WGS Statistics
Organism WGS Record. Vs Total IGHV IGLV IGKV TRAV TRBV TRGV TRDV
Heterocephalus glaber AHKG00000000.1 (AHKG01) 132 22 13 35 38 14 4 6
Heterocephalus glaber AFSB00000000.1 (AFSB01) 138 21 14 37 40 17 5 4
Vgene Table
Organism Vgene Locus contig Contig Pos. AA sequence
Heterocephalus glaber V83 trgv AHKG01018371.1 1939 SQTSSGLEGGMISISRKRGSYIVITCDIHEEGNYIHWYLFRVGQAPHRLLYYDFFASKPVVDSEFSPGKYHAYEGTKKSYKFVLRNVEESDSGVYYCAIWA
Heterocephalus glaber V84 trgv AHKG01018373.1 7035 GLGVTKMEQSQISISIEENKRVDIPCKVSGDYFEDEAIHWYLQKQDQALEHLIQVVSTTTPAQEKINRVSATKDLATRSSVLTIKFVAKEDVGLYYCAMWD
Heterocephalus glaber V85 trgv AHKG01018381.1 25133 GLGVTKLEQFQISVSTEVKKSVNIHCRVWSTQFETKPIHWYLQKANQALVHLIQVTSLTTPARAKNNRVSARKDPVTLSSTLTINFVEKEDMAIYYCAGWD
Heterocephalus glaber V86 trgv AHKG01018393.1 26816 GLGQLEQPKIVISRATDKSASIPCKATTNNFKSVDIHWYRQKPKKEFEHLMYVRTAYNQRPLGGTNKKLEASKNFDTFASTLKINVLKKEDEATYYCTYWD
Heterocephalus glaber V97 ighv AHKG01019868.1 1298 KTWCSLGGRGSLQLSCAALGFAFSDFGISCVHQASGNGVEWFSVIRYHSSCINCACSMKGQFTTSKANSKNMLYLQMKCLRTEDTAVYYCAR
Heterocephalus glaber V138 iglv AHKG01026755.1 823 SMAQAVLTQPPSLSKVSGETAILTCTGNSNNVGYEGAGWVQLQQQGQSPKTLVNRNNNRLSGIPERFSGTRSGNSASLTITGIQPEDEADYYCAAWDKSQSA
Heterocephalus glaber V139 iglv AHKG01026757.1 2735 VVSQTVVTQEPSMSVSSGETVSLNCGLSSGSVSTGNYPSWYQQNPGQAPHLFIYQTDKRPSGVPDRFSGSIAGNKAALTITGAQPEDEADYYCLLYMGSGN
Heterocephalus glaber V140 iglv AHKG01026757.1 11351 SFCQPVLTQSPSASASLGASVKLTCTLSNEHSSYTIAWFQQHPGQSPVYVMYVGSGGNYNKGDRIPDRFSGSSSGADRYLTISNLQSEDEADYICGVSH
Heterocephalus glaber V141 iglv AHKG01026757.1 23396 TWAQSGLRQEASLSQSVGQTISFSCTGSSNNIGTYAAGWYQQIPGAAPKTVMIGSSRPSGIPDRFSGSKSGNTASLRISNVQAEDEADYYCSSWDYSQNA
Heterocephalus glaber V142 iglv AHKG01026762.1 3486 AASQAVVTQESSLSTTPGGTVTLTCGSSTGTVTTSNYAAWVQQKPYQAPQGLIDDTSNRLPGIPARFSGSLLGDKAALTIAGAQPEDEASYYCALWYSNH
Heterocephalus glaber V143 iglv AHKG01026763.1 8580 AASQAVVTQESSLSTTPGGTVTLTCGSSTGAVTTSNYAAWVQQKPYQASQGLIGDTSNRVPGIPARFSGSLLGNKAALTITGAQPEDEASYYCALWYSSH
Heterocephalus glaber V144 iglv AHKG01026791.1 9752 SLFSGTWAQSALTQPPTASGSLGEEVTISCIGTSSDIGSYNAVSWYQQLQGTSPKLLIYDVSSRPSGIPDRFSGSKSGNTASLSIARLQAEDEADYYCCSYRSG
Heterocephalus glaber V145 iglv AHKG01026792.1 7077 CWAQSALTQPPTASGSLGGKVTISCTGTSSDIGSYNDVSWYQQLQGTSPKLLIYDVSNRPSGIPDRFSGSKSGNTASLSIDRLQAEDEADYYCSSYTTS
Heterocephalus glaber V146 iglv AHKG01026792.1 17554 SLFPGTWAQSALTQPPSASGSLGEKVTISCDGTSNDIGRYDAVSWYQHLEGTSPKLLIYDVNNRASGISDRFSGSKSGNTASLSISGLQPEDESDYYCS
Heterocephalus glaber V147 iglv AHKG01026794.1 10699 SMASSILTQPPSVSVTPGQTALLTCSGDKLSEVYAHWYQLKTGQAPKLVIYEDSKRPSGIPDRFSGSSSGNTATLSISGAQAGDEADYYCQSYDSSEL
Heterocephalus glaber V148 iglv AHKG01026797.1 9010 SMASYVLTQPTSVSVALGQTATITCSGSALPQKYAYWFRQNPGQTPVQIIYEDSKRPSGIPERFSGSSSGTTATLTISGAQPEDEADYYCFSADSDDKH
Heterocephalus glaber V149 iglv AHKG01026800.1 11700 SAASYVLTQPSSVSATLGQTARMTCEGNSIGNKLVNWYQQRPPQAPMLVIYDDDTQPSGIPDRFSGANSGNTATLTITGAQAEDEADYYCQVWDGSN
Heterocephalus glaber V150 iglv AHKG01026803.1 2880 SMASYKLTQPSSLSVTWGKTARITCQGYSIRSYTVNWYQLKPGQAPVMIIYYDDSKPSGIPDRFLGSNKGNTATLTISKAQFEDQADYYCQVWDNSDK
Heterocephalus glaber V168 igkv AHKG01029299.1 3811 VSGDIILTQTPASLSASPGETVSISCQASADVNREMSWIRIKLGQRLEPLISHITTLASGVPARYSSSGSGTSYVFSISPVEPGDSGEYYCMHDYGWP
