSLPVSCGDRVTITCIASEDISSYLHWYQQKQGQAPKLLIGYANTLESGVPLRFSGSGSGTGFTLTINSLEPEDVATYYCQQGSNYP
Ictidomys tridecemlineatus V191 iglv AAQQ01185284.1 2390 SLSQPVLTQLPSLSATPGASSKLTCTLSSGFSVRSYWINWYQQKPGSPPKYLLSYYSESSKHQGPGVPSRFSGSKDTSANAGVLQISGLQLEDEADYYCGT
Ictidomys tridecemlineatus V192 igkv AAQQ01238387.1 917 IRGDIVMTQTLCEPFMPGQSASISCRSSQSLLYSKGNTYMNWVVHKPGQAAQGLIYKVSNQFSGVPEGFSGSVSGTDFTLRNSRVEPEDAGVYYCYQG
Ictidomys tridecemlineatus V193 trav AAQQ01245087.1 2052 SSFAQKVTQAQPAMWVQEKEAVTLHCSYDVSGTTYDLLWYKQPSSGEMVFLILQNSYSQQNATEGRYSVNLQKASKSIQLVISASQLGDSAVYFCALRE
Ictidomys tridecemlineatus V194 trav AAQQ01245088.1 895 GVRGQQVEQSPSALRLQEGTSTTLRCNFSTSMTNVQWFRQNPGGSLINLFYLASGTKQEGRLKATVDPKERYSTLHISTSQLEDSGTYLCAM
Ictidomys tridecemlineatus V195 trav AAQQ01316258.1 1211 GSGAQSVTQPDRHVLVSEGAPLQLRCSYSSSVPPSLFWYQQHPSQGLQLLLKYVSGATLVTGINGFQAELRKNETSFHLRKPSAHWSDSAEYFCALS
Ictidomys tridecemlineatus V196 trav AAQQ01316259.1 5880 RTLGQSVTQTEGQVTISEGSFLTINCTYSSSGYAYLFWYVQYPGEGPQLLLKAMNINDKGSEKGFEATYKKETTSFHLEKASIQESDSAVYYCALG
Ictidomys tridecemlineatus V197 trav AAQQ01316260.1 2456 SSFAQKVTQAQPAMWVQEKEAVSLLCSYDTSETNYGLVWYKQPSSGEMVFLILQNSYSQQNATEGRYSVNLQKASKSIQLVISASQLGDSAVYFCALRE
Ictidomys tridecemlineatus V198 trav AAQQ01316262.1 1491 MSQGEKVEQRPSTLSVQEGDSAVINCTYSYSGSEYFPWYKQETGKGPQLIIDIRSNKEINQIQRFIVVLDKKAKHFSLNITATQPGDSAVYFCAAD
Ictidomys tridecemlineatus V200 igkv AAQQ01336075.1 1326 VRCDITMNQSPSSLPVSRGDRVKITCRASQDISGYLNWYQQKPGQAPKRLIYRANSLESGVPSRFTGSGSGTDYTLISSSLEPEDVADYFCLQYYSYP
Ictidomys tridecemlineatus V201 igkv AAQQ01336085.1 1065 VKCDITITQSSSSLPVSCGDRVTIVCRASQGISSYLNWYQQKPRKSPKLLICGANSLQSGVPSRFSGSGSRTNFTLTISSLESEDVATYYCQQYKVTL
Ictidomys tridecemlineatus V202 trdv AAQQ01338553.1 1624 KGMLCNQVTQNSEDQTVLSGRELMLLCTYDVSFSNPDLYWYRKRPEGSFQFILYKDNTRSKYADFAQGRFFVKHNPTQKTFHLVVSRVSLEDSATYYCAVD
Ictidomys tridecemlineatus V203 igkv AAQQ01380488.1 1094 ARCDIQMTQSSSSLSKSVGDRVTITCQASQDIKNSLHWYQQKPGQAPKLLIHWATSMGYGVSSRFSGSGYGKDFTLTISSLEPEDVATYYCLQGYSSP
Ictidomys tridecemlineatus V204 igkv AAQQ01381117.1 1165 VRFDIMITQSPSSLRVSCEHRDTLTCRASQSISSNLLWYQQKPGQAPKLLIRYANALESWIPSRFSGSGYGTDFTLTISSLEPEDDADYYCLQNYSSP
Ictidomys tridecemlineatus V205 ighv AAQQ01381218.1 416 VQCEVQLVESGGGLVQPGGSLQLSCAASGFTFSSYGMSWVRQAPGKGLEWVGQINPSGGSTYYPDSVKGRFTISRDNSKNTLYLQMSSLRVEDTAIYFCAG
Ictidomys tridecemlineatus V206 ighv AAQQ01381291.1 2531 VQCEVQLVESGGGLVQPGGSLRLSCAASGFTFSSYWMHWVRQAPGKGLEWVGGIYPGSGSTYYPDSVKGRFTISRDNSKNTLYLQMSSLRVEDTATYFCAR
Ictidomys tridecemlineatus V207 ighv AAQQ01395350.1 5305 VLCQVQLQESGPGLVKHSQTLSLTCAVSDYSITSGYWSWIRQPPGKGLEWIGYITSGGSTYYNPSLKSRVSISRDTSKNQFSLQLSSLTTQDTATYYCV
Ictidomys tridecemlineatus V208 ighv AAQQ01405654.1 2858 VQCEVQLVESGGGLVQPGGSLRLSCAASGFTFSDYYMYWFRQAPGKGLEWVARIKNKANSYTTEYASSVKGRFTISREDAKNTLYLQMSSLRAEDTATYYCFR
Ictidomys tridecemlineatus V209 ighv AAQQ01410532.1 425 VLCQVQLQESGPGLVKPSQTLSLTCAVSGFSITTSSYRWSWIRQPPGKRLEWIGGIRNDGDTNYNPSLKSRVSISRDTSKNQFSLQLSSMTTEDTATYYCAR
Ictidomys tridecemlineatus V210 iglv AAQQ01413458.1 459 FVVSYELTQPFSVSVAPGQTATITCSGDELPNNYANWFQQQYPGQSPVLVIYKDSERPLGIPERFSGSSSGTTATLTISRTQTEDEAVYYCLSSYDDSGN
Ictidomys tridecemlineatus V211 igkv AAQQ01416590.1 578 IRCDIQMTQTSSTLSVSQGDRVTITCQASENIYRYVSWYQQKQEQAPKQLIYAASNLQSGVPSRFSGSGSGKDYSLTISDLEPDDIATYYCLQTTSF
Ictidomys tridecemlineatus V212 ighv AAQQ01418082.1 795 VQCEVQLVESGGGLGQPGGSLRLSCAASGFTFSDYWMSWVRQAPGKGLEWVGEINQNGGTINSANSVKGRFTISRDNAKNTLYLQMSSLRTEDTATYYCAR
Ictidomys tridecemlineatus V213 iglv AAQQ01418267.1 793 SWAQSVLTQQPSLSGTPGQTITISCTGSSTNIGTYIVNWYQQFPQTAPKLLIYGDSNRPSGVSDRFSGSKSGNSASLIITGLQPEDEADYYCQSYDRSLDA
Ictidomys tridecemlineatus V214 ighv AAQQ01418292.1 991 VLCQVQLQESGPGLAKPSQTLSLTCAVSGYSITSNYCWNWIRQPSGEGLEWIGSICYSGNTYYSSTLKSRVSISRDTSKNQFSLQLSSLTTQDTATYYCAR
Ictidomys tridecemlineatus V215 iglv AAQQ01418955.1 1438 SWVQSVLIQQPSLSGASEQSVTISCTGSSNNIGDNFVHWYQQLSGTAPKLIIYDDNDRPSGVPDRFSGSRSGNSALLTITGLQPEDEAVYHCQSYDDSLNT
Ictidomys tridecemlineatus V216 igkv AAQQ01419638.1 365 ANCDIMMTQSPSSLPVSRGKKVTITCRASQNVNSWLVWYQQKPGQAPKHLIYKASNLQSGVPSRFSGSGSGTDYTLTISSLEPEDIATYFCLQYDSYP
Ictidomys tridecemlineatus V217 iglv AAQQ01421875.1 816 FWAQSALTQPPSVSGTPGQAVTISCAGTSSDIGQYNYVSWYQHRPGTTHKLMIYGVSSRPSGIPARFSGSKSGNTASLTISGLQLEDEADYYCCSYAGNYN
Ictidomys tridecemlineatus V218 ighv AAQQ01422143.1 2270 VQCEVQLVESRGGLVKPRDSLRLSCAASGFTFSDYYMYWFHQARGKGLEWVSHIKIKANSYNKEYTSSVKDRFTISREDSKNTLYLQMSSLRTQDTATYYCFR
Ictidomys tridecemlineatus V219 trbv AAQQ01423821.1 2477 SGLGAHVSQHPSRAICESGTSVKIECRFVDFQALSVFWYRQFPKQSFQLMATSNVGSEGTYEQGFDKKNFPISHPNASFASLKVTSAHSADSSFYFCAGS
Ictidomys tridecemlineatus V220 igkv AAQQ01427787.1 2325 SSGNTVMTQSRLSLSITAGQPASISCRSSQSLLHSDGNTYSRWVVHKPSQSPQSLIYKVPNRYTGVPDRFSGSGSGTDFTLRISRVEAEDAGVYYCLQ
Ictidomys tridecemlineatus V221 iglv AAQQ01430713.1 858 SVVSYELIQPPSVSVAPGQTATITCSGDALPKIYAYWFQQQHPGQSPLRVIYEDTKRPSGIPERFSGSSSGTTATLTITRTQTEDEAVYYCLSSYDDSGN
Ictidomys tridecemlineatus V222 igkv AAQQ01436916.1 1493 VRCDIMITQSPSSLSSSQRERVTINCRASQGIINSLHWHPQKPVQAPKLLITYSSTWHSGVPLRFSGNGSGTDFTLTIRSLEHEDVADYYCQQSNSSP
Ictidomys tridecemlineatus V223 ighv AAQQ01456424.1 2738 ALCQVQLQESGPGLVKPSETLSLTCAVSGYSITSGYCWDWIRQPPGKGLEWIGEICSSGNTYYSPSLKSRVSISRDTSKNQFSLQLSSLSTEDTATYFCAR
Ictidomys tridecemlineatus V224 ighv AAQQ01456425.1 4574 VLCQVQLQESGPGLVKPSETLSLTCSVSGFSITTSGYCWDWIRQPPGKGLEWIGRICSSGSTNYSPSLKSRVSISRDTSKNQFSLQLSSLTSEDTATYFCAR
Ictidomys tridecemlineatus V225 ighv AAQQ01456429.1 8878 VLCQVQLQESGPGLVKPLQTLSLTCAVSGFSITTSGYCWDWIHQPVGKGLEWISQICYDGSTAYSPSLKSRVSISRDTSKNQFSLQLSSLTTQDTATYYCAR
Ictidomys tridecemlineatus V226 trav AAQQ01458850.1 667 VKGGNQVEQSPLSLRPWEGDSTSMSCTYSVSAFKGLQWYRQDAGTGLRHLFSMYSTGDVQQKERLRATLLKGGSSLNITAVQHGDSATYLCAV
Ictidomys tridecemlineatus V227 ighv AAQQ01459379.1 691 VLCQVQLQESGPGLVKPSQTLSLTCAVSGYSITSGYWWSWIRQPPGKGLEWIGYIHSGGSTNYSPSLKSRVSISRDTSKNQFSLQLSSLTTEDTATYYCAR
Ictidomys tridecemlineatus V228 igkv AAQQ01460844.1 10049 SIVSSGKIVLMQSPGSLAASQGERVTMTCTASSSISTSYLHWYQQKPGSSPCLLIYRTSTLASGVPERFSGSRSGTSYTLTISNMEAEDVATYYCKYWGSS
Ictidomys tridecemlineatus V229 igkv AAQQ01460862.1 1063 VKCDITMTQSSSSLSVSPGGRVTITCRASEDIYDNLNWYQQKPGKPPKLLIYDASNLQPGVPSRFSGSGSGTDYYFTINSLEPEDAATYFCQQGSSSP
Ictidomys tridecemlineatus V230 ighv AAQQ01465113.1 804 VLCQVQLQESGPGLVKPSQTLSLTCAVSGFSITTGIYDWSWIHQPSGKGLEYIGHIHSGGSTNYSPSLKSRGSISRDTCKNQFSLQLSSLTTEDTATYYCAR
Ictidomys tridecemlineatus V231 ighv AAQQ01465114.1 2255 VLCQVQLQESGPGLVKPSETLSLTCSVSGFSITTSGYCWDWIRQPPWKGLEWIGEICSSGNTYYSPSLKSRVSISRDTSKNQFSLQLSSLTSEDTATYFCA
Ictidomys tridecemlineatus V232 ighv AAQQ01465117.1 3225 IQCDVQLVESGGGLVQPGGSLRLSCAASGFTFSNYWMHWVRQAPGKGLEWVALIRNKANSYTTEYAASVKDRFTISREDAKNTLYLKMSSLRTEDMATYYCTR
Ictidomys tridecemlineatus V233 igkv AAQQ01470514.1 1139 ARCDTTMTQSPSSLSKSQGDRVAISCKASQIIGTAVAWYQQKAGQTPKLLIYQATSLQPGVPSRFSGSGSGTDFTFTISSLEPKVAATYYCQLDYN
Ictidomys tridecemlineatus V234 ighv AAQQ01475063.1 961 VLCQVQLQESGPGLVKPSQTLSLTCAVSDYSITSGYWSWIRQPPGKGLEWIGYIWRDGDTYYNPSLKSRVSISRDTSKNQFSLQLSSMTTQDTATYYCAR
Ictidomys tridecemlineatus V235 trgv AAQQ01476540.1 2362 SQTSSSLQGRMMSVTSSPGSYVSISCDLASTYIHWYQFKEGQAPRRLLYYDFKNSKVVRDSRITWIKYSAYKGADGQCKLTVRNVEESDSAVYYCAHWI
Ictidomys tridecemlineatus V237 ighv AAQQ01478065.1 3111 VLCQVQLQESGPGLVKPSQTLSLTCAVSGFSITSGSYGWSWIRQPPGKGLEYIGYIHSVGSTYYSPSLKSRVSISRDTSKNQFSLQLSSLTTEDTATYYCAR
Ictidomys tridecemlineatus V238 iglv AAQQ01478144.1 723 SWAQFELTQPHSVSASPGKTVTISCARSSGNIGSNYVHWYQQRRGSAPSTVIYEDDQRPSGVPDRFSGSIDSSSNTASLSISDLQIEDEADYYCQSYDSNY
Ictidomys tridecemlineatus V239 iglv AAQQ01481895.1 1526 FWAQSALTQPPSVSGTPGQAVTISCAGTSSDIGQYNLVSWYQHRPGTTHKLMIYDVSSRPSGIPARFSGSKSGNTASLTISGLQLEDEADYYCCSYAGNYN
Ictidomys tridecemlineatus V240 igkv AAQQ01486385.1 910 ARCDITMTQSPSSLPVSHGDRVTITCRASQSINSWLAWYQQKPGQAPKPLIYKASNLQSGVPSRFSGSGSGTDYTLTISSVEPEDVATYYCQQYDKLP
Ictidomys tridecemlineatus V241 igkv AAQQ01492536.1 317 VRCDITMTQSPSSLPVSRRDRVKITCRASQNINSWLAWFQQKPGQAPKLLIYSASNLQPGVLSRFSGSGSGTDYSLTISSLEPEDVANYYCVQG
Ictidomys tridecemlineatus V242 igkv AAQQ01497147.1 5823 SIGDTVMTQSPLSLSISAGQPVSISCKSSQSLLHSNGNTYLRWVVHKLGQSPQNLIYKVSNQYTGVPDRFSGSGSGTDFTLRISRVEAEDAGVYYCLQ