Heterocephalus glaber V169 igkv AHKG01029300.1 3736 TSGNTVLTQSPAFLSVTPGESISITCRASESVSDYVTWYQQKPGQAPRILIYDADNQYSGVSDRFTGIQSGTEFIFKISSVEGDDAGTYFCQQDYSVP
Heterocephalus glaber V170 igkv AHKG01029300.1 7947 SDTSGQTLLTQSPASLALSPGEMATLTCRASQSVSNYLAWYQQKPGQAPRLLIYGASSRATGIPARFIGSGSGTDFTLSISSLEPEDIAVYHCYQYSNWY
Heterocephalus glaber V171 igkv AHKG01029300.1 22862 ARCDIQMTQSPSSLSASIGDTVTISCQASQDINKYLAWYQQKPGKAPKLLIYYASSLESGVPQRFSGSGSGTDYTLTINSVEAEDVGTYYCQQHQSYP
Heterocephalus glaber V172 igkv AHKG01029300.1 30347 ARCDIQMTQSPSSLSPSIGDTVTISCRASQGISKYLNWYQQKPGKAPKLLIYYASSLASGVPQRFSGSGSGTDFTLTINSVEAEDAGTYYCQQYNSYP
Heterocephalus glaber V173 igkv AHKG01029318.1 23130 ARCDIQLTQSPSSLSASIGDTVTISCQASQGINYYLAWYQQKPGKAPKLLIYDASNLESGVPARFSGSGSGTDFTLTINSVVVEDAGTYYCQQYNSYP
Heterocephalus glaber V174 igkv AHKG01029381.1 3756 ARCNIQMIQSPSSFLASIGDTVTISCRASQGINNYLVWYQQKPGKPPKLLIYLASNLESGVPARFSGSGSGTDYSLTINSVEAEDVGTYYCHQHNSYP
Heterocephalus glaber V175 igkv AHKG01029394.1 12121 ARCDIQMTQSPSSHLASIGDTVTISCHASQGINKYLSWYQQKPGKAPKLLIYYASNLESGVPARFSGSGSGTDFTLTINSVEAKDVGTYYCQQGYNP
Heterocephalus glaber V176 igkv AHKG01029395.1 6861 TRYDIQMKQSPSSLSVSPGETVTITCRTSQNSYSGLHWYQQKPGKVPKLLIYAASSLQSGVPPRFSGSGSGTHYSLFFSSVEAEDVATYYCQHDYEFP
Heterocephalus glaber V177 igkv AHKG01029398.1 7932 AICDIQMTQSPFFLSVSPGDRVTITCQASQDIYSNLEWYQQKAGKVPKLLIYSASNLQSGVPPRFSGSGSGTDYSLTISSLKPEDVAVYYCAQSYNYP
Heterocephalus glaber V179 igkv AHKG01029434.1 4137 VLCDIQMTQSPSYLSASLGDTVTITCQASQSVSSYLNWYQQKPGKAPTLLIYNSNNLQSEVSSRFSGSGSRTDFTLSISNLEPEDVATYYCLQHNSSP
Heterocephalus glaber V180 igkv AHKG01029446.1 20412 GRCDIQMTQSASSLSGSVGDTVAITCTASQNIYSNLQWYQQKPGKAPKLLIYGASSLASGVPPRFSGSGSGTDYTLTISNLEPEDVGTYYCQQDSRYP
Heterocephalus glaber V181 igkv AHKG01029446.1 30625 VRCDIQMTQSPSSLSAPLRDTVTIFCRASQSISNELDWYQQTPGKVPTLVIYSASSLSSGVPSMFSGSGSGRDFTLTISQLEPEDFATYYCQQDYINP
Heterocephalus glaber V182 igkv AHKG01029450.1 36601 TTGEIVMTQTPATLSLSPGEEATLTCKASQGISSYLAWYQQKPGQAPRRLIYGASSRATGVPTRFTGSGSGTDFTLRISSLEPEDVAIYYCQQGYSG
Heterocephalus glaber V183 igkv AHKG01029451.1 24547 ASCDIQMTQSPSSLSASEGNSITITCRASQGISSYLNWYQQKPGKAPKLLIYRASSLESGVPSRFSGSGSGTDFSLTINSVEPEDVATYYCQQGNNWP
Heterocephalus glaber V184 igkv AHKG01029464.1 8002 SSGEIVLTQSPAVLSLSPEEKATITCQASQGISSSLHWYQQKPNQAPKLLIKYASESISGVSSRFSGSGSGTDFTLTISSLEPEDVATYYCQQSRSYPS
Heterocephalus glaber V185 igkv AHKG01029468.1 11247 ICGDIIMTQSPGSLAVSAGESTTISCKSSQSLLSSSNQKNYLSWYQQKPGQSPKLLISWASTQVSGVPDRFTGSGSGMDFTLTISNLQPEDVADYYCQQGYSAP
Heterocephalus glaber V186 igkv AHKG01029468.1 15176 SNGQIVLTQSPASLAASPGDKVTITCTASSSVSTNYLHWYQQKPGASPKLLVYRTSNLASGVPARFSGSGSGTSYSLIISNVEAEDAATYYCQQNSSS
Heterocephalus glaber V187 igkv AHKG01029480.1 828 ARGDIQVTQSPTSLSAAVGDTVTITCRASEDISYALNWYQQKSGKAPKLMIKAADELAPGVPPRFSGSRSGTDFTLTISSLEPEDVATYYCLQAYSTP
Heterocephalus glaber V188 igkv AHKG01029480.1 4496 ARYDIQLTQSPTSLSAAVGDTVTITCRASEDISIGLNWYQQKPEKAPKLFIYAVDNLETGVPSGFHGSGSGTDFTLTISSLQCEDVATYYCLQYYEDP
Heterocephalus glaber V189 igkv AHKG01029483.1 12525 ARCDIQVTQSPTSLLAAVGDTVTITCRASEDIGYGIHWYQKKSGKAPKLLVYVADELASGVPKRFSGSGSGTDFTLTISSLEPEDVATYYCLQGYDTP
Heterocephalus glaber V190 igkv AHKG01029496.1 8566 STGDVVMTQTPLSLSITPGESASISCRSSQSLLHSNGNTYLYWLVHKPGQAPRGLIYRISNQYSGIPDRFSGSGSGTDFTLKISRVEAEDAGVYYCWQA
Heterocephalus glaber V191 igkv AHKG01029497.1 590 STGDALINQTPFSLSITSGEPASISCRSSQSLLHSSGKIYLNWIVHKPGQSPQQMIYQVTKRDSWVPGRFSGSGSGTDFTLKISRVEAEDTGVYYCVQG
Heterocephalus glaber V192 igkv AHKG01029499.1 2910 STGDVVMTQTPLSLSITSGEPASISCRSSQSLLHSNGKTYLNWIVHKPGQSPRRMIYQVTNRDSWVPDRFSGSGSGTDFTLKISRVEAEDAGVYYCVQG
Heterocephalus glaber V193 igkv AHKG01029500.1 3370 CRGDVVMTQTPLSLSITPGESVSISCRSSQSLLHSNGNTYLHWFVHKPGQAPRGLIYRISNWYSGIPDRFSGSGSGTDFTLKISRVEAEDAGVYYCVQS
Heterocephalus glaber V398 trbv AHKG01070610.1 20940 ARAQTIHQWPVTKVQLVGSPLSLECIVKGKSSPNLYWYQQVAGGALQLLFYSIGVGEVFSEVLRNLSASRPQDGQFILSSKKLLLNDSGFYLCAWS
Heterocephalus glaber V449 trav AHKG01082258.1 2555 MCPLTGAAGQTIEQPTELMAMEGASAQVNCTFQTSGFNGLSWYQQHEGRAPVFVSYNVLDGLQNKSRSSTFLHHSDGYSYLLLKELQMKDSASYFCAVR
Heterocephalus glaber V450 trav AHKG01082267.1 25888 TGSLAETTQPISMDSYEGQDVNLTCNHPNIATNEYIFWYRQVHHQGPRFVIQGYKTNGANEVASLFIPEDRKSSTLSLRHVALRDTGVYYCIVRG
Heterocephalus glaber V451 trav AHKG01082268.1 4984 MSGGEQVEQHPSFLSVLEGDRAVISCTYTDSAFSNFYWYKQEPGTGLQLLIYIISNVDNRKDRRFIVFLNKKDKHLSLNITAACPGDSATYFCAA
Heterocephalus glaber V452 trav AHKG01082269.1 1679 DARAQSVSQPDAQVIVREGAPLELRCKYTYAGVVYLFWYVQYPGQGLQPLLKYYSGDTRVQGIKGFEAEYSKSQSSFHLRKRFAHWSDTAEYFCALS
Heterocephalus glaber V453 trav AHKG01082270.1 2504 RTYGDSVTQTEGQITVPEEAMLVINCTYTATGYPALFWYVQYPGEGPQLLFRVSKANNKGSNKGFEATYDKETSSFHLKKSSVQEPDSAVYYCALS
Heterocephalus glaber V454 trav AHKG01082273.1 3629 RNNGDSVTQTEGQVALSEKDSLTLNCSYESSLYPALFWYVQYPGESLQLLLKATKDKEKGSKKGFAATYNKEASSFHLEKASVEQSDSAVYYCAVS
Heterocephalus glaber V455 trav AHKG01082275.1 11392 RVNGDSVTQTEGQVTLFERASLTVNCSYETKQYLNLFWYVQYLGEGPQLLLKAMKANDQGRNKGFEATYDKATSSFHLEKASVQESDSAVYYCALG
Heterocephalus glaber V456 trav AHKG01082275.1 22544 SRGEQVEQRPSTLRVQEGDSSIINCTYSDSASSYFPWYKQEPGKGPQFIIDIRSNKEKEQKQRLIVLFNKAAKHVSLHITATQPGDSAVYFCAAS
Heterocephalus glaber V457 trav AHKG01082275.1 31790 GIHGDSVTQMPGQTTVSEGVFLTVNCTYTAKATNYPSLFWYVQYPGKTPQLLFRVSKAKDKGGNKGFEATYDKETSSFHLEKFSVQESDSAVYYCALS
Heterocephalus glaber V458 trav AHKG01082276.1 5403 VSSQQEVEQSPESLSVLEGAIASLNCTYRDSASQYFRWYRQYPGKGPEFLVSMYSSGDKEEGRFTMQLNTASRHVSLYIRDSQHSDSATYLCAV
Heterocephalus glaber V459 trav AHKG01082276.1 22285 VNNQRGEVPQALNIQEGENATMNCSYKSSIMNLEWYRQDASGGPVLLILMRSNEKEKHSGRLRATLETSTKRSSLSITAARAADTAAYFCATD
Heterocephalus glaber V460 trav AHKG01082276.1 27488 TTMGQKIVQAQTEISVLEKEAVSMDCVYETSDPTYSLFWYKQPPSGEMILLIRQDSYSEHNATEGRYSLNFQKAASSIRLTITASQLLDSAVYFCAGRE
Heterocephalus glaber V461 trav AHKG01082276.1 36750 WSHGDSVTQTEGPVILSEWAPLILNCTYQTTYSASFLFWYVQYFNTAPQLLLKSTTENQRTENQGFEATLVKSHSSFHLQKPSLQLADSAVYYCALG
Heterocephalus glaber V462 trav AHKG01082276.1 51171 VRGMQVEQSPPALILQEGANSTLSCSFSASVTTVQWFRQDPGGLLSSLFYIPSGTKQNGRLEVTTVPKERHSSLSISSSQPTDSATYFCAAAHSAPL
Heterocephalus glaber V463 trav AHKG01082277.1 2823 VSSQQKEVEQSPETLSVPEGAIASFSCTYRDSASQNFRWYRQYPGKGPKLLMSIYSSGDQEEGRFTVQLNRASRHVSLYIRDSQHSDSATYLCAA
Heterocephalus glaber V464 trav AHKG01082277.1 13496 VSSQQKDVEQSPESCNVLEGAIVSLNCTYRSSASDYFTWYRQFSGKGLVFLMAAYSKDDKKEGRFRMQVSKASRYVSLDIRDCQQSDSATYFCAVR
Heterocephalus glaber V465 trdv AHKG01082285.1 16996 SREVTQVQPSISKLVWEGVALDCSYETIWSFYDVFWYKQLPSGKMIFLIHQRSNSGNARSGRCSVRFQKAANCISLIILPLLMEDSAKYFCVLGE