Ictidomys tridecemlineatus V243 trav AAQQ01505592.1 810 LMGDSVTQMESHVTMSEGALLTINCTYSATTIAYPALFWYVQYPGEGLQILLKAVKANYKSSNKGFEATYNKEASSFNLEKASIQESDSAVYYCALG
Ictidomys tridecemlineatus V244 trav AAQQ01505595.1 1002 SSFAQKVTQAQPAMWVQEKEAVSLLCSYDTSETSYGLLWYKQPSSGEMVFLILQNSYSQQNATEGRYSVNLQKASKSIQLFISASHPGDSAVYFCALRE
Ictidomys tridecemlineatus V245 trbv AAQQ01506717.1 1296 SMDSGVTQTPRKRITKTGKSTVLECSQTKGHDRMYWYRQDPGQGLRLIYFSIGVNDISQGEVSNGYSASRTEKPKFFLTVETATPNQTALYFCASSP
Ictidomys tridecemlineatus V246 ighv AAQQ01508580.1 824 FLCQVQLQESGPGLFKPSQTLSLTCAVTGYSITSGYWWSWIHQSPGKGLEYIGYVSYDGSTNYSPSLKSRVSIFRDTSKNQFSLQLSSLTTEDTATYYCAR
Ictidomys tridecemlineatus V247 ighv AAQQ01508585.1 1973 VQCEVQLVESGGGLVQPGGSLRLSCAASGFTFSNYWMHWFRQAPGKGLEWVALIKHKANSYSTAYAASVKDRFTISREDAKNTLYLQMSSLRTEDTATYYCAR
Ictidomys tridecemlineatus V248 igkv AAQQ01509669.1 3032 IQITQSPSSLSKSVGDKVTITCQVSQGISNNFHWYQKKPGQTPKLLIHWATSMGYGVPSRFSGSRYGKDFTLIIRSLEPEDVATYYCVQDNSAP
Ictidomys tridecemlineatus V249 trav AAQQ01513663.1 1713 GSGAQSVTQPDRHVLVSEGAPLQLRCSYSSSVPPSLFWYQQRPSQGLQLLLKYASGATLVTGINGFQAELRKNETSFHLRKPSAHWSDSAEYFCALS
Ictidomys tridecemlineatus V250 trdv AAQQ01513669.1 682 SSFAQKVTQAQPAMWVQEKEAVSLLCSYDTSETSYDLLWYKQPSSGEMVFLILQNSYSQKNATEGRYSVNLQKASKSIQLVISASQLGDSGVYFCALRD
Ictidomys tridecemlineatus V251 trgv AAQQ01516646.1 2581 TSGDILISQFAANIIKKRGNTAFLECQMKTNTRKNNAYMHWYRQKPDQPLKRILYISSNENVIHEQGVNGDRYEAKKWQNDLIFSLRIHRVAQEDEGIYYCACWD
Ictidomys tridecemlineatus V252 igkv AAQQ01518247.1 2343 ARCAIKMTQSPSSLSASPGDRVTITCRASQSINSWLAWYQQKPGQAPKCLICKASSLESGVLSRFSGRGSQTDYTLTISSLEPEDVANYFCLLYYSSP
Ictidomys tridecemlineatus V253 igkv AAQQ01522897.1 666 TSGDVVMTQTTLSEPVTPGESTSISCMSSQSLLDSDGNTYLSWVVHKPGQAPQGLIYKVSNSVSGVSDRFSGSGSETEFTLRISRVEAEDAGVYYCAQH
Ictidomys tridecemlineatus V254 igkv AAQQ01524356.1 3258 AKCDMQMTQSPLSLSKSRGERVTITCQASEYISDDLYWYQQKPGQAPKLLLYDTTSLQSGVPSRFTGSGSGMDFTLTISILEPEDVNTYFCQQGNSFP
Ictidomys tridecemlineatus V255 igkv AAQQ01524357.1 692 ANCDIMMTQSPSSLPVSRGKKVTITCRASQNVNSWLVWYQQKPGQAPKHLIYKASNLQSGVPSRFSGSGSGTDYTLTISSLEPEDIATYFCLQYDSYP
Ictidomys tridecemlineatus V256 igkv AAQQ01524361.1 10221 ARCDITMTQSPSSLSVSPGDRVTITCRASQSINSWLVWHQQKPGKAPKRLIYKASNLQSGVPARFSGSGSGTDYTLTISSVDPEDVATYYCQQHNSNP
Ictidomys tridecemlineatus V257 igkv AAQQ01524370.1 1047 SRCDITMTQSPSFMSKSQGDSVTMTCQASESIGTSLHWYQQKPEQAPRLMNNYATNLESGVPSRFSGTGSWIDFTLTISSLESEDVATYYCQQSWDSP
Ictidomys tridecemlineatus V258 igkv AAQQ01524372.1 6708 VRCYITMTQSPSSLPVSREDRVTLNCRASQGFGSNLNWYQKKLGQAPKLLIYLAISLQPGITSRFSGSGSGTDFTLTISSLEPEDVANYYCQQGSSSP
Ictidomys tridecemlineatus V259 iglv AAQQ01525252.1 509 SQAQSKLIQESSMSASKGEKVSLSCVGNSNNVGTYYAGWYQQILGSAPKTVMLGTTRPSGIPDRFSGSHSGNTATLTITGLQVEDEANYYCSTWDSSLS
Ictidomys tridecemlineatus V260 iglv AAQQ01525255.1 10340 VVTQETSLPTTPGGTVTLTCGSSTGAITTSNYAGWVQQKPYQVPQGLIGSTSNRFPGVPASYSGSLLGDKASLTIMGTQTEDEATYYCALWFSNH
Ictidomys tridecemlineatus V261 trbv AAQQ01567778.1 7405 SVDAEVTLSPRHLIRAKGGKGTLKCYPMSGHRSVSWYQQAPGQGPQFLVEYFDKLQRDKGNLPDRFSAQQFDDYHSELNMSSLELGDSATYLCASS
Ictidomys tridecemlineatus V262 trbv AAQQ01567778.1 5032 HMEAGITQSPRHVITETGEKVTLRCHQTYNHDNMYWYRQDPGQGLQLIHYSYGVGNTAKGDVSDGYSVSRSNKKDFPLTLESATSSQTSVYFCATSE
Ictidomys tridecemlineatus V264 trbv AAQQ01567781.1 1127 LMDGGITQTPKFLLRKEGQGVTLGCEQNSGHDAMYWYRQDPGLGLRLIYFSTVEKDVQQGDLAEGYGASREQKPSFPLSVTSAEEKHTSLYLCASSL
Ictidomys tridecemlineatus V265 trbv AAQQ01567784.1 500 HMEAGITQSPRHVITETGEKVTLRCHQTYNYDYMYWYRQDPGQGLQLIHYSYTVGNTAKGDVSDGYSVSRSNKKDFPLTLESATRSQTSVYFCATSD
Ictidomys tridecemlineatus V266 trbv AAQQ01567785.1 2170 HMEPGVRQAPRHTVTETGQDVALSCDPVAGQASLYWYRQTPGKGLEFLVSFYNKQPAGKADFFRDPFSAERPEGSLSTLKIQPTQLGDSATYLCSSSL
Ictidomys tridecemlineatus V132 trbv AGTP01044882.1 1400 HMEAGITQSPRHVITETGEKVTLRCHQTYNYDYMYWYRQDPGQGLQLIHYSYTVDNTEKGDVSDGYSVSRSNTEDFPLTLESATSSQTSVYFCATSE
Ictidomys tridecemlineatus V133 trbv AGTP01044882.1 9480 LTDVGVTQTPRHVVAQKGQTVTLRCQAILSHNALFWYRQTVVQGLELLIFFRNQAPIDNTGMPKDRFSAAMPSASSSTLKIQPTEPRDSAVYLCASSL
Ictidomys tridecemlineatus V134 trbv AGTP01044883.1 4974 HMEPGVRQSPRHAVTETGQDVALSCDPVAGQASLYWYRQTPGKGLEFLVSFYNKQPAGKADFFRDRFSAERPEGSWSTLKIQPTQLGDSAIYLCSSSL
Ictidomys tridecemlineatus V135 trbv AGTP01044883.1 14138 PTKAGITQSPKSQILKTAQRMTLTCAQDMNHDSMYWYRQDPGLGLRLIHYSHNVRNEEKGEVPDGYTASRSSKENFLLTLESPTPSQTSVYLCATSY
Ictidomys tridecemlineatus V136 trbv AGTP01044883.1 27813 HAHAGVSQSPRHRVTKTGENIALRCDPVPGHISLYWYRQTPGQGLEFLISFQYERAADKSGMRSERFSAERPQGSYSTLEIKLTEPGDSAVYLCASSS
Ictidomys tridecemlineatus V137 trbv AGTP01044883.1 30834 LVDAGITQRPRHLILNTGKKTTLECSQNLNHYSMFWYRQDPGQGLRLLHYSGSVGSTAEGEASQGTSVSRDQKEHFPLTLESPSTSQSSLYLCASSE
Ictidomys tridecemlineatus V138 trbv AGTP01044884.1 8271 HTHAGVSQSPTHRVTKTGQNVTFRCDPIPEHNVLYWYRQTLGQGPEFLVYFQNKIATDKSGMPNERFSAERPQGSFSTLEIQLTVQGDSAVYLCASSL
Ictidomys tridecemlineatus V139 trbv AGTP01044885.1 1875 SVDAEVILSPRHLIRAKGGRGTLKCYPMPGHTSMSWYQQAPGQGPQFLVEYYEKMQRNKGKLPDRFSAQQFDDYHSELNLSSLELGDSAMYLCASS
Ictidomys tridecemlineatus V140 trbv AGTP01044887.1 8089 HTDAGVIQTPRYEVTEKRQAVTLRCEPISGHTHLFWYRQTAGKEPEFLIYFSSRSVVDDKGMPKDRFSAEMPSASSSTLKIQPTEPKDSAVYLCASSS
Ictidomys tridecemlineatus V141 trbv AGTP01044889.1 4195 PTDAGVTQTPRHKVTQKGQTVTLRCEPHSNHDNIFWYRQTMVQGLELLVHFNNKLLMDDSGMPKDRFSAAMPETSFSTMKIQPTEPRDTAVYLCASSL
Ictidomys tridecemlineatus V142 trbv AGTP01044889.1 13643 PVSAMVMQNPRYWITRVGKPVNLSCSQTLNHDIMYWYQQKPSHAPKLLLYFYDNQLNKQTDTSDNFQASRPKTSLCSLDIRSAGLEDSAVYLCASSE
Ictidomys tridecemlineatus V143 trbv AGTP01044889.1 16220 SLGQEVTQTPRHLIKGKGQRVKMFCVPIKGHNYLFWYQQILAKQFKFLVSFQYNKVSDPSGMPKERFSAECTQNSSCSLEIQPTELQDSATYLCASSE
Ictidomys tridecemlineatus V144 trbv AGTP01044897.1 1735 LMDGGITQTPKFLLRKEGQGVTLGCEQNSGHNAMYWYRQDPGLGLRLIYFSTVEKDVQQGDLAEGYGASREQKPSFPLSVTSAEEKHTSLYLCASSL
Ictidomys tridecemlineatus V145 trbv AGTP01044904.1 2032 SGLGAHVSQHPSRAICKSGSSVKIECRFVDFQATTVFWYRQFPKQSFVLMATSNVGSEGIYEQGFDKEKFPTSHPNFTFASLMVTSAHSADSSFYFCGGS
Ictidomys tridecemlineatus V146 trbv AGTP01044908.1 19 SGLGAHVSQHPSRAICESGSSVKIECRFVDFQAQVVFWYHQFPNQTFVRMATSNVGFEATYEQDFDKKKFPISHPNSSFASLMVTSTHSADSSFYFCAGS
Ictidomys tridecemlineatus V147 trbv AGTP01044909.1 4477 SFVAEVIQTPEHLVKTKGQKAKMHCVPTTGHTAVYWYQQKPSKELQFLIYFQNREVLDQIEMVKQRFTVEYPQNSPCSLEIQSSEPGDSALYFCASSP
Ictidomys tridecemlineatus V148 trbv AGTP01044909.1 14481 SMDSGVTQTPRKRITKTGKSTVLECSQTKGHDRMYWYRQDPGQGLRLIYFSIGVNDISQGEVSNGYSASRTEKPKFFLTVETATPNQTALYFCASSP
Ictidomys tridecemlineatus V149 trbv AGTP01044910.1 19286 PLEAQVTQNPRYLIAKTGKTLTLTCSQNMNHDCMYWYRQDPGLGLKLIYLSINVEMLDKGDISDGYVVSRKEKKEFPLTLTSTSINQTSLYLCASSL
Ictidomys tridecemlineatus V150 trbv AGTP01044910.1 23543 LVDTGVTQTPRFLVKRMGEKAVLECLQDMDYERMFWYRQDPGLGLRLIYFSYDADNNDKGDIPEGYSVSRKKREKFSLILESASFTQTALYLCACSR
Ictidomys tridecemlineatus V151 trbv AGTP01044910.1 28910 FVSSVLLYQKPSRSICQHGTSVTIQCQVDSQVSLMFWYRQPPGQGLMLIATANQGSEATYESGFDKDKFPISRPNLTFSTLAVNNVSPKDSSLYLCSAG
Ictidomys tridecemlineatus V283 igkv AGTP01098978.1 15711 VKRDITMTQSPSSLFVSRGGRATITCRVSEDIYGNLNWYQQKPGQPPKLLIYGTFNLQPGVASRFSGSGSETDYSLTISSLKPEDVGTYYCLQGSSYP
Ictidomys tridecemlineatus V284 igkv AGTP01098980.1 5489 ARCDIMMTQSPSSLSASSGDRVTITCRTSQSINSWLAWNQQKPGQAPKLMLYKASNLQSGVPSRFIGRGSGTDYSLTISNLEPEDASTYYCLQGSIW
Ictidomys tridecemlineatus V285 igkv AGTP01098982.1 12901 TTGEIVLTQTPASVALSPGERVTLTCKTSQSVGSYLAWYQQKPGQAPRCLIYGASSRASGIPARFSGSASGTDYTLSISSLEPEDAAVYYCVQ
Ictidomys tridecemlineatus V286 igkv AGTP01098983.1 5155 AKCDIMMTQSPSSFSVSPRGRVTITCRASEDIYDNLNWYQQKPGQPPKLLIYGESNLQPGVPSRFSGSGSETDYSLTVSILEPEDAGTYYCQQSWDYP
Ictidomys tridecemlineatus V287 igkv AGTP01098987.1 528 IQITQSPSSLSKSVGDKVTITCQVSQGISNNFHWYQKKPGQTPKLLIHWATSMGYGVPSRFSGSRYGKDFTLIIRSLEPEDVATYYCVQDNSAP
Ictidomys tridecemlineatus V288 igkv AGTP01098987.1 40676 VKMGTALTQSPALLAVYPGERATITCTTNPKENSKFSWYQQKPGQAPKLLVHGTSTLASGVPARFSGSHLGADFTLTISNVETNDAGTYYCIEWPG
Ictidomys tridecemlineatus V289 igkv AGTP01098987.1 66916 VRCDITMTQSPPSLPLFLRDRVTLTCRASQGISNNLHWYQQKPGQAPKLLIKYANTLKSGIPSRFSGSGSGTDFTLTSSSLEPEDVANYYCIQDNSSP
Ictidomys tridecemlineatus V290 igkv AGTP01098989.1 1635 ARCDITMTQSISSLSKSLGESVTIMCQANQFISNYLNWYQHKPGQFPKRLIYGAFSLQSWVPLRISGSGSGTDFTIISSSLEPEDAATYFCLQDTVPL