Heterocephalus glaber V466 trav AHKG01082285.1 25049 GSGAQSVAQPDRHVAVWEGDPLLLRCNYTYSGAPYLFWYVQYPGQGPQFLLRYMSGAPVVTGIRDFKAEFKKSETSFHLEKSSAHWSDTATYYCAVS
Heterocephalus glaber V467 trav AHKG01082285.1 35875 PSTEQLQQSPGFLSIEEGKDVTMHCNSSSVFPKIQWYRQKPGGGPVFLMALVKGGEVKEQKSLTAQFGEERKSSSLRITTAQPGDSGTYICAG
Heterocephalus glaber V468 trav AHKG01082286.1 26767 VNGQQLNQSPQSITVQEGEDISMNCSSSSTFSNFQWYKQNPGEGLVLLLILYKSDELSRNGRLTAQLGGTRKDSFLSLQASKPDDTATYFCAE
Heterocephalus glaber V469 trav AHKG01082287.1 21156 GSNGDSVTQTEGQVTLSERTSLTVNCSYKTTQYPALFWYVQYPGEAPQLLLKASKDKDKGSKKGFEATYDKETSSFHLQKVSVQESDSATYYCALS
Heterocephalus glaber V470 trdv AHKG01082288.1 3021 PSVGQKVTQVQPPTSRPEGETVTLDCSYETSWNSHYIFWYKQLLSGEMIFLIRQSSSATTGQSGRYSVRKVGYSISYSMGLTISTLQMDDSARYFCALWE
Heterocephalus glaber V471 trav AHKG01082288.1 23960 GVRGVEVEQSPSASSLQEGTSSKLRCDFSSVMNTVHWFRQNPGGGLISLFFMAPGTKQNGRLESTFNFKERYSTLQITASDLGDSGFYLCAGE
Heterocephalus glaber V472 trav AHKG01082288.1 30942 SSIAQKVTQAQPPMSVQEMETTILHCTYDTSDTNYGLFWYKQPGSGEMVFLIRQESYSQQNATEGRYSLNFQKASKSIQLVISASQLEDSAVYFCALRE
Heterocephalus glaber V473 trav AHKG01082289.1 476 VSSQQKEVEQSPESLIVPEGAIASLNCTCRDSAFRNFNWYRQYPGKGPELLMSMYSSGDKEEGRFKMQLNTASQLVSLHIRGSQHSDSAVYLCAV
Heterocephalus glaber V474 trav AHKG01082289.1 11622 VSTKQKEVEQSPETLSVPERAMVSLNCTYRDSASQNFRWYRQYPGKGPELLMSMYSIGDQEEGRFTMQLNRASRHVSLYIRDSQHSDSATYLCAV
Heterocephalus glaber V476 trav AHKG01082291.1 13823 MNGQQVKQFPQFHHIWVGQNFTMYCNSSSTSSTLQWYKQKPGGCPVFLLMLTKSGEVKKQERLTAQFGEKRKDSSLHITATQTTDVGTYFCAV
Heterocephalus glaber V477 trav AHKG01082291.1 22577 GSRAQSVAQPDHHVTVSERAPLLLKCNYTYGATVSLFWYVQHPGRGFQLLLKYVAGPSLVTGIRGFKAEFKKSETSFHLEKASVQWSDAAMYFCAVS
Heterocephalus glaber V478 trdv AHKG01082293.1 1857 SSVAQKVTQVQSAISRPEREAVTMDCSYETTFSAYYIFWYKQLPKGDMIFLIRQHSSDLSAKSGRCSLNFQKVAKAISLTISDLEMGDTAKYFCAFR
Heterocephalus glaber V479 trav AHKG01082294.1 8493 RICGQSVTQTRGQVSTAEGGLLTINCTYTASGYPTLFWYVQYSGEGPQLLLKAVTVNEKGRNKGFEATYDKATSSFHLEKASVQESDSAVYYCALS
Heterocephalus glaber V480 trav AHKG01082295.1 12791 GSNGDLVTQTEGKVTLSEEALLTVNCSYDTTGFPVLFWYVQYPRGAPQLLLKATKAKDKGSNKGFEATYDKATSSFHLEKASVQESDSAVYYCALG
Heterocephalus glaber V481 trav AHKG01082295.1 31084 RTHGDSVTQMRGQVTLSEHSVLTINCTYTASRYPALFWYVQYPGEGPQVLLKAMKANEQGRNKGFEATYDKETSSFHLEKASVQESDSAVYYCALG
Heterocephalus glaber V482 trav AHKG01082301.1 3137 QQKEKHDQQQVKQSPSFLTNQEGKISILNCTYEQSTFDYFPWYRQFPGKGPTFLIAISSYTNEKQDGRFTIFHRGSSKHLSLHISDSQLEDSATYFCAA
Heterocephalus glaber V483 trav AHKG01082306.1 7037 RHGQQVKQTPQFQYIKEGENFTTYCNFSGILNNLQWYKQKPGGCPVFLMILTKGAEVKKQERLTAQFGGKRKDSSLHITATQTTDVGTYFCAV
Heterocephalus glaber V484 trav AHKG01082314.1 2875 GSRAQSVAQADLHVTVIEGAPLQLKCNYNYGATPYLFWYVQHPGQGLQLLLKYLGGASLIKGARSFEAEFKKSENSFHLEKTSAHWSDTAMYFCALS
Heterocephalus glaber V485 trav AHKG01082318.1 12982 IRAQIKVEQSPQVQILQERRNSSLTCNYSTSINSMQWFQQNQEGRLISLFYIASGEQQKGRLKATVNFKERYSQLYIRDSQPEDSASYFCAVQ
Heterocephalus glaber V486 trav AHKG01082324.1 13651 SSGQEKDVVQSPSILDVWEKETAIINCSYTDVTFSYFPWYKKEEGKGPILLTEIRSNLDKKQERRFTVILNKTAKQVSLHITETQPGDSALYFCAA
Heterocephalus glaber V487 trav AHKG01082326.1 2315 VSSQELRQSQSLITQEGEDLTINCNSSKSLYVLHWYRQKNDGSLAFLVMLQKGGDKKSHGNITAKLDEKMQQSSLHITGAQPSHSGTYFCGGS
Heterocephalus glaber V488 trav AHKG01082327.1 4320 VSGQQLNQSPQSIITKEGEEISMNCSSSTTFNFLLWYKQDPGEGLVLLITLYKSGELITSGKLTAQLDGTRKNSFLSIPDSKPDDGGTYFCAG
Heterocephalus glaber V489 trdv AHKG01082329.1 2962 ASVAQKVTQSQPEISIQEAATVTLDCTYDPTESNYYLFWYKQPPSGQMIFIIRQEAYKHQNAAEDRFSVNFQKAAKSFSLKISDSELWDAATYFCALI
Heterocephalus glaber V490 trav AHKG01082331.1 1769 ISMTQTVIQSQPEISIQEAATVTLDCTYDTTESNYYLSWYQQLPSGQMIFIIRQESYKQQNTTKDRFSVNFQKAAKSFSLKISDSELRDAAIYFCAFA
Heterocephalus glaber V491 trdv AHKG01082337.1 10057 SSNAQRIDQPTDVVYKQEGESVTIDCKITFSFSYYIMYWYQQPTSGKMIYLTGLNSEGWSSKEGRYSVVFQKALEVLKLTISALTLSDSAVYFCTITI
Heterocephalus glaber V608 ighv AHKG01109151.1 5891 VLSQVQLQESGPGLVKPSETLSLICTVSGFSLTSYNVHWVRQAPGKGLEWIGVIWSGGSTNYNSALQSRVSISRDTSKSQVSLTLSSLRSEDTAVYYCAR
Heterocephalus glaber V612 ighv AHKG01111655.1 991 PDLVKPSQTLSLTCTVSEFSITACGYGWSWIRQPPGKSLEWMGYIAYSGGTGYSPSLKSHISISRDTAKNQFSLWLNSVTTEDTAMYYCARYTVIN
Heterocephalus glaber V738 igkv AHKG01029343.1 13212 ARCDIQMTQSPSFLFASLGDTVIINCQVSQDITTWLDRYQQKKWDRPKPLIYKASNLQSGVPPRFSGSGSGTDFTLIISRLQPENGATYYCM
Heterocephalus glaber V740 igkv AHKG01029411.1 25750 ARCDIQMTQSPSSLPASIGDTVTISCRASQGISKYLAWYQQKPGKAPKLLIYYASSLASGVPTRFSGSGSGTDFTLTINSVEAEDVGTYYCQQGNSFP
Heterocephalus glaber V741 igkv AHKG01029411.1 8082 ARCDIQMTQTPSSLSVSVGNTVTIKCQASEDIKQWLSWYQQKPGKAPKPLIYAASNLQSGVPSRFSGRGSGADYSLTINSVEAEDAGTYYCQQYDKLP
Heterocephalus glaber V742 igkv AHKG01029429.1 11486 ARCDIQMTQSPSSLPASIGDTVTISCRASQGINNYLAWYQQKPGKAPKLLIYYASSLASGVPTRFSGSGSGTDFTLTIKSVEAEDVGTYYCQQGNSLP
Heterocephalus glaber V743 igkv AHKG01029469.1 1280 TRCDIQMTQSPSSLSSSVGDKVIITCRASEDISKWLAWYQQKPGKVPKLLIYYAINLGSGVPSRFSGSGFGTDYSLTINSVETEDVGTYYCQPG
Heterocephalus glaber V744 igkv AHKG01029483.1 624 STGDTVLTQSSASLSVSPGQRTSISCRASQSVNAYGIGIMHWYQQKPGQPPKLLIYEASNQAPGVPERFSGSGSETDFTLTIHPVVAEDAAHYYCQ
Heterocephalus glaber V745 igkv AHKG01029486.1 4250 SRCDIQMTQSPSSHSASIGDPVTINCKASQNIGSILAWYQQSPGKAPKLLIYGASNLESGVPPRFSGSRSGTDFTLTISSLQLEDVATYYCLQGYSTP
Heterocephalus glaber V746 igkv AHKG01029487.1 27163 SRCDIQMTQSPSSHSASIGDTVTTNCKASQNIGRSLAWYQQKPGKAPKLLIYAASSLESGVPPRFSGSGSGTDFTLTISSLEPEDVATYYCQQYSSYP
Heterocephalus glaber V747 igkv AHKG01029492.1 5298 AYGAITVTQSPRSLTGSVGETVAINCKSSQSLLWSSNNKNYLAWYQKKPEQAPRLLISWASTRESQIPDRFIGSGSGSDFTLTINNLQAEDVGDYYCQQYYENP
Heterocephalus glaber V748 igkv AHKG01029493.1 3018 VCGDIVMTQSPDSLAVSAEETVTIRCKSSQSLLYSNNNKNYLSWYQQKLGQSPKLLIYWASTRESGVPDRFSGSGSGTDFTLTISSLQAEDVADYYCLQSY
Heterocephalus glaber V900 trdv AHKG01061163.1 23159 AHTQVVQVNDSMYGFIGTDVVLHCSFANPTPSVKITQVTWQKVTNGTKQNVAIYNPAMGVSVLAPYRERVQFLRPSFTDGTIRLSRLELEDEGVYICEF
Heterocephalus glaber V944 trbv AHKG01070612.1 12356 IKGAEVTQFPRYRVARTGEKLTLQCSQNMNYLTMYWYQQNPGFGLQLIYYSPGTGSIEKGKVPEGHLVSRSETQYFPLTLVSTSANQTSVYFCTS
Heterocephalus glaber V945 trbv AHKG01070612.1 5100 PLETQVTQTPRYLIAKTGKSTIVTCSQNMNHDYMHWYRQDPGLGLKLIYYSINVKIIEKGDVPDGYSVSRKEESFLLTVDQVNTSYTSVYFCATSA
Heterocephalus glaber V946 trbv AHKG01070615.1 2076 FSDDEVTQVPRHLVKREGQRAKMSCVPKNGHNAVYWYQQKQNEELKFLISFLNKAVIDQVDMAKTRFLTEYPQNSPCSLEIKSSELEDSALYLCASSQ
Heterocephalus glaber V947 trbv AHKG01070618.1 914 FGLCALVSQLPRRAICKTGSSVKIQCRCVDFQAAMVIWYRQFPKQGFTRMAISNEGSSVTYEPGFKRAKFPISHPNLTYSSLTLTSTHPEDSSFYFCGAS