Ictidomys tridecemlineatus V291 igkv AGTP01098990.1 588 IQMTQSPSSLSKSVGDKVTITCQVSQGISNNFHWYQKKLEQAPKLLIYMASSMGYGVSKRFSGSGYGKDFTLTIRSLEPEDVATYYCVQDNSAP
Ictidomys tridecemlineatus V292 igkv AGTP01098990.1 72728 VRFDIMITQSPSSLRVSCEHRDTLTCRASQSISSNLLWYQQKPGQAPKLLIRYANALESWIPSRFSGSGYGTDFTLTISSLEPEDDADYYCLQNYSSP
Ictidomys tridecemlineatus V293 igkv AGTP01098997.1 555 IRCDIKMTQSPSSLPVSRGDRVIITCRASQDIGSYLNWYQQKPGQAPKVLIYVANSLQSRVPLRFSGSGCGTDFTLTISSLEPEDVTTYYCQQYNSL
Ictidomys tridecemlineatus V294 igkv AGTP01099002.1 19608 IRCDIQMTQTSSTLSVSQGDRVTITCQASENIYRYVSWYQQKQEQAPKQLIYAASNLQSGVPSRFSGSGSGKDYSLTISDLEPDDIATYYCLQTTSF
Ictidomys tridecemlineatus V295 igkv AGTP01099002.1 81072 VKCDITMTQSSSSLSVSPGGRVTITCRASEDIYDNLNWYQQKPGKPPKLLIYDASNLQPGVPSRFSGSGSGTDYYFTINSLEPEDAATYFCQQGSSSP
Ictidomys tridecemlineatus V297 igkv AGTP01099002.1 114277 VRCDITMTQSPSSLPLSHGDRVTINCKASQDIGGYLHWYQQKLGQAPKLLIRHATSLQSGVPSRFSGIGSGTDFTLTISSLEPEDAATYFCQQGYSFP
Ictidomys tridecemlineatus V298 igkv AGTP01099002.1 159636 SIVSSGKIVLMQSPGSLAASQGERVTMTCTASSSISTSYLHWYQQKPGSSPCLLIYRTSTLASGVPERFSGSRSGTSYTLTISNMEAEDVATYYCKYWGSS
Ictidomys tridecemlineatus V299 igkv AGTP01099009.1 5118 AKCDITMTQSPISLSKCQGETVTISCQASEGIGNELSWYQQKTGKAPKLLIYYANRLQFGVPLSFSGSGSGTEYSLTISSLDPEDLGTYYCQQYDECP
Ictidomys tridecemlineatus V300 igkv AGTP01099011.1 2317 YKCDIIMTQSQTSLSKSQGETVTIRCQASQGISNYLSWYQQKPGQAPKPLIYYTNSLQSGVLWRFSGSGSGTDYSLTITSLEPKDVADYFCVQSYSSP
Ictidomys tridecemlineatus V301 igkv AGTP01099012.1 5180 DKCDITMTKSPTSLSKSQGETVTIRCQASQGISNYLSWYQQNPGQAPKLLIYYNNSLQSGVPLRFSGSVSGTDYSLTISTLEPEDAATYFCQQHYSY
Ictidomys tridecemlineatus V302 igkv AGTP01099014.1 5450 ARCDIQMTQSSSSVSKSVGDRVTITCWVSQNIKNYLHWYQQKPGQAPKLLIHWATSMGYGVSSRFSGSGYGKNFTLTISSLEPEDVATYYCLQGYSSP
Ictidomys tridecemlineatus V303 igkv AGTP01099018.1 5986 LGVRCDITMTQSPFSLSASQEDRVTITCRDSQGISNYLHWHQQKPGQAHKLLIRYANTFQSGVPSRFSGSGSGTDFTLTISSLEPEDVADYYCQQSNSYP
Ictidomys tridecemlineatus V304 igkv AGTP01099018.1 51312 SRCDVQMTQSPSSLSASQGNRVSLTCRASQGISNNLHWYQHKPGQAPKLLIRYTNTLQSGVPSRFSGSGSGTDFTLTISSLEPEDVSIYFCQ
Ictidomys tridecemlineatus V305 igkv AGTP01099019.1 11199 SSGEIVLTQSPGSLAASQGERVTMTCTTSSSVSTSNLHWYQQKPGASPRLLIYRTSTPASGVSARFSGSGSGTSYSLTISSIEAEDATTYYCQQWDSS
Ictidomys tridecemlineatus V306 igkv AGTP01099024.1 15920 SRCDIQMTQSPSSLSASQGERVSLTCKASEGISNYLHWYQQKPGQAPKLLINNANTLQSGVPSRFSGSGSETDFTLTISSLEPEDGATYFCQQGYSYP
Ictidomys tridecemlineatus V307 igkv AGTP01099027.1 12217 SNGDIVLTQSPLSLSVTPVQPASISCRSTQSLLHSDGKKYLKWHQQKPGQAPKLLIYKVPSRFTGVPDRFIGSGSGTEFTQRISRVEAEDAGVYYCFQGKVYP
Ictidomys tridecemlineatus V308 igkv AGTP01099027.1 23324 VRCEITMIQSSSSLSVSRGDRVKITCRSSEDISSYLNWYQQKPGQAPKLLIYGTNSLESGVPSRFSGSGSGTDYTLTISSLEPEDVATYFCQQGWSSP
Ictidomys tridecemlineatus V309 igkv AGTP01099029.1 23906 SSGNTVMTQSRLSLSITAGQPASISCRSSQSLLHSDGNTYSRWVVHKPSQSPQSLIYKVPNRYTGVPDRFSGSGSGTDFTLRISRVEAEDAGVYYCLQ
Ictidomys tridecemlineatus V310 igkv AGTP01099029.1 68450 VRCDITMTQSPSSLPVSPGDRVTITCRASEDIYDSLHWYQQRPGKAPKLLIYGASNLQPGVPSRFSGSGSGTDYTLTISSLEPEDVANYHCLQTNSFP
Ictidomys tridecemlineatus V311 igkv AGTP01099032.1 4178 VRCDIQMTQPTSSLSASQGDRVTITCRASQSIGINLAWYQQKPGQAPKLLIYHANSLESGVPSRFSGSGSGTDFTLTFSSLEPEDAATYYCQQYYNSP
Ictidomys tridecemlineatus V312 igkv AGTP01099033.1 32453 VRCDITMTQSPSSLSVSRGDRVKITCRASQNINSWLAWYQQKPGQAPKLLINGASNLQPGVPSRFSGSGSGTDYYLTINSLEPEDVGTYYCQQSWDYP
Ictidomys tridecemlineatus V313 igkv AGTP01099034.1 11673 ARCDNTMTQYPTSMSASPGDRVTITCRASQNINSWLAWHQQKPGQAPKLLIYKAYNLQSGVLSSFSGSGSGTDYSLTTSSLESEDIATYYCQQDSSLP
Ictidomys tridecemlineatus V314 igkv AGTP01099035.1 33406 PRCDITMTQSPYFMSKSHGDSFTITCQASESIGTSLHWYQHKPGQAPRLMINYATSLESGVPSRISGTGSWTDFTLTISSLEPEDAATYYCQQSWDSL
Ictidomys tridecemlineatus V316 trdv AGTP01099421.1 56531 KGMLCNQVTQNSEDQTVLSGRELMLLCTYDVSFSNPDLYWYRKRPEGSFQFILYKDNTRSKYADFAQGRFFVKHNPTQKTFHLVVSRVSLEDSATYYCAVN
Ictidomys tridecemlineatus V335 iglv AGTP01103550.1 7781 SLAEVVFTQPQHVSGSLGQKVTISCTRSSGDIGNNYVYWYQQHLGSPPTLLIYNYNQRPSGIPDRFSGSKDSSSNSASLTITGLQPEDEADYHCLSGYGNYY
Ictidomys tridecemlineatus V336 iglv AGTP01103555.1 19742 SWAQFELTQPHSVSASPGKTVTISCARSSGNIGSNYVHWYQQRQGNAPSTVIYADDQRPSGVPDRFSGSIDSSSNTASLSISDLQIEDEADYYCQSYGSNY
Ictidomys tridecemlineatus V359 iglv AGTP01114381.1 15568 SWAQSVLTQQPSLSGTPGQRVTISCTGSSNNIGSYNVHWYQQLPEKVPKLLIYHNSNRPSGVPDRFSGSKSGNSASLTITGLQPEDEADYYCQSHDNSLG
Ictidomys tridecemlineatus V360 iglv AGTP01114387.1 2561 SWAQSVLTQPPSVSGTPGATVTISCKGSSNNIGSNYVHWYQQLQEKAPQLLIYDNSDRPSGVPDRFSGSKSGNSASLTITGLQPDDEAIYHCQSYDDSLSA
Ictidomys tridecemlineatus V361 iglv AGTP01114390.1 11265 VDPQNMVTQEPSLSVSSNGTVTLTCGLSSGSVSTGYYPKWCQQMPGHAPYTIIYNTNTRPSGVPDRFSGSILGNKAALTITGAQIDDEADYYCALFMGSG
Ictidomys tridecemlineatus V362 iglv AGTP01114391.1 8909 SQVHSELIQESSMSASKGEKVTLSCTGNSNNVGTYYTGWYQQILGSAPKTVMLGTTRPSGISDRFSGSHSGNTATLTITGLQEEDEANYYCEAWDKSLN
Ictidomys tridecemlineatus V363 iglv AGTP01114393.1 21710 VVTQETSLPTTPGGTVTLTCGSSTGAITTSNYAGWVQQKPYQVPQGLIGSTSNRFPGVPASYSGSLLGDKASLTIMGTQTEDEATYYCALWFSNH
Ictidomys tridecemlineatus V364 iglv AGTP01114396.1 6368 SQAQSKLIQESSMSASKGEKVSLSCVGNSNNVGTYYAGWYQQILGSAPKTVMLGTTRPSGIPDRFSGSHSGNTATLTITGLQVEDEANYYCSTWDSSLS
Ictidomys tridecemlineatus V365 iglv AGTP01114400.1 15432 STSQAVVTQETSLTTTPGGTVTLTCGSSTGAVTTSNYASWVQQKPYQVPQGVIGGTSNRVPGVPARFSGSLLGDKAALTITGAQTEDEATYYCVLWFSNH
Ictidomys tridecemlineatus V366 iglv AGTP01114401.1 7451 SLSQPVLTQPPSASASLGQTAKLTCTLSSGYNSYAVNWYQQSPGKSPRFVMRVGISGIVGSKGDGIPDRFSGSDSGLDRYLTIQNIQEEDENVYYCGAGYGSD
Ictidomys tridecemlineatus V367 iglv AGTP01114401.1 12357 CADSAALSLCIPGASARLTCSLSSGFGVDNYLISWYQQKPENPPHYLLSYYSDSYPVKDKGSEVPNHFSGSKDASTNAGILLISELQPEDEADYYCA
Ictidomys tridecemlineatus V368 iglv AGTP01114402.1 28594 SLSQLVLTQPPSASAPLGQTVKLTCTLSSGYNSYWVAWYQQSPGKSPRFVMRVGTSGIVGSKGDGIPDRFSGSGSGLDRYLTIQSIQEEDENVYYCGTDY
Ictidomys tridecemlineatus V369 iglv AGTP01114412.1 9679 FWSQSALTQPPSVFGTPGQSVTISCAGTSSDIGRFNDVSWYQNHPETTHKLMIHSVSSRPSAIPNHFSGSKTGNTVSLTISGLQLEDETDYYCCS
Ictidomys tridecemlineatus V370 iglv AGTP01114414.1 5641 SMASYVLTQPPSVSVTPGQTAIITCSGDKLSEKYIHWYQQKSAQSPVLVIYEDSERPSGIPDRFSGSSSGNTATLTISRVQAEDEADYYCQSWDSNAE
Ictidomys tridecemlineatus V371 iglv AGTP01114416.1 10922 SWSQSALTQPPSASGSAGQTVTISCTGTSNDIGKYNYVSWYQNLPGSSPTLLIYRVTNRPSGIPDRFSGSKSGNTASLTISRLQPEDEADYYCCSYTSS
Ictidomys tridecemlineatus V372 iglv AGTP01114417.1 4437 FWAQSALTQPPSVSGTPGQAVTISCAGTSSDIGQYNYVSWYQHRPGTTHKLMIYDVSSRPSGIPARFSGSKSGTTASLTISGLQLEDEADYYCCSYAGNNN
Ictidomys tridecemlineatus V373 iglv AGTP01114418.1 4643 SVASYVLTQPSSVSVTPGQTARITCGGNNIGSKYVQWYQQKPAQSPLLVIYGTSNRPSGIPDRFSGSKSGNTATLTVSGAQSGDEADYYCQVWDGNA
Ictidomys tridecemlineatus V377 igkv AGTP01116850.1 509 TSGDVVLTQTPLSEPVTPGQSVSLSCRSSQSLLDSNGYTYLSWVVHKPGQAPKGLIYWISNRVSGVSDRFSGSGSGTEFTLRISRVEPEDAGVYYCWQG
Ictidomys tridecemlineatus V378 igkv AGTP01116867.1 7651 TSGDVVMTQTPLSDLITPGQSASISCRSSESLLHSDEKTDLHWIVQKPGQAPQVLIYGVSNRFTGVSDRLSVIGSRTDFTLRIIRVEPDDAGLYYCVQSLHIP
Ictidomys tridecemlineatus V379 igkv AGTP01116877.1 32126 VRGDITMTQSPSSLPVSPGDRVTINCKASQGIGSNLQWYQQKPGQPPKLLIYWATRLQSGVPSRFSGSGSGTDFTFTISSLEPEDGATYYCQQGYSYP
Ictidomys tridecemlineatus V382 iglv AGTP01117695.1 1896 SWAQFELTQPHSVSASPGKTVTISCARSSGNIGDYYVHWYQQRRGSAPSTVIYADDQRPSGVPDRFSGSIDSSSNTASLSISGLQIEDEADYFCQSYDGNY
Ictidomys tridecemlineatus V383 iglv AGTP01117695.1 20350 VDSQTTVIQEPSLSVSPGGTVKLTCGLSSGSVSTGHYPGWYQQNPGLAPRQLIYNTNNRPSGVPDRFSGSILGNKAALTITGAQTDDEADYYCSLYMGSG
Ictidomys tridecemlineatus V384 iglv AGTP01117695.1 34101 VDCQTTVIQEPSLSVSPGGTVRITCGLSSGSVSTGYYPGWYQQNPGLAPRPLIYNTNNRPSGVPDRFSGSILGNKAALTITGALTDDEAVYYCSLYMGNGI
Ictidomys tridecemlineatus V385 iglv AGTP01117696.1 6992 SWAQSVLTQQPSLSGTPGQTITISCTGSSNNIGGYYVQWYQKIPETAPKLIIYDYSKQNSGVSDRFSGSNSGNSASLTITGLQPEDEADYYCQAYDSSLDA
Ictidomys tridecemlineatus V386 iglv AGTP01117701.1 18976 SWAHSVLTQPPSLSGTPGERVTISCTGNSNNIGGNYVHWYQQLPETAPKLFIYGNSNRHSGVPDRFSGSKSGNSASLTITGLQPEDEAVYYCQSYDDSLDV
Ictidomys tridecemlineatus V387 iglv AGTP01117701.1 39694 SWVQSVLIQQPSLSGASEQSVTISCTGSSNNIGDNFVHWYQQLSGTAPKLIIYDDNDRPSGVPDRFSGSRSGNSALLTITGLQPEDEAVYHCQSYDDSLNT