Heterocephalus glaber V985 trav AHKG01079621.1 7072 LTSAAVTQNPRHLVRRRGQEVILSCNPEKKHLYVYWYQQLPEEGPKFLVYLQEEEVLDDSGIRNSRFFAEFPKEGPKVLKIQTAELEDSAVYFCAGSV
Heterocephalus glaber V986 trbv AHKG01079621.1 4048 TMNGGITQTPKFWLIEKGKDVTLGCEQNLNHEAMYWYRQDPGRGLRLIYFSQFVSDIQEGDAAEGYTVSREEKNFFPLTVTSTQKNQTAVYLCASSV
Heterocephalus glaber V987 trbv AHKG01079625.1 43644 FMDAGIIQTPRYCIICTGKKMTLQCSQNMNHYGMFWYRQDPGQGLRLLHYSGSVSSTAKGDAPEGYSVTRDENEHFPLTLESASTNQTSMYLCASSE
Heterocephalus glaber V988 trbv AHKG01079625.1 32561 LVDAGVTQFPRHLIKAEGGKSTLKCYPDSGHRSVSWYQQDPGQGPQFLAEYFEMSQRTKGSMPGRFSAQQFGDYHSELNMSTLQLADSAVYLCASSL
Heterocephalus glaber V989 trbv AHKG01079625.1 29743 HMEAGITQSPRHKITKTKEKVTLKCHQTNNHDYMYWYRQDPEHGLRLIHYSYEVDRVDKGEVPNGYSVSRANTEDFPLTLDSATLSQSSVYFCGSSF
Heterocephalus glaber V990 trbv AHKG01079625.1 23373 HTNAGVTQTPKQEVTKRGQAVTLRCEPISDHKALYWYRQTVVRRLELLTYFRSLTLMNEGEMPKDRFTAQMPNASFSILKIQPAEPSDSAVYLCASSL
Heterocephalus glaber V991 trbv AHKG01079626.1 21264 PTNTRITQTPRHLIMETTNTKSLKCEQHLKHNAMYWYKQNAKKPLELMFLCNFQEVVQNETVPSRFLPRCPDSSHFYLDLTALEPQDSAVYLCASSQ
Heterocephalus glaber V992 trbv AHKG01079626.1 19581 HMEPRVKQTPSHEVTNMGQNVVLRCEPISNHLYIYWYRQTAEKGMEFMVYLYNNNPGEKADFFKDRFSAEMSKGSYSILKIQPVQLEDSAMYLCASSL
Heterocephalus glaber V993 trbv AHKG01079626.1 7350 PGNAGISQTPKFQVLRTGQRMTLSCTQDLKHDSMYWYRQDPGLGLRLIYYSYDVNNTKKGEVPDGYTVSRLSSKNFPLTLESASPSQASVYFCASSY
Heterocephalus glaber V994 trbv AHKG01079626.1 4071 HTEAGVSQSPSYRVTKKGQNVTFGCAPISGHGFLYWYRQTFEQGLEFLTYFQNELASDTSKMPPERFSAERPEGTFSNLKIQGVQQGDSAVYFCAS
Heterocephalus glaber V1046 ighv AHKG01088704.1 1293 AHAQVQLVQSGSEVRRPGTSVKVSCKASGYTFTSYWLNWVRQGPGQGLEWIGRIYPGDGDTRYAQKFQGRVTLTSDTSSSTAYMELSSLRSEDTAVYYCA
Heterocephalus glaber V1047 ighv AHKG01088710.1 1112 VQAEVQLLESGGGLVQPGGSLRLSCAASGFTFSDYWMSWIRQAPGKGLEWVGEINQNSGTIRYPDSVKGRFTISRDNAKNTLYLQMNSLKTEDTAVYYCAR
Heterocephalus glaber V1048 ighv AHKG01088711.1 25801 VLSQVQLQESGPGLVKPSETLSLICTVSGFSLTSYNVHWVRQAPGKGLEWIGVIWSGGSTNYNSALQSRVSISRDTSKSQVSLTLSSLRSEDTAVYYCAR
Heterocephalus glaber V1049 ighv AHKG01088721.1 4301 VLSDLTLQESGPSLVKPSQSLSLTCTVTGGSLSSYAWSWIRQPPGKALQRMGDYYLESTSYNPDLQDRISITADTGKNQIFLQLNSVTTEDTAVYYCA
Heterocephalus glaber V1050 ighv AHKG01088732.1 43223 VLSDPTLRESGPSLVKPSQTLPLTCTVTGGSVTSSYYWSWIRQPPGKALQWMGWWSGSTNYNPAFEGRISITADTAKNQFFLQLNSVTTEDTAVYYCA
Heterocephalus glaber V1051 ighv AHKG01088732.1 28170 VLSQVQLQELGPGLVKPSQTLTLTCTISGDTVSSTSATWDWIRQPLGRSLQWLGRTYYRSNWNYEYAPSLQGRLTITPDTSKNQFSLQLSSVSTEDTAMYYCAR
Heterocephalus glaber V1052 ighv AHKG01088734.1 4241 VHGQVQLVQSGAEVRRPGASVKVSCKASGYTFTNYFMHWVQQSPGQGLEWIGRIDPSDGETKYAQKFQGRLSLTADTSSTTAYMELSDLRSEDTAMYYCA
Heterocephalus glaber V1053 ighv AHKG01088744.1 759 VQAEVQLVESGGGLVQPSGSLKLSCVASGFTFSSYGMHWIRQAPGKGLEWISAISSAGSNTYYSDSVKGRFTISRNNGKNTLYLQMNNLQTEDTALYYCAR
Heterocephalus glaber V1054 ighv AHKG01088755.1 3887 VQAEVQLVESGGDLVQPGGSLRLSCAASGFTFSNYWMNWVRQAPGKGMEWVGNINQNGGSTNYPDSVKGRFTISRDNGKNTLYLQMNSLRTEDTAVYYCAR
Heterocephalus glaber V1055 ighv AHKG01088756.1 16114 VQCEVRLVESGGDLVPPEGSLKLSCVASEFTFSSYDMSWVRQAPGKGLEWISYISNTGGTTRYAESVKDRFTISRDNGQNTLYLQMNRLRTEDMAMYYCAR
Heterocephalus glaber V1056 ighv AHKG01088764.1 20485 AAGGVRGRLSNAWGGGSLRLSCAASGFTFSDYWMSWIRQAPGKGLEWVGEINTGGGSTYYPDSVKGRFTISRDNAKNTLYLQMNSLRTEDTAVYYCTR