Ictidomys tridecemlineatus V388 iglv AGTP01117702.1 5174 TWAQSVLTQQPSLSGTPGQTVTISCTGSSNNIGYSFVNWYQQFPATSPKLLIYGDSNRPSGVPDRFSGSKSGNSGSLTITGLQPDDEADYFCQSYDSSLNA
Ictidomys tridecemlineatus V389 iglv AGTP01117702.1 30077 SWAQSVLTQQPSLSGTPGQTITISCTGSSTNIGTYIVNWYQQFPQTAPKLLIYGDSNRPSGVSDRFSGSKSGNSASLIITGLQPEDEADYYCQSYDRSLDA
Ictidomys tridecemlineatus V390 iglv AGTP01117705.1 15513 SWAQSVLTQQPSLSGNPGQTVTISCSGNNNNIGIFGVSWYQQLPETAPKLLIYGDSNRHSGVSDRFSGSRSGNSGSLTITRLQPEDEADYFCQSYDSSLRS
Ictidomys tridecemlineatus V391 iglv AGTP01117712.1 942 SWAQSVLTQQPSMSGTPGATVTISCIGSSTNIGNGNSVQWYQQLPETAPKLLIYGSSNRPSGVPDRFSGSRSGNSGSLTITRLQPEDEADYYCQSYDSSLS
Ictidomys tridecemlineatus V392 iglv AGTP01117716.1 13331 SWAQSVLTQQPSLSGTPGQRVTISCTGSSTNIGTYSVNWYQQFPETAPKLLIYGNSNRPSGVSDRFSGSKTGNSASLTITGLQPEDEGIYYCQSPDSSFGY
Ictidomys tridecemlineatus V393 iglv AGTP01117719.1 11620 SWAQSVLTQQPSLSGTLGETVTISCTGSRNNIGIFGVSWYQQLPEMAPKLLIYINSNRPSGIPDRFSGSRSGNSGSLTITRLQPEDEADYFCQSYDSSLSS
Ictidomys tridecemlineatus V394 iglv AGTP01117725.1 4333 QSVLTQQPSLSGTPGETVTISCKGSSTNIGRYGVNWYQQIPENAPKLLIYDNSNRPSGVPDRFSGSRSGNSGSLIITNVRPEDEGDYFCHSYDSSLSS
Ictidomys tridecemlineatus V395 iglv AGTP01117734.1 443 SWAQSVLTQQPSLSGTPGQRVTISCTGSSNNIGGGYYVSWYQQFPETAPKLLIYGNSNRPSGVPDRFSGSKSGNSASLTITGLQPEDEAVYYCQSYDKSLKA
Ictidomys tridecemlineatus V396 igkv AGTP01117789.1 1906 SGARCDITMTQSPSSLPVSRGDRVTITCRASQNNNNWLAWYQQKQGKAPKPLIYRASSLQPGVPLRFSGSGSGTDITLTISSLEPEDVATYFCQQGYLP
Ictidomys tridecemlineatus V397 igkv AGTP01117795.1 28169 VRCDIMMTQSPSSLPVSHGDRVTLTCRASEGISSYLNWYQQKPGQAPKLLIKYANILESGVPSRFSGSGSGTDFTLTISSVEPEDVADYYCQQSNSYP
Ictidomys tridecemlineatus V398 igkv AGTP01117796.1 2624 ARCNIMMTQSPSSLSASPGDRVTITCGASQNINSWLAWYQQIPGQAPKLLIYKASNLQSGIPSRFSGSGSGADYTFTISSMDPEDVATYYCQQHNSYP
Ictidomys tridecemlineatus V399 igkv AGTP01117797.1 13307 SSGDTVMTQTPLSLSVIHGESTSISCRSSQSLLHNDGNTYLSWYQQKPGQAPKILIYEVSKRFSGVSDRFSGSGSETKFTLRISRMEAEDTGVYYCLQGTWIP
Ictidomys tridecemlineatus V400 igkv AGTP01117811.1 5679 AKCDITMTQSPTSLSKSQGETVTIRCQASQGISNYLNWYQQKPGQAPKLLIYYTNSLQSGVPSRFSGSGSGTDYSLTISSLEPEDFATYYCQQGISFP
Ictidomys tridecemlineatus V401 igkv AGTP01117813.1 1563 VRCDFTMTQPPFFLSKSPGKRVTITCKASQGISNYLNWYQQKPGQAPKHLIYDASSLQSGVSTRFSGRGSVTDFTITISSLEPEDFATYYCLQYDEFP
Ictidomys tridecemlineatus V402 igkv AGTP01117813.1 7268 AICDIQMTQSSSSLSKSVGDRVTITCRASQDIKNSLHWYQQKPGQAPKLLIHWATSMGYGVSSRFSGSGYGKDFTLTISSLEPEDVATYYCLQG
Ictidomys tridecemlineatus V403 igkv AGTP01117818.1 250 VRCDITMTQAPSSLPVSLGDRVTLTCRTSQGIRSNLHWYQQKPGQAPKLLIYGANNLQSGVPWRFSGSGSGTHFTLTISSLEPEDVATYYCQQRKSSP
Ictidomys tridecemlineatus V404 igkv AGTP01117824.1 30659 VRCDIMMTQSPSSLPVSLGDRVTITCRASEGISNDLHWYQQKPGQAPKLLIIYASTLQSGVPSRFSGSESGTDFTLTISSLESEDVADYYCQQSNSYP
Ictidomys tridecemlineatus V405 igkv AGTP01117824.1 38111 VRCDITITQSPSPLSASQGERLTINCRASQGISNSLHWHPQKPVQAPKLLITYSSTLHSGVPLRFCGSGSGTDFTLTISSLEHEDVADYYCKQSNSSP
Ictidomys tridecemlineatus V407 igkv AGTP01118332.1 3892 AKCDITMTQSPASLSKSQGETITIRCQTSQGISNYLSWYQQKPGQAPKLLIYYTNRLQSGVPSRFSGSGSGTDYSLTISSLEPEDVATYFCQQGYLP
Ictidomys tridecemlineatus V408 igkv AGTP01118340.1 29518 AKCDITMTQSPSSLSKSQGETITISCQASQSISSYLNWYQQKPGQAPKLLIYYTSRLQSGVPSRFSGSGSGSDYSLTISSLESEDFATYFCQQYYRYP
Ictidomys tridecemlineatus V409 igkv AGTP01118343.1 3906 ARCDITMTQSPASLSKSQGETVTIRCQVSQGISNYLSWYQQKPGQAPKLLIYYTNQLQSGVPSRFSGSGSGTDYSLTISSLEPEGVADYYCV
Ictidomys tridecemlineatus V410 igkv AGTP01118344.1 9193 AKCDIIITRYPASLSKSQGETVTIRCQASQGIGNELSWYQQKPGQALKLLVYGANHLHSGVPSRFSGSGSGTDYSLTISSLEPEDFATYYCLRDYSYP
Ictidomys tridecemlineatus V411 igkv AGTP01118348.1 4294 AKCDITMTQSPTSLSKSHGETVTISCQASQGSINYLNWYQQEPGQGPKLLIYYTNCLQSGVPLRFSGSGSGTDYSLSISSLEPEDFATYFCQQDYSSP
Ictidomys tridecemlineatus V412 igkv AGTP01118360.1 5058 AKCDITMTQSPTSLSKSQGETVTISCQASEGIINYLSWYHQKPGQAPKLLIYYTSRLQSGVPSRLSGSGSGTDYSLTINSLEPEDFAPYYCQQHSSSP
Ictidomys tridecemlineatus V413 trbv AGTP01119763.1 35840 HMESGVVQIPSHQVTKMGQMVILRCDPIFGHSFFYWFQQILEQRLEFLVSFYNGKTLEKSEILKDRFSVEKPDKSYFTLKIHLTKLEDSAMYLCASSL
Ictidomys tridecemlineatus V414 trbv AGTP01119767.1 3536 NAGITQTPKYQILKVGQPVTLRCAQDMNYGSMYWYRQDPGLGLRLVHYSHKIDNMEKGEVPEGYSVSRSRKEDFPLTLPSATYSQTSVYICASS
Ictidomys tridecemlineatus V415 trbv AGTP01119770.1 229 SVDAEVTLSPRHLIRAKGGRGTLKCYPMSGHTSVSWYQQAPGQGPQFLVEYFDKLQRNKGNLPDRFSAQQFDDYHSEMNMSSLEPGDSATYLCASS
Ictidomys tridecemlineatus V416 trbv AGTP01119771.1 27 HMEARITQSPRHVITETGEKVTLRCQQTYNYDNMYWYRQDPGQGLQLIHYSYGVDNTENGDVSDGYSVSRPNKTDFPLTLESATRSQTSVYFCATSD
Ictidomys tridecemlineatus V417 trbv AGTP01119772.1 3716 NAGIVQTPKYQILKVGRPVTLRCAQDMNHGSMYWYRQDPGLGLRLLHYSHNIDNMEKGEVPEGCSVSRSRKEDFPLTLPSATYSQTSVYLCASS
Ictidomys tridecemlineatus V418 trbv AGTP01119783.1 2139 HMEAGITQSPRHVITETGEKVTLRCHQTYNHDNMYWYRQDPGQGLQLIHYSYGVGNTAKGDVSDGYSVSRSNKKDFPLTLESATSSQTSVYFCATSE
Ictidomys tridecemlineatus V419 trbv AGTP01119783.1 10865 HMESGVIQIPSHQVTKMGQMVILRCDPISGHSFFYWYQQILEQRLEFLVSFYNGKTLEKSEILKDRFSVEKPDKSYFTLKIHLTKLEDSALYLCASSL
Ictidomys tridecemlineatus V420 trbv AGTP01119784.1 1361 PLHSGVSQNPKYLLAQAGKKQSFKCEQNLGHDTMYWYKQDSKQSLKMMFHYYNKEMIANETVSGRFSPESPDKDHLNLHVNSLEPEDSALYLCASSQ
Ictidomys tridecemlineatus V422 igkv AGTP01120444.1 588 VRCDIMMTQSPSSLPVSHGDRVNITCRASQNINSWLAWFQQKPGQAPKLLIYSASNLQPGVPSRFSGSGSGTDYSLTISSLEPEDVANYYCVQGWSFP
Ictidomys tridecemlineatus V424 igkv AGTP01120502.1 8021 TSEDIVMTQTPVSEPVTPGQSVFLSCRSSQSLLHSDGKTYLSWVVHKPGQALQGLIYLASNHVSGVPERFSGSGSGKGFTLRISRVEPEDVGVYYCWQG
Ictidomys tridecemlineatus V425 igkv AGTP01120503.1 339 SIGDVVLMQSTLLEPVTPGQPASISCRSSQSLLDSNGITYLHWVVHKPGQSPEGLIYQVSNQYTGVPDRFSGSGSGTDFTLRISRVEPEDAGVYYCLQS
Ictidomys tridecemlineatus V426 igkv AGTP01120505.1 4354 SSGDIVMTQTPFSETLTTGQSASISCRSSQSLLHSNGITYFYWFVHKPGQAPKHLIYQVFNWNTGVSDKFSGSRSGTDFTLRISRVEAKNSGVYYCWQL
Ictidomys tridecemlineatus V427 igkv AGTP01120518.1 1908 IRENVVMTQTFSELVKPGQPASISCRSSQSLLNSKGNTYMNWIVHKPGQAAQGLIYKVSHQFPGVPEGFSGSESGTDFTMRISRVEPEDAGVYYCYQG
Ictidomys tridecemlineatus V428 igkv AGTP01120520.1 239 TSGDIVMTHTPLSEPIIPGQPASISCRSSQSLLHSNRNTYLSWVVHKPGQAPQGLIYKVSKLFTWVSDRFSGRGTGTNFTLRISRVEAEDAGVVYYCMQH
Ictidomys tridecemlineatus V429 igkv AGTP01120520.1 5800 TSGDIVMTQNPLSKPLTPGQSVSLSCRSSHSLLDSGGNNYLRWVAHKPGQAPQGLIYEISNRFTGVSDRFSGSGSGTDFTLRISRVEPADTGIYYCLQCLQAP
Ictidomys tridecemlineatus V431 igkv AGTP01120528.1 2537 TNGDIVMTQIPVSEPVTPRQSASISCRSSQSLLHCNGNTYLHWVVHKPGQAPQGLIYFVSNRCTGVPDRFSGSGTGTDFTLRISRVEPEDAGVYYCYQGIQVP
Ictidomys tridecemlineatus V433 igkv AGTP01121036.1 5389 AKFDITMTQSSTFLSKSQGETVTIRCQASQGIGNELSWYQQKPGQAPKLLIYYTNCLKSGVPLRFSDSGSGTEYSLTISSLKPEGFATYYCQHYNECP
Ictidomys tridecemlineatus V435 igkv AGTP01121055.1 2900 TKCDIMMTQYPSSLCTSQGETVTISCQASQGISNYLNWYQQKPGQAPKLLIYYNNSLLSGVPLRFSGSRSGTDYSLTISSLEPEDVATYFCLQNDDLP
Ictidomys tridecemlineatus V438 igkv AGTP01123846.1 1630 VRCDITMTQSPSYLSKSPGERVTITCRASQGISSYLNWYQQKPGQSPKRLIYGASNLQSGVPSRFSGSVSGTDFTLTISSLEPEDFATYYCLQYDKLP
Ictidomys tridecemlineatus V439 igkv AGTP01123849.1 2663 FRCDITMIQSPSSLHVSHGDRVTITCRANQHISNRLHWYQQKPGQAPKLLIYGANTLQPGVPLRFSGSGYGLDFTLTISSLEPEDVVIYYCQQGSCSP
Ictidomys tridecemlineatus V440 igkv AGTP01123854.1 1305 VRCDITMTQSPSSLPVSRGDRVKITCRASEDISSYLNWYQKKPLQAPKLLIYRANSLESGVPSRFTGSGSGTDYTLSSSSLEPEDVADYFCLQYDSYP
Ictidomys tridecemlineatus V441 igkv AGTP01124281.1 4127 TSGDIVMTQTPLSQPITPGQSVSFSCRSSQSLLYSNGNTYLYWVVHKPGQAPQGLIYLVSNRYTGVPDRFSGSGSGTDFTLKISRVESEDAGIYYCYQAKEYP
Ictidomys tridecemlineatus V442 igkv AGTP01124281.1 9771 SSGNIVVTQSPLSEPVTSGQPLSISCRSSQSLLHSNGITYLNWVVQKPGQSPQGLIYQASNRYTGVSDRFSGSGSGTDFTLRISRVEPDDAGVYYCVQSLHVP
Ictidomys tridecemlineatus V443 ighv AGTP01124549.1 1063 VQCEVQLVESGGGLVQPGGSLRLSCAASGFTFSDYWMQWVRHAPGKGLEWVGEINHNGGTTNYVESVKGRFTISRENSKNLLYLQMSSLRAEDTATYYCAR
Ictidomys tridecemlineatus V444 ighv AGTP01124552.1 3490 AAGTESGGGLVQPGGSLQLSCAASGFTFSDYYMEWVHQAPGKGLEWVGHIRNKANSYSTAYAASVKDRFTISREDAKNTLYLQMSSLRTEDTATYYCTR
Ictidomys tridecemlineatus V446 igkv AGTP01125196.1 1940 SSGDTVMTQSSLSLSITAGQPASISCRSSQSLLHSDGNIYLRWVVHKPGQSPQSLIYKVSNRYTGVPDRFSGSGSGTGFTLRISRVEAENAGVYYCLQ
Ictidomys tridecemlineatus V447 igkv AGTP01125198.1 3977 VRCDITMTQSPSSLPVSRGDRATLTCRASQGIGSNLNWYQQKPGQAPKLLIYLSTSLQPGITSRFSGSGSGTDITLTISSLEPEDFATYYCQQDSSYP
Ictidomys tridecemlineatus V448 igkv AGTP01125198.1 35297 VRCDITMTQSPSSLPVSRGDRVTITCKASQHISNSLHWYQQKPGQAPKLLIRYANTLESGVPSRFSGSGYGTDFTLTIISLEPEDAATYHCQQSSFYP
Ictidomys tridecemlineatus V449 igkv AGTP01125200.1 5342 VKCDITITQSSSSLPVSCGDRVTIVCRASQGISSYLNWYQQKPRKSPKLLICGANSLQSGVPSRFSGSGSRTNFTLTISSLESEDVATYYCQQYKVTL
Ictidomys tridecemlineatus V450 iglv AGTP01125512.1 3884 SVSSYVLTQPSSVSVTPGQTARITCGGNNIGSKSVHWYQQKPAHSPLLIIYEDSKRPSGIPDRFSGSNSGNTATLTISGAQDGDEADYYCQVGYSNA
Ictidomys tridecemlineatus V451 iglv AGTP01125521.1 24725 SVVSYELIQPPSVSVAPGQTATITCSGDALPKIYAYWFQQKHPGQSPLRLIYKDSERPSGIPERFSGSSSGTTATLTITRTQTEDEAVYYCLSSYDDSGN
Ictidomys tridecemlineatus V452 igkv AGTP01125551.1 907 VRCDITMTQSPSSLPVSSGDRVTITCIASEDVSSYLHWYQQKQGQAPKLLIRYANTLESGVPSRFSGSGSGTEFTLTINSLEPEDVATYYCQQGSSYP
Ictidomys tridecemlineatus V453 igkv AGTP01126047.1 2114 TSGDIVMTQTPLSEPVTPEKSASISCRSSQSLLHSDGKTYLSWVMHKPGQAPQGLIYLASNHVSGVPERFSGSGSGTDFTLRISRVEPEDAGVYYCWQG
Ictidomys tridecemlineatus V454 igkv AGTP01126048.1 8790 STGDVVLTQSPLSEPVTPGQPASISCRSSQSLLHSNGNTYLHWVVHKPGHAPQGLIYQVSKWYTGVPDRFSGSESGTDFTLRISRVEPDDAGIYYCVQSLHIP
Ictidomys tridecemlineatus V455 igkv AGTP01126049.1 3836 TSGDVVMTQTPLSEPIMPGQSASISCKSSQSLLNSKGNTFLNWVVHKPGQAPQGLIYKISNRYTGVPDRFSGSGSGTDFTLRISRVEPEDAGVYYCWQGSYVP
Ictidomys tridecemlineatus V456 igkv AGTP01126050.1 433 STGDIVLTQTPLSEPITPGQSASISCRASQSLLHSDGKTYLSWVVHKPGQAPKLLIYQVSNRGTGVPDRFSGSGSGTDFTLTISRVETEDAGVYYCVQG
Ictidomys tridecemlineatus V458 igkv AGTP01129040.1 3969 VRCDITMTQTLSSLPVSRGDRVTLTCRASQGIGSNLNWYQQKPGQAPKLLIYLSTSLQPGITLRFSGSGSGTDFTLTISSLEPEDFATYYCQQDSSSP
Ictidomys tridecemlineatus V462 iglv AGTP01130203.1 8686 SWAQSVLTQQPSLSGTPGQRMTISCTGSSNNIDINYVNWYQQHHKKTPKLLIYDNSNRPSGVLDRFSGCKSENSGSLTITGLQPEDEADYYCQSFDNSLD
Ictidomys tridecemlineatus V463 iglv AGTP01130205.1 3992 SWAQSVLTQQPSLSGTPGQRVTISCTGSSNNIGRYDVQWYQQIQEMAPKLLIYDDSNRYSGIPDRFSGSKSGNSASLTITGLQPEDEAVYYCQSYDNSFDA
Ictidomys tridecemlineatus V464 igkv AGTP01132370.1 1709 SRCEIQMTQSPSSLSASQGDRVSLTCRASQGISNNLHWYQQKPGQAPKLLIRHENTLQSGILSRFSGSGSGTDFTLTISSLEPEDVAIYFCQQSSSYP
Ictidomys tridecemlineatus V465 ighv AGTP01134246.1 5745 VQCEVQLVESGGGLVQPGGSLRLSCAASGFTFSSYWMSWVRQAPGKGLEWVGQINPSGGSTYYPDSVKGRFTISRDNSKNTLYLQMSSLRIEDTATYYCAR
Ictidomys tridecemlineatus V466 igkv AGTP01135752.1 1515 SSGDIVMTQTPLSEPVTPGKPVSISCRSSQSLLHSNGNTYLNWVVHKPGQAPQSLIYKVSNRYTGVPHRFSGSGSGTDFTLRISRVEPEDTGMYFCVQSLQTP
Ictidomys tridecemlineatus V467 iglv AGTP01136448.1 3729 SQAQSKLIQESSLSASKGEKVSLSCVGNSNNVGAYYAGWYQQILGSAPKTVMLGTSRPSGIPDRFSGSRSGNTATLTITGLQEEDEADYYCSTWDKSLN
Ictidomys tridecemlineatus V468 igkv AGTP01137287.1 1488 VRCDIMITQYPSSLSSSQRERLTINCRASQGISNSLHWHPQKPVQAPKLLITYSSTWHSGVPLRFSGNGSGTDFTLTIRSLEHEDVADYYCQQSNSSP
Ictidomys tridecemlineatus V471 trbv AGTP01139993.1 2180 PLYSDVSQTPKYLLAQTGKKQFLKCEQNLGHNAMYWYKQDSKQSLKMMFRYYNKEMTVNETVPSRFSPESPDKAHLNLHVKSLEPEDSALYLCASSR
Ictidomys tridecemlineatus V472 trav AGTP01141976.1 161 VSRGEKVEQSPSTLSVQEGDSAVINCTYSDSNSEYFPWYKQEAGKGPQCIINIHSNEDINQIQRFIVVLDKKAKHFSLNITAAQSRDSAVYFCAAS
Ictidomys tridecemlineatus V477 igkv AGTP01132370.1 1709 SRCEIQMTQSPSSLSASQGDRVSLTCRASQGISNNLHWYQQKPGQAPKLLIRHENTLQSGILSRFSGSGSGTDFTLTISSLEPEDVAIYFCQQSSSYP
Ictidomys tridecemlineatus V478 ighv AGTP01134246.1 5745 VQCEVQLVESGGGLVQPGGSLRLSCAASGFTFSSYWMSWVRQAPGKGLEWVGQINPSGGSTYYPDSVKGRFTISRDNSKNTLYLQMSSLRIEDTATYYCAR
Ictidomys tridecemlineatus V479 igkv AGTP01135752.1 1515 SSGDIVMTQTPLSEPVTPGKPVSISCRSSQSLLHSNGNTYLNWVVHKPGQAPQSLIYKVSNRYTGVPHRFSGSGSGTDFTLRISRVEPEDTGMYFCVQSLQTP
Ictidomys tridecemlineatus V480 iglv AGTP01136448.1 3729 SQAQSKLIQESSLSASKGEKVSLSCVGNSNNVGAYYAGWYQQILGSAPKTVMLGTSRPSGIPDRFSGSRSGNTATLTITGLQEEDEADYYCSTWDKSLN
Ictidomys tridecemlineatus V481 igkv AGTP01137287.1 1488 VRCDIMITQYPSSLSSSQRERLTINCRASQGISNSLHWHPQKPVQAPKLLITYSSTWHSGVPLRFSGNGSGTDFTLTIRSLEHEDVADYYCQQSNSSP
Ictidomys tridecemlineatus V484 trbv AGTP01139993.1 2180 PLYSDVSQTPKYLLAQTGKKQFLKCEQNLGHNAMYWYKQDSKQSLKMMFRYYNKEMTVNETVPSRFSPESPDKAHLNLHVKSLEPEDSALYLCASSR
Ictidomys tridecemlineatus V485 trav AGTP01141976.1 161 VSRGEKVEQSPSTLSVQEGDSAVINCTYSDSNSEYFPWYKQEAGKGPQCIINIHSNEDINQIQRFIVVLDKKAKHFSLNITAAQSRDSAVYFCAAS
Ictidomys tridecemlineatus V549 trgv AGTP01012537.1 4761 VLGELEQPEISISREKDKSAQMSCKAILQSFESIDIHWYREKPNQGLEHLIYVRAKYNQRTLGGKNKKFEASKYAQTSTSVLTVNFLGKEDEATYYCACWT
Ictidomys tridecemlineatus V550 trgv AGTP01012541.1 1097 VLGELEQPEISISREKDKSAQMSCKAILWSFDSIDIHWYREKPNQGLEHLIYVRIKYNERPLGGKNKKFEASKDSPTSTSVLTVNFLGKEDEATYYCACWT
Ictidomys tridecemlineatus V551 trgv AGTP01012552.1 8040 SHTSSSLERRMMLVTSKPGSHVPITCDLRETNKFIYWYQFKEGKVPRYLIYYNFLNCKVVVDSGIISGKYDAYKGPDGKCKLEVRNVEESDSAVYYCAYWT
Ictidomys tridecemlineatus V552 trgv AGTP01012562.1 18946 SHTSSGLKRGMISVTSKPGLNVPITCDFNEASNYIHWYQFKEGQAPRHILYYNFLQSKVVVSSGIISGKYNANKGPDGRCTFVVQNVEESDSAVYYCAYWM
Ictidomys tridecemlineatus V553 trgv AGTP01012567.1 3997 SQTSSSLEGRMMSVTSSPGSYVVITCDLASTYIHWYQFKEGQAPRRLLYYDFVNSKAVRDSESTLVKYDAYKGTDGRCKLAIRNVEESDCAVYYCAYWT
Ictidomys tridecemlineatus V554 trgv AGTP01012571.1 15144 SQTSSSLERRMMSVTSSPGSNVVITCDLSSTYIHWYQFKEGQVPGRLLSYNNYNYKVVVDSGISSTKYVPKITDGSYQLIIQNLGDSDSAVYYCAYWA
Ictidomys tridecemlineatus V555 trgv AGTP01012571.1 6893 SQTSSSLQGRMMSVTSSPGSYVSISCDLASTYIHWYQFKEGQAPRRLLYYDFKNSKVVRDSRITWIKYSAYKGADGQCKLTVRNVEESDSAVYYCAHWI
Ictidomys tridecemlineatus V556 trgv AGTP01012575.1 21191 GLGLSKVEQSEISVSKEIKKSVSINCKISSTSFDTEVIHWYWKKPNKTVEHLIQVSSIKSPARGSLNGKDNKIEAKKYSLTSSSVLTIFSIEKEDAAMYYCAGW
Ictidomys tridecemlineatus V558 trgv AGTP01012576.1 37273 TSGDILISQFAANIIKKRGNTAFLECQMKTNTRKNNAYMHWYRQKPDQPLKRILYISSNENVIHEQGVNGDRYEAKKWQNDLIFSLRIHRVAQEDEGIYYCACWD
Ictidomys tridecemlineatus V559 trgv AGTP01012576.1 12169 SQTSRSEGRMMSVTSSPGSYVPITCDLPEASIYIHWYQFKEGKAPRYLLYYDLFYCKVVVDSGIISEKYDANEGPNGKCKLEVRNVDESDSAVYYCAYWT
Ictidomys tridecemlineatus V560 trgv AGTP01012577.1 560 SQTSSSLEGRMMSLKRTTGSTAVITCDFAEERNFIHWYQFKEGKAPQHLLFHDFYNSKIVMDSGLDPVKYHVYEGTGQRYKFIVRNLEESDSAEYYCAYWSA
Ictidomys tridecemlineatus V653 trbv AGTP01044917.1 6477 ARAQTIHQRPTSKVQLVGSPLSLECTVKGASNPNLYWYRQTAGGALHQLFYSVSVGQVEPEMFQSLSASRPQSGQFFLSSKKLLLEDSGFYFCAWS
Ictidomys tridecemlineatus V678 trav AGTP01053009.1 69159 AHTQVVQVNDSMYGFIGTDIVLHCSFANPLPNVKITQVTWQKATNGSKQNVAIFNPAMGVSVLSPYRERVEFLRPSYIDGTIRLSRLELEDEGVYICEF
Ictidomys tridecemlineatus V783 iglv AGTP01088818.1 126323 SVASYVLTQPSSVSVTPGQTTKITCGGNNIGNKYVHWYQQKTAQAPLLIIYRDSNRPSGIPDRFSGSNSGNTATLTISEVQAGDEADYYCQTGDSNT
Ictidomys tridecemlineatus V784 iglv AGTP01088818.1 56060 SWSQSALNQPLSASGSAGQTVTISCTGTSNDIGRYNYVSWYQNLPGSSPTLLIYGVTNRPSGIPDRFSGSKSGNTASLTISRLQPEDEADYYCCSYTSS
Ictidomys tridecemlineatus V785 iglv AGTP01088818.1 41302 TVASYVLTQPSSVSVTPGQTARITCEGNSIGSYSVYWYQQKPAQAPVLVIYRDSNRPSGISDRFSGSNSGNTATLTISGAQAGDEADYYCQVWDNPV
Ictidomys tridecemlineatus V786 iglv AGTP01088819.1 9585 FVVSYELTQPFSVSVAPGQTATITCSGDELPNNYANWFQQQYPGQSPVLVIYKDSERPLGIPERFSGSSSGTTATLTISRTQTEDEAVYYCLSSYDDSGN
Ictidomys tridecemlineatus V787 iglv AGTP01088820.1 10738 SVVSYELTQPPSVSVALGQTATITCSGDALPKKYAYWFQQQHPGQTPVRVIYKDSERPSGIPERFSGSSSGTTATLTISRTQTEDEAVYYCFSWNSDETQ
Ictidomys tridecemlineatus V788 iglv AGTP01088822.1 14469 SVATYVLTQPSSVSVTPGQAARITCEGDSIGSYSVHWYQQKPAQSPLLIIYNDNNCPSGIPDRFTGSNFGNTATLTISGAQAGDEADYYCQVWDGSA
Ictidomys tridecemlineatus V789 iglv AGTP01088830.1 4903 SVASYVLTQPSSVSVTPGQTARITCGGNNIGSKNVYWYQQKPAQSPLLIIYGDSYRPSGIPDRFSGSNSGNTATLAISGAQAGDEADYYCQVWDGSA
Ictidomys tridecemlineatus V790 iglv AGTP01088834.1 3361 SVVSYELTQPPSVSVALGQTATITCSGDALPKKYAHWFQQQHPGESPVRVIYKNNERPSGIPDRFSGSKSGTTATLTISRTQTEDEAVYYCLSWNSDGTQ
Ictidomys tridecemlineatus V820 igkv AGTP01098008.1 2234 TTGDIVLTQSPLSEPITPGESASISCRASQSLRHSDGKTYLYWFVHRPGQAPQSLIYQVSNRDTGVPDRFSGSGSGTDFTLRISRVEPEDAGVYYCWQL
Ictidomys tridecemlineatus V824 igkv AGTP01099005.1 50221 ARCDIMMTQSPSSLSASPGDRVTITCRASQNINSWLAWYQQKPGQAPKLLIYKASSLESGVPSRFSGSGSGTDYTFTISSMEPEDAATYYCQ
Ictidomys tridecemlineatus V826 igkv AGTP01099006.1 14080 VRCDITMTQSPSFLSVTPGDRVTLTCRSSQGIGSNLNWYQQKLGQASKLLIYLTTSLQSGVHFRLSGSGSGTDFTLTISSLEPEGFANYYCQ