Heterocephalus glaber V1057 ighv AHKG01088764.1 10045 VLSDLTLRESGPSLVKPSQTLSLTCTVTGGSISSYAWSWIRQPPGKALQWMGYYAGGSTNYNPAFQDRISITGDAGKNQIFLQLNSVTTEDTAVYYCA
Heterocephalus glaber V1058 ighv AHKG01088764.1 3006 VLSQVQLQELGPGLVKPSQTLTLTCTISGDTVSSTSAAWNWIRQPLGRGLQWLGRTYYRSNWNYEYAPSLQGRLTITPDTSKNQFSLQLSSVSTEDTAMYYCA
Heterocephalus glaber V1059 ighv AHKG01088767.1 10071 VQAEVQLMESGGNLVQPGKSLKLSCVASGFTFSDYYMHWVRQAPGKGLEWISYISGGSGDIQYADSVKGRFTISRDNAKNTLYLQMNSLKAEDTAVYYCAR
Heterocephalus glaber V1060 ighv AHKG01088770.1 2567 VLSQVQLQESGPGLVKPSQALSLICSVSGYSITSGYYWSWIRQPQGKGLQWMGWISSGGSTAYNPSLKSQISISRDTSKNQFSLQLNSVTAEDTAMYYCAR
Heterocephalus glaber V1061 ighv AHKG01088771.1 6531 VQSEVQLMESRGGLVQSGESLRLSCAASGFIFSDYWMSWVGQAPGKGLEWVALLRDKGKSHTTEYATYVKGRFTISRDDYKSTIYLQMNSLKVGDIAMYYCAR
Heterocephalus glaber V1062 ighv AHKG01088779.1 3776 VLSQVQLQESGPDLVKPSHTLSLTCTVSGFSITTSGYCWHWVRQASGKGLEWVGAICASGSTYYSLSLKSRVTITKDTSKNQFSVQMNSVVSEDTAVYHCAR
Heterocephalus glaber V1063 ighv AHKG01088783.1 1861 VQCEVQLVESGGGLVQPGGALKLSCAASGFTFSNYYMSWVRQAPGKGLEWVGLIRNKGNSYTTEYATSVKGRFTISRDDSKSTLELQMNSLKVEDTAMYYCTR
Heterocephalus glaber V1108 ighv AHKG01100653.1 38125 QLVQPGAEVKRPGESVKVSCKGSGYTFTDYAINWVKQVPGKGLQWMGWINTKTSKPTYAEGFTGRFVFSLDASVSTAYLQISSLQAEDMAVYYCT
Heterocephalus glaber V0 trbv AFSB01006593.1 4229 ARAQTIHQWPVTKVQLVGSPLSLECIVKGKSSPNLYWYQQVAGGALQLLFYSIGVGEVFSEVLRNLSASRPQDGQFILSSKKLLLNDSGFYLCAWS
Heterocephalus glaber V2 igkv AFSB01025996.1 5594 VCGDIVMTQSPDSLAVSAEETVTIRCKSSQSLLYSNNNKNYLSWYQQKLGQSPKLLIYWASTRESGVPDRFSGSGSGTDFTLTISSLQAEDVADYYCLQSY
Heterocephalus glaber V3 igkv AFSB01025999.1 3964 AYGAITVTQSPRSLTGSVGETVAINCKSSQSLLWSSNNKNYLAWYQKKPEQAPRLLISWASTRESQIPDRFIGSGSGSDFTLTINNLQAEDVGDYYCQQYYENP
Heterocephalus glaber V4 igkv AFSB01026003.1 8135 SRCDIQMTQSPSSHSASIGDTVTTNCKASQNIGRSLAWYQQKPGKAPKLLIYAASSLESGVPPRFSGSGSGTDFTLTISSLEPEDVATYYCQQYSSYP
Heterocephalus glaber V5 igkv AFSB01026009.1 2438 SRCDIQMTQSPSSHSASIGDPVTINCKASQNIGSILAWYQQSPGKAPKLLIYGASNLESGVPPRFSGSRSGTDFTLTISSLQLEDVATYYCLQGYSTP
Heterocephalus glaber V6 igkv AFSB01026100.1 12200 ARCDIQMTQSPSSLPASIGDTVTISCRASQGINNYLAWYQQKPGKAPKLLIYYASSLASGVPTRFSGSGSGTDFTLTIKSVEAEDVGTYYCQQGNSLP
Heterocephalus glaber V7 igkv AFSB01026114.1 32954 ARCDIQMTQTPSSLSVSVGNTVTIKCQASEDIKQWLSWYQQKPGKAPKPLIYAASNLQSGVPSRFSGRGSGADYSLTINSVEAEDAGTYYCQQYDKLP
Heterocephalus glaber V8 ighv AFSB01041892.1 3730 VQCEVRLVESGGDLVPPEGSLKLSCVASEFTFSSYDMSWVRQAPGKGLEWISYISNTGGTTRYAESVKDRFTISRDNGQNTLYLQMNRLRTEDMAMYYCAR
Heterocephalus glaber V9 trgv AFSB01077612.1 1355 GLGQLEQPKIVISRATDKSASIPCKATTNNFKSVDIHWYRQKPKKEFEHLMYVRTAYNQRPLGGTNKKLEASKNFDTFASTLKINVLKKEDEATYYCTYWD
Heterocephalus glaber V10 iglv AFSB01085163.1 8981 SMASYVLTQPTSVSVALGQTATITCSGSALPQKYAYWFRQNPGQTPVQIIYEDSKRPSGIPERFSGSSSGTTATLTISGAQPEDEADYYCFSADSDDKH
Heterocephalus glaber V11 iglv AFSB01085165.1 11691 SAASYVLTQPSSVSATLGQTARMTCEGNSIGNKLVQWYQQRPPQAPMLVIYDDDTQPSGIPDRFSGANSGNTATLTITGAQAEDEADYYCQVWDGSN
Heterocephalus glaber V12 iglv AFSB01085171.1 2800 SMASYKLTQPSSLSVTWGKTARITCQGYSIRSYTVNWYQLKPGQAPVMIIYYDDSKPSGIPDRFLGSNKGNTATLTISKAQFEDQADYYCQVWDNSDK
Heterocephalus glaber V13 trgv AFSB01085412.1 1967 SQTSSGLEGGMISISRKRGSYIVITCDIHEEGNYIHWYLFRVGQAPHRLLYYDFFASKPVVDSEFSPGKYHAYEGTKKSYKFVLRNVEESDSGVYYCAIWA