Ictidomys tridecemlineatus V827 igkv AGTP01099006.1 4680 ARCDITMTQSPSSLPVSHGDRVTITCRASQSINSWLAWYQQKPGQAPKPLIYKASNLQSGVPSRFSGSGSGTDYTLTISSVEPEDVATYYCQQYDKLP
Ictidomys tridecemlineatus V828 igkv AGTP01099007.1 7453 STGDVVLTQSPLSEPVTPGQPASISCMCSQSLLHSNRNTYLHWVVHKPGQGPQGLIYRVSNWYTGVPDRFSGSGSGTDFTLRISRVEPDDAGVYYCGQA
Ictidomys tridecemlineatus V829 igkv AGTP01099008.1 11250 IVMTQTPLSKLVTHGQSVSISCRASQSLLYSDEKTYLHWVVHKSGQTPHVLIYGVSNRFAGVSDRFSGSGSGTDFTIRIIRVESDDAGIYYCV
Ictidomys tridecemlineatus V830 igkv AGTP01099008.1 1865 ISADIVMTQTPPSVPVTPGESVSLSCRSSQSLVNSNGNTYLSWFVHKPGQAPQGLIYKVSNRLTGVSDRFSGSGSGTDFTLKISRVEHDDAGIYYCQQGKEYP
Ictidomys tridecemlineatus V831 igkv AGTP01099011.1 15858 TSGDVVLTQTPLSEPVRPGQSAFISCMSSQSLQHSNGNVYLNWVVHNPGQAPQGLIYKVSNQYTGVPDRFSGSGTEFTLRISRMESEDTGVYYCYQG
Ictidomys tridecemlineatus V832 igkv AGTP01099035.1 98014 VRCDIMMTQSPFSLPVSPGDRVTLTCRASEDIRSYLNWYQQKPGQAPKLLMYLANSLESGVPLRFSGSGSRKDYSLTISSLEPEDVSIYFCQQGYH
Ictidomys tridecemlineatus V833 igkv AGTP01099037.1 16603 VRCYITMTQSPFSLPVSHGDRVTLTCRASQGIGSNLNWYQQKPGQAPKLLIYLSTSLQPGITSRFSGSGSGPDISLTISSVEPEDFATYYCQQDSSYP
Ictidomys tridecemlineatus V834 igkv AGTP01099039.1 35679 AKCDMQMTQSPLSLSKSRGERVTITCQASEYISDDLYWYQQKPGQAPKLLLYDTTSLQSGVPSRFTGSGSGMDFTLTISILEPEDVNTYFCQQGNSFP
Ictidomys tridecemlineatus V835 igkv AGTP01099041.1 42182 ARCDITMTQSPSSLSVSPGDRVTITCRASQSINSWLVWHQQKPGKAPKRLIYKASNLQSGVPARFSGSGSGTDYTLTISSVDPEDVATYYCQQHNSNP
Ictidomys tridecemlineatus V836 igkv AGTP01099041.1 17681 ANCDIMMTQSPSSLPVSRGKKVTITCRASQNVNSWLVWYQQKPGQAPKHLIYKASNLQSGVPSRFSGSGSGTDYTLTISSLEPEDIATYFCLQYDSYP
Ictidomys tridecemlineatus V837 igkv AGTP01099044.1 49631 SIGDTVMTQSPLSLSITTGKPASISCKSSQSLLHSNGNTYLRWVVHKPGQSPQSLIYKVSNQNTGVPDRFSGSGSGTDFTLRISRVEAKDAGVYYCLQ
Ictidomys tridecemlineatus V838 igkv AGTP01099044.1 21335 VRCYITMTQSPSSLPVSREDRVTLNCRASQGFGSNLNWYQKKLGQAPKLLIYLAISLQPGITSRFSGSGSGTDFTLTISSLEPEDVANYYCQQGSSSP
Ictidomys tridecemlineatus V839 igkv AGTP01099045.1 18991 SRCDITMTQSPSFMSKSQGDSVTMTCQASESIGTSLHWYQQKPEQAPRLMNNYATNLESGVPSRFSGTGSWIDFTLTISSLESEDVATYYCQQSWDSP
Ictidomys tridecemlineatus V842 trav AGTP01099427.1 18125 GSCRTEIIQSSNLAATMGTDVKFQCQYNNLKGNYDSVYWYLQRTNQRLTYIYHTFQGTVESERYQLSVDRKLSSSTLTIKQVQPRDRAVYYCAV
Ictidomys tridecemlineatus V843 trdv AGTP01099427.1 12422 VCLEIILEPDTKTLTVLIGKPATFRCRVTGGDLKNYQMSWYKKNEDNSLFLIYKLNNSTGNLRNNLKGKIDTLKSEFILDIQKTTPQDAGTYYCGSD
Ictidomys tridecemlineatus V844 trav AGTP01099431.1 11047 VSGKNEVEQSPQYLSAQEGEFIILNCSYSTGMTTLHWLQQNPGGGTVSLFVLSLQMKKNGRMSATISTKESQSSLHIESSQPRDSATYLCAV
Ictidomys tridecemlineatus V845 trav AGTP01099432.1 4241 ITGGVVVEQNPRYLSTQEGEDHTIYCNYSFTSTDRLHWYRQDPGKSLEFLFVLLSNGAVKQEGPLIASLDTMARLSTLHITDTQYVLSATYFCAL
Ictidomys tridecemlineatus V846 trav AGTP01099433.1 14539 ASMAQTVTQSQPEMSVQEAETTTLDCTYDTRESNYYLYWYKQTASGQMIPIIRQEAYKQENATENRFSVNFQKAAKSLGLKISDSQLGDAAVYFCALQ
Ictidomys tridecemlineatus V847 trav AGTP01099433.1 7766 ASMAQSVTQSQPEMSVQEAETATLDCTYDTKDSNYYLYWYKQTASGPMIPIIRQEAYKQENATENRFSVNFQKAAKSLGLQISDSQLGDAAVYFCALQ
Ictidomys tridecemlineatus V848 trav AGTP01099440.1 2975 VSSEDKVVQSPPSLVVHGGDSATLNCSYEMANFQSLHWYKQEEKAPTFLFILVSSGAETKLGRLSGSLNKKLSTLHITATQPGDTATYLCAVE
Ictidomys tridecemlineatus V849 trav AGTP01099443.1 3258 VRGQQLNQSPRSLSIQEGENVSMICNSLSTFNIFLWYRQDPGKILVLLITLYKSGELVRSGKLTAQLGGARKESFLNISSFMPDDSGTYFCSG
Ictidomys tridecemlineatus V850 trav AGTP01099455.1 3409 VRRAQMKVEQSPQVLNLQEGMSSSLLCNYSLSMTSIQWFQQNPGGQLISLFYIASGAQQNGRMKSTVNSKERYSQLFIRDSQLGDSASYFCAVE
Ictidomys tridecemlineatus V851 trav AGTP01099457.1 8674 GSGAQSVAQPDLHVTVTEGVRLELRCNYSYAATPYLFWYVQYPDQHLEHLLTYLARDTLVKGIKGFEAEFKESESSFNLRKSSAHLSDSAKYFCAPV
Ictidomys tridecemlineatus V852 trav AGTP01099460.1 23440 VRGMQVEQSPPALILQEAASSTLLCNFSTSANNVQWFRQNPGGRLINLFYIPSGTKQSGRLTSTTVSKERRSSLYISSSQTTDSAVYFCAVDARCSP
Ictidomys tridecemlineatus V853 trdv AGTP01099460.1 10747 FSVAQKVTQVQTATSGLEREAVTLDCSYETSYPTYYIFWYKQLSSGEIIFLIHQSSSGSDERKGRYSIQFRRAAKSISLTISPLQREDSAKYFCALRE
Ictidomys tridecemlineatus V854 trav AGTP01099460.1 907 VNGEQLKQIPPSLHIQEGEDFTIYCNYSSTIDSLQWYKQKPGGSPVFLMIIVKDGDVKKQGRLAAQLGKTRKDSSLHIVATQATDVGTYFCAV
Ictidomys tridecemlineatus V855 trav AGTP01099464.1 2043 KSHGDSVTQTAGLVTLVEGAPMILNCTYQTTYSVFTLWYVQYLDKAPQLLLKSATDNQKTESQGFHATLIKKENSFHLQKPAVQMSDSAVYYCALR
Ictidomys tridecemlineatus V856 trav AGTP01099465.1 13469 VNSQQREESPQVLSIQGGENATMNCSYKISTTNLQWYRQDSGKSPALAILIHSNEKEKHRGRLTATLDTSTKRSGLSITASQAADAATYFCATD
Ictidomys tridecemlineatus V857 trav AGTP01099465.1 1782 TSMAQKVAQDQTAISVMEKEAVTFNCTYEISDDIYYLFWYKQPPRGKPTFLIRQDSYNEQNAMEGRYSLNFQKASSSIQLTIKASQLMDAAVYFCALKE
Ictidomys tridecemlineatus V858 trav AGTP01099466.1 13861 GSGAQSVTQPDRHVLVSEGAPLQLRCSYSSSVPPSLFWYQQRPSQGPQLLLKYASGATLVTGINGFQAELRKNETSFHLRKPSAHWSDSAEYFCALS
Ictidomys tridecemlineatus V859 trav AGTP01099466.1 7197 GIRAQTVTQPEDHIAVFEGALVQVKCNYSYTGSPVLFWYVQYPGQGLQVLLKHISRDSAKGFTAALDRGEKSFHLQKPSAHLDDSATYYCALS
Ictidomys tridecemlineatus V860 trav AGTP01099468.1 22785 GTHGDSVTQIEDKMTVSEGSFLTINCTYTATGYPSLFWYFQYPGEGLQLLFRVSKANEKGSNRGFQAMYNKEATSFHLEKDCVQGSDSAVYYCALS
Ictidomys tridecemlineatus V862 trav AGTP01099468.1 3402 VRSQQKAVEQSPADLSVPEGAAASFNCTYSDSASQYFFWYKQYPGKGPKLLISIYSNGEKGEGRFTARLEKANRHLFLHIRGSQLSDSATYLCAV
Ictidomys tridecemlineatus V863 trdv AGTP01099469.1 580 SSFSQKVTQAQPAMRVQEKEAVTLLCSYDTSFANYNLLWYKQPSSGEMVFLILQNSYSQKNAAEGRYSVNFQKASKYIQLVISDSQLGDSAVYFCALR
Ictidomys tridecemlineatus V864 trav AGTP01099471.1 10557 GSNGDSVTQTEGQVIISEGTSVTVNCSYETSRYPALFWYVQYTGEGPQLLFRVSKANEKGSNKGFEATYNKETSSFHLKKASIQESDSAVYYCALG
Ictidomys tridecemlineatus V865 trav AGTP01099471.1 3439 GVRGQQVEQSPSALRLQEGTSTTLMCKFSTTMNKVQWFRQKPDGDLINLFFLTQGTKQEGRLNATADAKERSSTLHISISQLEDSGTYLCAAE
Ictidomys tridecemlineatus V866 trav AGTP01099473.1 13115 VKGGNQVEQSPPSLRLWEGDGTSMSCTYSVSGFTGLHWYRQDSGTGLRRLFSMYSAGDVQQKGRLRATLLKGGSSLNITAVQHGDSATYLCAV
Ictidomys tridecemlineatus V867 trav AGTP01099473.1 1515 DSRAQSVTQPDRQVTISEGNSLELACNYSYGGSFSLFWYVQYPNQGLQPVLRYISGNTLVQGIKGFEAEAKKSESSFNLRKPSVHWSDTAEYFCVLV
Ictidomys tridecemlineatus V868 trdv AGTP01099477.1 4557 FIVAQKVTQVQPVTSGQEGETVTLDCSYETSWSAYDIFWYKQLPSGEIIFLIRQSSSGFSEIRGHYSVWFRKTAKSISLIISPFQREDSAKYFCALRE
Ictidomys tridecemlineatus V903 ighv AGTP01111287.1 58437 VQCEVQLVESRGGLVKPRDSLRLSCAASGFTFSDYYMYWFHQARGKGLEWVSHIKIKANSYNKEYTSSVKDRFTISREDSKNTLYLQMSSLRTQDTATYYCFR
Ictidomys tridecemlineatus V912 igkv AGTP01116870.1 4287 AKCDIMMTQTPASMSKSQGETVTIRCQASQGISNALSWYQQKSGQAPKLLMYNTNQLESGVPSRFSGNGSGTDYSLIISSLEPEDVADYYCVQSYKY
Ictidomys tridecemlineatus V913 igkv AGTP01116875.1 22625 VRCDITMTQSPSSLPVSLGDRVTLTCRASQDISNDLHWYQQKPGQAPKLLIYWATNLQSGVPSRLSGSGYGTDFTLTISSLEPEDVADYYCQQSNSSP
Ictidomys tridecemlineatus V914 igkv AGTP01116920.1 1739 ARCDITMTQSPSSLPVSRGDRVTITCRASQNINSWLAWYQQKPGKAPKPLIYRASILQSGVPSRFSGSGSGTDFTLTISSLEPEDVATYFCQQGYLP
Ictidomys tridecemlineatus V915 igkv AGTP01117799.1 19462 TSGDIVLTQTPLSEPVTPGQQDSISCRSSQSLLHINGIMYLYWVVHKPGQARTGLIYQVSIWFIGVSDRFSGSGSGTEFTLRISSVKPDDAGIYYCVQYLQT
Ictidomys tridecemlineatus V916 igkv AGTP01117895.1 24450 SSGEIVLTQSPGSLAASQGERVTRTCTASSSIITSYLHWYQQKLGASPQLLIYRTSILASGVPARFSGSGSGTSYLLTISSVEAEDVTTYYCQQWDSS
Ictidomys tridecemlineatus V917 igkv AGTP01117927.1 5592 VRCDIMMIQSPSSLPVSRGDRITITCMASQHISNRLHWYQQKPGQAPKLFIYGANTLQPEVPLRFSGSGYGLDFTLTISSLEPEDVAIYYCQQGSSSP
Ictidomys tridecemlineatus V918 igkv AGTP01117929.1 7586 VRCDITMTQSPSYLSKSPGERVTITCRASQGISSSLNWYQQKPGQSPKRLIYGASNLQSGVPSRFSGSVSGTDFTLTISSLEPEDFATYFCLQCYSFP
Ictidomys tridecemlineatus V919 igkv AGTP01117940.1 44518 VKTGTALTQSPALLAVYPGERATITCTTNPKENSKFSWYQQKPGQAPKLLVHGTSTLASGVPARFSGSYLGADFTLTISNVETNDAGTYYCFEWPG
Ictidomys tridecemlineatus V920 igkv AGTP01117943.1 28037 VRCDIMMTQSPSSLPVSHGDRVTIKCKARKDIGSYLHWYQQKPGQVPKLLIRHATSLQSGVPSRFGGSGSGTDFTLTISSLEPEYVATYFCQQSYSF
Ictidomys tridecemlineatus V921 igkv AGTP01118315.1 6692 TSGDIVMTQTPLSKPVTPGQSVSLSCKSSQSLLYSDGKTYLSWVVHKPGQAPQGLIYLASNRFSGVPERFSGSGSGTDFALRISRVEPEDTGIYYCGQSLQTP
Ictidomys tridecemlineatus V922 igkv AGTP01118333.1 6571 TSGDIVMTQTPVSEPVTPGQSAYISCRSNQSLLHSNGNIYLHWVVHKPGKAPQGLIYFVSNRYTGVPDRFSGSGSGTDFTLRISRVEPEDAGVYYCYQGIQVP
Ictidomys tridecemlineatus V923 igkv AGTP01118336.1 17917 SSGDVVLTQTPLSEPVTPEQPASISCRSSQSLLHSNGNTYLNWVVHKPGQAPKGLIYRVSNPYTGISDRFGGSGSGTDFTLKISRVEPEDVGVYYCYQW
Ictidomys tridecemlineatus V925 igkv AGTP01118347.1 28992 TSGDIVMTQTSLSKPVTPVQPASISCRSIQSLLHSNGNTYLHWVVHKPGQAPQGLIYPVSNWFTGVPDRFSGCGSGTEFTLRISRVQSEDAGVYYCWQDIQAP
Ictidomys tridecemlineatus V926 igkv AGTP01118347.1 21042 SIGDVVQTQTPLSELITPGQPASISCRSSQRLLHSNGNMYLHWVVPKSGQAPQGLICGVSNWYIGVSDRFSGSGSETDFTLRISRVEPEDSGVYYCFQD
Ictidomys tridecemlineatus V927 igkv AGTP01118347.1 10902 TSGDIVMTQTPLSEPVTPGQSASISCRSSQSLLHSNGNTYLYWLVHKPGQAPQGLIYRLSNRYTGVSDRFSGSGSGTDFTLKISRVEPEDAGVYYCWQGLQYP
Ictidomys tridecemlineatus V928 igkv AGTP01118351.1 2859 TIGDVVLTQIPLSESISPGQPASISCRSSQSLLHSNGNTYLHWVVHKPGQAPQGLIYKVSNRYTGVPDRFSGSGSATEFTLRISRVEPEDAGVYYCLKN
Ictidomys tridecemlineatus V929 igkv AGTP01118366.1 1230 STGDIVLTQTPLSEPITPGQSASISCRASQSLLYSNGKTYLNWFVHKPGQAPKHLIYQVSNRDTGVPDRFSGSGSVTDFTLGISRMEPEEAGVYYCSQG
Ictidomys tridecemlineatus V930 trav AGTP01118702.1 6840 VKGGNQVEQSPPSLRLWEGDGTSMSCTYSVSGFTGLHWYRQDSGTGLRRLFSMYSAGDVQQKGRLRATLLKGGSSLNITAVQHGDSATYLCAV
Ictidomys tridecemlineatus V931 trdv AGTP01118704.1 7908 FSVAQKVIQVQPSTSGQEGGAVTLDCSYGTGWSAYNLFWYKQLPSGEIIFLIRQSSSGSNEIRGHYSVQFRKAAKSISLIILPLQREDSAKYFCALRE
Ictidomys tridecemlineatus V932 trav AGTP01118709.1 3817 RSNGDSVTQTAGLVTLIEGANVTLNCTYQTSYSGSFLYWYVQYLDKAPQLLLKSATDNQRTESQGFHATLVKKENSFHLQKPAVQPSDSAVYYCAVE
Ictidomys tridecemlineatus V933 trav AGTP01118711.1 6604 NTMAQKVIQAQTAISVVEKETVTLDCVYEISYPSYYLFWYRQLPRGKLTLLIRQDSYNEQNTTEGRYSLNFQKASSSIQLTITASQLMDAAVYFCALRE
Ictidomys tridecemlineatus V934 trav AGTP01118712.1 16252 GSGAQSVTQPDRHVLVSEGAPLQLRCSYSSSFSPYLFWYQQRPSQGLQLLLKYVSGATLVTGINGFQAEFRKNETSFHLKKPSAHWSDSAEYFCVLG
Ictidomys tridecemlineatus V935 trav AGTP01118712.1 6427 VNSQQGEASPQFLSIQEGENATMNCSYKIDITNLLWYRQDSGKGPALVILIRSNEREKHSGRLTATLDTSTKRSILSITASQAADAATYFCATD
Ictidomys tridecemlineatus V936 trav AGTP01118713.1 16402 WTRGESVTQTEGQVTISEGFFLTINCTYSSSGYPNLFWYVQYPGEGPQLLLKAVKANDMGSEKGFEATYRKETTSFHLEKASVQESDSAVYYCALS
Ictidomys tridecemlineatus V937 trav AGTP01118713.1 4381 VHSQQKAVEQSPAALSVPEGSVASLNCTYSNSLSQYLFWYRQYPGKGPKLLISIFSNGEKGEGRFTTQLDTAKRHLFLHIRSSQLSDSATYLCAV
Ictidomys tridecemlineatus V938 trav AGTP01118714.1 5250 VSQGEKVEEYPSTLSVQEGDSIVINCTYSDSASNYFPWYKQEAGKGPQHIIDIISNKEINQVQRFIVVLDKKAKHFSLNITATQPGDSAVYFCAAS
Ictidomys tridecemlineatus V939 trav AGTP01118720.1 2706 RTHGDSVTQTAGHVTMSEGVLLIINCTYSTTTIAYPVLFWYVQYPGKGLQLLLKAVKANDKVSNIDFEATYKKDTSSFNLEKASVQVSDSAVYYCALG
Ictidomys tridecemlineatus V940 trav AGTP01118730.1 5788 SSFAQKVTQAQPAMWVQEKEAVSLHCSYDTSAGSYGLLWYKQPSSGEMVFLILQNSYSQQNATEGRYSVNLQKASKSIQLAISTSQLGDSAVYFCALRDR
Ictidomys tridecemlineatus V941 trav AGTP01118734.1 2104 ASQGEKVEQHPCTLSVQEGDSAVINCTYSESSSSYLPWYKQEAGKGPQHIIDILSNKEINQIQRFIVVLDKKAKHFSLNITATQPGDSAVYFCAADA
Ictidomys tridecemlineatus V942 trav AGTP01118741.1 2379 VKGGNQVEQSPLSLRPWEGDSTSMSCTYSVSAFKGLQWYRQDAGTGLRHLFSMYSTGDVQQKERLRATLLKGGSSLNITAVQHGDSATYLCAV
Ictidomys tridecemlineatus V943 trav AGTP01118742.1 367 ADGQKVEQNPQVCSIQDSENASLTCYYTNYSPESIQWYQQDPGRGLFFLILVRENKGEKQKERLRVTFDTPTKQSALHITASQPADSATYLCAL
Ictidomys tridecemlineatus V944 trav AGTP01118747.1 1928 VSKGEKVEQHPSFLSVQEGDSAVIHCTYTDSASTYFFWYKHKPGAGLQLLMQILSSMERKQDQRLTVLLSKKDKHLSLNITAAHPRDSATYFCAAR
Ictidomys tridecemlineatus V945 trdv AGTP01118749.1 893 FSVAQKVTQVPPAISAQEGGAVTLDCSYETSRSAYDLFWYKELPSGKMMLLIRQSSSGGNRREGRYSVQFRRAEKSISLTISPLQREDSAKYLCALRE
Ictidomys tridecemlineatus V946 trav AGTP01118752.1 4694 RSNGDSVTQTAGLVTLIEGAPVTLNCTYQTTYSGSFLYWYVQYIDKGPQLLLKSATENQKTESQGFHATLVKKENSFHLQKPAVQPSDSAVYYCAAG
Ictidomys tridecemlineatus V947 trav AGTP01118754.1 3262 TSMAQKVIQAQTAISVVEKEAVTLDCVYETSDSTYYLFWYKQLPSGKLTLLIRQESYNQQNATEGFYSLNFQKASSSIQLTITASQLMDAAVYFCALRE
Ictidomys tridecemlineatus V948 trav AGTP01118755.1 1748 VNSQQEEENPRVLSVQEGENATMNCSYKTSTTTLQWYRQDSGKGPALVILIRSNEREKHSGRLTATLDTSTKRSFLSITASQAADVATYFCATD
Ictidomys tridecemlineatus V949 trav AGTP01118762.1 2232 GVRGQQVEQSPSALRLQEGTSPTLRCNFSTTMQSVQWFRQNPGGGLINLFYLASGTKQEGRLKATADAKERYSTLHISTSQQEDSGTYLCAAE
Ictidomys tridecemlineatus V950 trav AGTP01118768.1 18964 RSNGDSVTQTAGLVTLTEGASVILNCTYQTIYSVSFLFWYVQYLDKGPQLLLKSATENQKIESQGFHATLVKKENSFHLQKPAVQPSDSAVYYCAVG
Ictidomys tridecemlineatus V951 trav AGTP01118768.1 16127 SSMSQKVTQDQAAISMLEMEAVTLNCVYNATSFSYYLFWYKQPPRGEMILLMDQESYREEKVIEGRFSLNLQKPVSSFSLTISALELQDSAVYFCALRE
Ictidomys tridecemlineatus V952 trav AGTP01118773.1 2074 VNSQQEEESPWVQSVQEGKNATMNCSYKTSTTTLQWYRQDSGKGPALVILIRSNEREKHSGRLTATLDTSTERSFLSIMASQAADVATYFCATD
Ictidomys tridecemlineatus V953 trav AGTP01118775.1 1631 VHSQQKAVEQRPAALSVPEGAVASLNCTYSDSASQNFMWYQQYSGKGPKLLMFIFSNGEKGEGRFTTQLDTAKRHLFLHIRGSQLSDSATYFCAL
Ictidomys tridecemlineatus V955 trav AGTP01119909.1 5272 VSSQQKAVEQSPEALSVPEGAVASLNCTYSDSASRNFMWYQQYSGKGPKLLISIFSNGEKGEGRFTAQLDTATRHLFLHIRASQLSDSATYFCAL
Ictidomys tridecemlineatus V956 trav AGTP01119912.1 2746 RTRGQSVTQTESQLTMSERSILTINCTYSSTGYAYLFWYVQYPGEGPQLLLKAMKANDMGSEKGFKATYRKETTSFHLEKASVQESDSAVYYCALS
Ictidomys tridecemlineatus V957 trav AGTP01119919.1 751 RTYGDSVTQMESHVTMSEGALLTINCTYSATTIAYPALFWYVQYPGEGLQLLLKAVKANYKSSNKGFEATYNKEASSFNLEKASIQESDSAVYYCALG
Ictidomys tridecemlineatus V958 trav AGTP01119920.1 5280 VSQGEKVEQHPSTLSVQEGDSAVINCTYSISGSEYFPWYKQEVGKGPQRIIDIRSNKEINQVQRFIVVLDKKAKHFSLNITATQPGDSAVYFCAAD
Ictidomys tridecemlineatus V959 trav AGTP01119921.1 36250 RTHGDSVTQMEGQVTISEGALLTINCTFSSTRYPTLFWYVQYPGEGPQLLLKAMKANDKVSNKGFEATYNKEATSFNLEKASIQESDSAVYYCALG
Ictidomys tridecemlineatus V960 trav AGTP01119921.1 29871 GVRGQQVEQSPSALRLQEGTSPTLRCNFSTTMNRVQWFLQNPGGGLINLFYLASGTKQEGTLKVTADAKEHYSTLHISTSQLEDSGTYLCAVE
Ictidomys tridecemlineatus V961 trav AGTP01119921.1 20262 FSQGEKVDQHPSTLSVQDGDSAVINCSYSESTWDYFSWYKQETGKGLQRIIDIRSNKEISQIQRFIVVLDKKAKHFFLNITATQPGDSAVYFCAAS
Ictidomys tridecemlineatus V962 trav AGTP01119921.1 3455 GVRGQQVEQSPSALRLQEGASSILKCNFSTSMDRVQWFRQSPGGSLISLFFLASGTKQEGRLKGVLNFQERYSTLNISTSHLEDSGTYLCAG
Ictidomys tridecemlineatus V963 trdv AGTP01119925.1 895 FSVAQKVIQVQPATFGQLGEAVTLGCSYETSRSAYTIFWYKQLPSGEIIFLIHQGSFGVNEIRGRYSVQFRRAAKSIKLTISPLQREDAAKYFCALWE
Ictidomys tridecemlineatus V964 trav AGTP01119928.1 1102 VNSQQEEDSPRILSVQEDENATMNCSYKTSTTTLQWYRQDSGKGPALVILIRSNEKEKHSGRLTATLDTSSQRSVLSITASQAADAATYFCATD
Ictidomys tridecemlineatus V965 trav AGTP01119931.1 5687 VRSQQKTVEQSPEALSVPEGAVASLNCTYSDSASQNFRWYQQYSGKGPKLLISIFSNGEKGEGRFTVQLDTAKRHLFLHIRGTQLSDSATYLCAV
Ictidomys tridecemlineatus V966 trav AGTP01119936.1 1131 GVRGQQVEQSPSALRLQEGTSPTLRCNFSTTIYRVQWFQQKPDGGLINLFFLTQGTKQEGRLKATVDAKERYSTLHISTSQQDDSGTYLCAAE
Ictidomys tridecemlineatus V967 trav AGTP01119943.1 1250 VSRGDKVEQRPSTLSVQEGDSAVVNCTYSSSGSVYFLWYKQEAGKGLQMIIDIRSNKEINQIQRFIVVLDKKAKHFSLNITAAQPGDSSVYFCAAD
Ictidomys tridecemlineatus V968 trav AGTP01119944.1 4706 GVRGQQVEQSPSALRLQEGASSTLRCNFSTNIYSVQWFQQNSGGSLRSLFFLTSGTKQEGRLKATADAKERYSTLHIFTSQLEDSGTYFCAM
Ictidomys tridecemlineatus V969 trav AGTP01119945.1 6502 FSQGEKVDQHPSTLSVQEGDSAVINCTYSDSALDYFPWYKQEAGKGPRRIIDIRSNKEINQIQRYIVVLDKRAKHFSLNITATQPGDSAVYFCAAS
Ictidomys tridecemlineatus V970 trav AGTP01119945.1 1873 SSFAQKVTQAQPAMWVQEKEAVSLLCSYDTSETRYGLLWYKQPSSGEMVFLILQNSYSQQNATEGRYSVNLQKASKSIQLVISASQLGDSAVYFCALRE
Ictidomys tridecemlineatus V971 trav AGTP01119946.1 5137 GVRGQQVEQSPSALRIQEEASSTLRCNFSTTMTRVQWFRQNPGGGLISPSFLTPGTKQEGRLKATMNFQEWYSTLIISTSQLEDSGTYLCAAE
Ictidomys tridecemlineatus V972 trav AGTP01119947.1 6801 GVRGQQVEQSPSALRLQEGTSTTLRCNFSTSMTNVQWFRQNPGGSLISLFYLASGTKQEGRLKATVDPKERYSTLHISTSQLEDSGTYLCAM
Ictidomys tridecemlineatus V973 trav AGTP01119953.1 945 VIQGEKVDQHPSTLSVQEGDSAVINCTYSDSASTYFPWYKQEAGKGPQRIIDIRSNKEINQIQRFIVVLDKKAKHFSLNITAAQPGDSAVYFCAAD
Ictidomys tridecemlineatus V974 trav AGTP01119956.1 7885 VKGGNQVEQSPPSLRPWEGEGTSMSCTYSVSIFNGLQWYRQDAGSGLRHLFSMYSAGDVQQKGRLQATLLKGRSSLNITAVQHGDSATYLCAV
Ictidomys tridecemlineatus V975 trav AGTP01119958.1 18123 TVSLAKTTQRISMDAYEGQEVNVSCNHTNIATNEYIFWYRQVPRQGPHFVIQGYKTNVANEVASLFIPVDRKSSTLSLHRVTLRDSAVYYCTVG
Ictidomys tridecemlineatus V976 trav AGTP01119958.1 7578 GVRGEQVEQSPLALRLQEGTSPTLRCNFSATMTSVQWFLQNPGGSLISLFYLTPGTKQEGRLKATMNFQERYSTLHISTSQLEDSGTYLCAAE
Ictidomys tridecemlineatus V977 igkv AGTP01120296.1 88455 VRCDITMNQSPSSFPVSQGDRVTITCRASQNINSWLAWFQQKPGQVPKCLIYKASSLQSGVPSRFSGSESGTIYTLNISSLESEDVADYYCQQSNSSP
Ictidomys tridecemlineatus V978 igkv AGTP01120495.1 7965 ARCDITMTQSPTSLSKSQGETVTIRCQASQVINNELNWYQQKPGEAPKILIYETNHLQSGVPSRFSGSGRGTDYSLIISSLEPEDVATYFCQQG
Ictidomys tridecemlineatus V979 igkv AGTP01120509.1 685 AKCDITMTQSLTSLSKSQGETVTIRCQASQGISNYLSWYQQKPGQAPKLLIYDTNCLQSGVPSRFSGSGSGTDYSLTISSLEPEDIADYYCLQSYNYP
Ictidomys tridecemlineatus V981 igkv AGTP01120511.1 4370 TTGDIVLTQTPLSEPITPGQSASISCRASQSLQHSDGKTYLNWFVHKPGQAPKRLIYQVSNRYTGVPDRFSGSGSVTDFTLRISRVEPEDVGVYYCSQG
Ictidomys tridecemlineatus V982 igkv AGTP01120512.1 6100 TSGDIVLTQNPLSNPVTPGQSASLSCRSSQSLLGSDGNTYLSWVVHKPGQAPRGLIYGISNQYTGVSDRFSDSGSGTDFTLRISRVEPADTGIYYCVQSLQTP
Ictidomys tridecemlineatus V983 igkv AGTP01120515.1 3527 AKCDITMTQSPSSLSKSQGETVTIRCQASQGISNVLSWYQQKPGQAPKPLIYYTNRLHSGVPSRFSGSGSGTDYSLTIRSLEPEDVATYFCVQSYSSP
Ictidomys tridecemlineatus V984 igkv AGTP01121035.1 4624 TSGDVVMTQTTLSEPVTPGESTSISCMSSQSLLDSDGNTYLSWVVHKPGQAPQGLIYKVSNSVSGVSDRFSGSGSETEFTLRISRVEAEDSGVYYCAQH
Ictidomys tridecemlineatus V985 igkv AGTP01121039.1 1124 FIGDVVQTQTPLSEPITPGQPASISCRSSQSLLHSNANTYLHWVVHKRGQAPQGLICGVSNRYTGVPDRFSGSRSGTEFTLRINRVEPEDDGVYYCWQD
Ictidomys tridecemlineatus V986 igkv AGTP01121040.1 2078 FIGDVVQTQTPLSEPITPGQPASIFCRSSQSLLHSNANTYLHWVVHKRGQAPQGLICGVSNRYTGVPDRFSGSGSGTEFTLRINRVEPEDDGVYYCWQD
Ictidomys tridecemlineatus V987 iglv AGTP01122745.1 3152 SRAQSVVTQQPSLSGTPGQRVTISCTGSSNNIGWYNVHWYQQLPETAPKLLIYGDSNRYSGVPDRFSGSKSGNSASLTITGLQPEDEADYYCQSYDDNIGV
Ictidomys tridecemlineatus V988 iglv AGTP01122746.1 11361 SLSQPVLTQLPSLSASPGASSKLTCTMSSGFSVGNYWISWYQQKPGSPPKYLLSYYSESSKNQGTGVPSRFSGSKDTSANAGVLQISGLQLEDEADYYCAL
Ictidomys tridecemlineatus V989 iglv AGTP01122747.1 1104 SLSQPVLTQLPSLSVSPGASSKLTCTLSSGFSVGNYWISWYQQKPGSPPKYLLSYYSESSKNHGTGVPSRFSGSKDTSANAGVLQISGLQLEDEADYYCGT
Ictidomys tridecemlineatus V990 iglv AGTP01122754.1 1005 SWAQSVLTQQPSLSGTPGQKVTISCIGSSTNIGDGYTVQWYQQLPETAPKLIIYGSSTRPSGVPDRFSGSRSGNSGSLTITGLLLEDEADYYCQSYDKSLK
Ictidomys tridecemlineatus V991 iglv AGTP01122763.1 1112 SRAQSVLTQQPSLSGTPGQRVTISCTGSSNNIGSYNVQWYQQLPAMAPKLLIYGDSNRHSGVPDRFSGSKSGNSASLTITGLQPDDEADYYCQSYDYNLGA
Ictidomys tridecemlineatus V992 iglv AGTP01122778.1 3027 SWAQSVLTQPPSLSGTPGQKVTISCTGSSSNIGSDNVHWYQQFPETAPKLLIYGDSNRPSGVPDRFSGSKSGNSGSLTITGLQPEDEAVYYCQSYDYSLNA
Ictidomys tridecemlineatus V995 igkv AGTP01124282.1 9485 AGVRCDIMMTQSPSSLPVSHGDRVTITCRASQGISNNLHWYQQKPGQAPKVLIKYENTFGVPSRFGGSGSGTDFTLIISSLEPEDVADYYCQQSNSFP
Ictidomys tridecemlineatus V996 igkv AGTP01124282.1 624 AKCNIMMTQSPSSLSASPGDRVTITCGASQNINSWLALYQQIPGQPPKILIYKASNLQSGVLSRFSGSGSETDYTLTISSMDPEDVATYYCQQHNSYP
Ictidomys tridecemlineatus V999 igkv AGTP01126052.1 5933 AKCDITMTQSPTTLSKSQGETVTIRCQASQGISNYLSWYQQKPGQAPKPLIYYTNRLHSGVPSRFSGSGSGTDYSLTITSLEPEDVADYFCLQSYSSP
Ictidomys tridecemlineatus V1000 ighv AGTP01126101.1 14597 VLCQVQLQESGPGLVKPSQTLSLTCAVSGYFITSGYCWNWIRQPPGKGLEWIGYICSSGSTGYNPSLKSRVSISRDTSKNQFSLQLSSLTTEDTATYYCAR
Ictidomys tridecemlineatus V1001 ighv AGTP01126232.1 987 VAAESGPGQVKPSQTLSLTCAVSGFSITTSYNYWHWICQPPGKGLEWIEYIWYNGNTYYNPSLMSPVSISRDTSKNPFSLQLSSLTTQDTATYYCAR
Ictidomys tridecemlineatus V1003 ighv AGTP01126661.1 11795 VLCQVQLQESGPGLVKPSQTLSLTCAVSGFSITTSGYRWHWIRQPPGKGLEWIGRIWYDGDTNYNPSLKSRVSISRDTSKNQFSLQLSSLTTEDTATYYCAR
Ictidomys tridecemlineatus V1007 iglv AGTP01127740.1 7404 SLSQPVLTQSPSVSASLGASVKLTCTLSSQHSNYYISWYQQQPGKAPLYVMYVNSDGSHGKGNGIPDRFSGSSSGADRYLSISNIQNEDEADYLCGV
Ictidomys tridecemlineatus V1008 iglv AGTP01127750.1 881 SWAQSVLTQQPSMSGTPGETVTLSCKGSRNNIGSYGVNWYQQLPETAPKLLIYGSSNRPSGVPDRFSGSRSGNSGALTITNIQLQDEGIYFCHSYDSSLN
Ictidomys tridecemlineatus V1011 trav AGTP01129258.1 8006 GVRGQQVEQSPSALRLQEGTSPALRCNFSTTMRSVQWFQQNPGGGLISLFFLASGTKQEGRLKATVDAKERYSTLHISNSQLEDSGTYLCAVE
Ictidomys tridecemlineatus V1012 trav AGTP01129260.1 542 RTHGDSVTQMEGQVTISEGALLTINCTYSSTSYPTLFWYVQYPGEGLQLLLKAVKANDKVSNKGLEATYNKEITSFHLEKASIQESDSAVYYCALG
Ictidomys tridecemlineatus V1013 ighv AGTP01130625.1 1115 VLCQVQLQESGPGLVKPSQTLSLTCAVSGFSITTSSYRWSWIRQPPGKRLEWIGGIRNDGDTKYNPSLKSRVSISRDTSKNQFSLQLSSMTTEDTATYYCAR
Ictidomys tridecemlineatus V1014 trdv AGTP01130641.1 1698 TSMAQKVIQVQTAISVVENQAVTLHCVYETREPNYYLFWYKQLPSGKLTFLIRQESYNKQNATGGRYSLNFQKASSSIQLTITASQFMDTAVYFCALEA
Ictidomys tridecemlineatus V1015 trav AGTP01130643.1 3455 VNSQQEESSQILSIQEGENATMNCSYKSSTTTLQWYRQDSGKGPALVILIRSNEREKHSGRLTATLDTSTQRSFLSITASQAADAATYFCATD
Ictidomys tridecemlineatus V1016 trav AGTP01130645.1 662 VRSQQKAMEQSPAALSVPEGALASLNCTYSDSASRNFMWYQQYSGKGPKLLLFIYSNGEKGEGRFTAQLDTAKRHLFLHIRGSQLSDSATYFCAL
Ictidomys tridecemlineatus V1017 trav AGTP01130647.1 1433 RTLGQSVTQTEGQVTISEGSFLTINCTYSSSGYAYLFWYVQYPGEGPQLLLKAMNINDKGSEKGFEATYKKETTSFHLEKASIQESDSAVYYCALG
Ictidomys tridecemlineatus V1018 igkv AGTP01131245.1 9748 VRCYITMTWSPSSLPVSSGDRVTLTCRASQGIGSNLNWYQQKPGQVPKLLIYLSTSLQPGTTSMFSGSGSGTDFTLTISSLEPEDFATYYCQQDSSYP
Ictidomys tridecemlineatus V1019 ighv AGTP01131566.1 3599 VQCEVQLVESGGGLVQPGGSLRLSCAASGFTFSNYWMHWFRQAPGKGLEWVALIKHKANSYSTAYAASVKDRFTISREDAKNTLYLQMSSLRTEDTATYYCAR
Ictidomys tridecemlineatus V1020 trav AGTP01132673.1 7066 GSNGDSVIQTEGQMTLSEGTSLTVNCSYKTSQYPALFWYVQYPGEGLQLLLKAVKANDKVSNKGFEATYDQETTSFHLVKASVQESDLAVYYCALG
Ictidomys tridecemlineatus V1022 trav AGTP01132675.1 2113 VSQGEKVEQHPSTLSVQEGDSTVINCTYSDSTSSYFPWYKQEVGKGPQHIIDIRSSKEINQIQRFIVVLDKKAKHFSLNITAAQPGDSAVYFCAAD
Ictidomys tridecemlineatus V1024 iglv AGTP01133174.1 724 VDCQSTVIQEPSLSVSPGGTVTLTCGLSSGSVSTGHYPGWYQQNPGLSPRQLIYYTNNRPSGVPDRFSGSILGNKAALTITRAQTDDEADYYCSLYMGSG
Ictidomys tridecemlineatus V1025 ighv AGTP01135505.1 7558 VQCEVQLVESGGGLVQPGGSLRLSCAASGFTFSDYWMSWVRQAPGKGLEWISRISHTSHTTNYADSVKGRFTISRDNSKNTLYLQMSSLRVEDTATYYCAR
Ictidomys tridecemlineatus V1026 igkv AGTP01136440.1 909 ARCAIKMTQSPSSLSASPGDRVTITCRASQSINCWLAWYQQKPGQAPKCLICKASSLESGVLSRFSGRGSQRDYTLTISSLEPEDVANYFCLLYYSSP
Ictidomys tridecemlineatus V1028 trav AGTP01137775.1 2276 RTLGQSVTQTEGQVTISEGSFLTINCTYSSSGYAYLFWYVQYPGEGPQLLLKAMNVNDKGSEKGFEATYKKETTSFHLEKASIQESDLAVYYCAMH
Ictidomys tridecemlineatus V1029 igkv AGTP01137777.1 818 SRCDIQMTQSSSSLSASQGDRVTLTCRASQGISNNLHWYQQKPEQAPKLLIRYANTLQSGVPSRFSDSGSGTNVNLTVSSLKPEDGAIYFCQQG
Ictidomys tridecemlineatus V1031 trbv AGTP01141817.1 1961 PLHSGVSQTPKYLLTQAGKKQSFKCEQNLDHNTMYWYKQDSKQSLKMMFTYNNKEMIANETVSGRFSPESPDKAHLNLHVNSLEPEDSALYLCASSQ
Ictidomys tridecemlineatus V1033 ighv AGTP01149488.1 562 VLCQVQLQESGPGLVKPSETLSLTCAVSGFSITTGSYGWNWIRQPPGKGLEWIGHIWSDGDTIYSPSLKSRVSISRDTSKNQFSLQLSSLTTEDTATYYCAR
Ictidomys tridecemlineatus V1034 trav AGTP01132673.1 7066 GSNGDSVIQTEGQMTLSEGTSLTVNCSYKTSQYPALFWYVQYPGEGLQLLLKAVKANDKVSNKGFEATYDQETTSFHLVKASVQESDLAVYYCALG
Ictidomys tridecemlineatus V1036 trav AGTP01132675.1 2113 VSQGEKVEQHPSTLSVQEGDSTVINCTYSDSTSSYFPWYKQEVGKGPQHIIDIRSSKEINQIQRFIVVLDKKAKHFSLNITAAQPGDSAVYFCAAD
Ictidomys tridecemlineatus V1038 iglv AGTP01133174.1 724 VDCQSTVIQEPSLSVSPGGTVTLTCGLSSGSVSTGHYPGWYQQNPGLSPRQLIYYTNNRPSGVPDRFSGSILGNKAALTITRAQTDDEADYYCSLYMGSG
Ictidomys tridecemlineatus V1039 ighv AGTP01135505.1 7558 VQCEVQLVESGGGLVQPGGSLRLSCAASGFTFSDYWMSWVRQAPGKGLEWISRISHTSHTTNYADSVKGRFTISRDNSKNTLYLQMSSLRVEDTATYYCAR
Ictidomys tridecemlineatus V1040 igkv AGTP01136440.1 909 ARCAIKMTQSPSSLSASPGDRVTITCRASQSINCWLAWYQQKPGQAPKCLICKASSLESGVLSRFSGRGSQRDYTLTISSLEPEDVANYFCLLYYSSP
Ictidomys tridecemlineatus V1042 trav AGTP01137775.1 2276 RTLGQSVTQTEGQVTISEGSFLTINCTYSSSGYAYLFWYVQYPGEGPQLLLKAMNVNDKGSEKGFEATYKKETTSFHLEKASIQESDLAVYYCAMH
Ictidomys tridecemlineatus V1043 igkv AGTP01137777.1 818 SRCDIQMTQSSSSLSASQGDRVTLTCRASQGISNNLHWYQQKPEQAPKLLIRYANTLQSGVPSRFSDSGSGTNVNLTVSSLKPEDGAIYFCQQG
Ictidomys tridecemlineatus V1045 trbv AGTP01141817.1 1961 PLHSGVSQTPKYLLTQAGKKQSFKCEQNLDHNTMYWYKQDSKQSLKMMFTYNNKEMIANETVSGRFSPESPDKAHLNLHVNSLEPEDSALYLCASSQ
Ictidomys tridecemlineatus V1047 ighv AGTP01149488.1 562 VLCQVQLQESGPGLVKPSETLSLTCAVSGFSITTGSYGWNWIRQPPGKGLEWIGHIWSDGDTIYSPSLKSRVSISRDTSKNQFSLQLSSLTTEDTATYYCAR