Heterocephalus glaber V14 trgv AFSB01085416.1 1400 GLGVTKMEQSQISISIEENKRVDIPCKVSGDYFEDEAIHWYLQKQDQALEHLIQVVSTTTPAQEKINRVSATKDLATRSSVLTIKFVAKEDVGLYYCAMWD
Heterocephalus glaber V15 ighv AFSB01091650.1 502 VQCEVQLVESGRGLVQPGGALKLSCAASGFTFSNYYMSWVRQAPGKGLEWVGLIRNNGNSYTTEYATSVKGRFTISRDDSKSTLELQMNSLKVEDTAMYYCTR
Heterocephalus glaber V16 igkv AFSB01101461.1 26324 SIFTVFISWGKRSPSLLSLSPGEKVTITCRASQNIYNGLCWYQQKAGKAPKLLIYAARSFQSGVSLRFSGSGSGTDYTLTISNLETEDVATYYCQQYYNFP
Heterocephalus glaber V17 igkv AFSB01101470.1 3039 ARCDIQMTQSPSSHLASIGDTVTISCHASQGINKYLAWYQQKPGKAPKLLIYYASNLESGVPARFSGSGSGTDFTLTINSVEAKDVGTYYCQQGYNP
Heterocephalus glaber V18 igkv AFSB01101473.1 12154 AICDIQMTQSPFFLSVSPGDRVTITCQASQDIYSNLEWYQQKAGKVPKLLIYSASNLQSGVPPRFSGSGSGADYSLTISSLKPEDVAVYYCAQSYNYP
Heterocephalus glaber V19 iglv AFSB01106439.1 12500 SMAQAVLTQPPSLSKVSGETAILTCTGNSNNVGYEGAGWVQLQQQGQSPKTLVNRNNNRLSGIPERFSGTRSGNSASLTITGIQPEDEADYYCAAWDKSQSA
Heterocephalus glaber V20 iglv AFSB01106441.1 2813 VVSQTVVTQEPSMSVSSGETVSLNCGLSSGSVSTGNYPSWYQQNPGQAPHLFIYQTDKRPSGVPDRFSGSIAGNKAALTITGAQPEDEADYYCLLYMGSGN
Heterocephalus glaber V21 iglv AFSB01106441.1 11429 SFCQPVLTQSPSASASLGASVKLTCTLSNEHSSYTIAWFQQHPGQSPVYVMYVGSGGNYNKGDRIPDRFSGSSSGADRYLTISNLQSEDEADYICGVSH
Heterocephalus glaber V22 iglv AFSB01106442.1 372 TWAQSGLRQEASLSQSVGQTISFSCTGSSNNIGTYAAGWYQQIPGAAPKTVMIGSSRPSGIPDRFSGSKSGNTASLRISNVQAEDEADYYCSSWDYSQNA
Heterocephalus glaber V23 iglv AFSB01106453.1 371 AASQAVVTQESSLSTTPGGTVTLTCGSSTGAVTTSNYAAWVQQKPYQAPQGLIDDTSNRLPGIPARFSGSLLGDKAALTIAGAQPEDEASYYCALWYSNH
Heterocephalus glaber V24 iglv AFSB01106457.1 7175 AASQAVVTQESSLSTTPGGTVTLTCGSSTGAVTTSNYAAWVQQKPYQAPQGLIGDTSNRVPGIPARFSGSLLGNKAALTITGAQPEDEASYYCALWYSSH
Heterocephalus glaber V25 igkv AFSB01183225.1 17683 ARCDIQLTQSPSSLSASIGDTVTISCQASQGINYYLAWYQQKPGKAPKLLIYDASNLESGVPVRFSGSGSGTDFTLTINSVVVEDAGTYYCQQYNSYP
Heterocephalus glaber V26 igkv AFSB01210352.1 10156 TRCDIQMTQSPSLLSLSPGEKVTITCRASQNIYNGLCWYQQKAGKAPKLLIYSASSLESGVSPRFSGSGSGTDYTLTISNLETEDVAIYYCQQYYNFP
Heterocephalus glaber V27 iglv AFSB01220890.1 12069 CWAQSALTQPPTASGSLGGKVTISCTGTSSDIGSYSYVSWYQQLQGTSPKLLIYGVSNRPSGIPDRFSGSKSGNTASLSIDRLQADDEADYYCCSYRSG
Heterocephalus glaber V28 iglv AFSB01220898.1 15841 SLFSGTWAQSALTQPPTASGSLGEAVTISCIGTSSDIGSYSDVSWYQQLQGTSPKLLIYDVSSRPSGIPDRFSGSKSGNTASLSIARLQAEDEADYYCCSYRSG
Heterocephalus glaber V29 iglv AFSB01220900.1 1276 CWAQSALTQPPTASGSLGGKVTISCTGTSSDIGSYSYVSWYQQLQGTSPKLLIYGVSNRPSGIPDRFSGSKSGNTASLSIDRLQAEDEADYYCSSYTTS
Heterocephalus glaber V30 iglv AFSB01220901.1 4114 SLFPGTWAQSALTQPPSASGSLGEKVTISCDGTSNDIGRYDAVSWYQHLEGTSPKLLIYDVNNRASGISDRFSGSKSGNTASLSISGLQPEDESDYYCS
Heterocephalus glaber V31 iglv AFSB01220902.1 13888 SMASSILTQPPSVSVTPGQTALLTCSGDKLSEVYAHWYQLKTGQAPKLVIYEDSKRPSGIPDRFSGSSSGNTATLSISGAQAGDEADYYCQSYDSSEL
Heterocephalus glaber V32 trav AFSB01228014.1 13937 SSGQEKDVVQSPSILDVWEKETAIINCSYTDVTFSYFPWYKKEEGKGPILLTEIRSNLDKKQERRFTVILNKTAKQVSLHITETQPGDSALYFCAA
Heterocephalus glaber V33 trav AFSB01228018.1 2422 VSSQELRQSQSLITQEGENLTINCNSSKSLYVLHWYRQKNDGSLAFLVMLQKGGDKKSYGNIAAKLDEKMQQSSLHITGAQPSHSGTYFCGGS
Heterocephalus glaber V34 trav AFSB01228022.1 4512 VSGQQLNQSPQSIITKEGEEISMNCSSSTTFNFLLWYKQDPGEGLVLLITLYKSGELITSGKLTAQLDGTRKNSFLSIPDSKPDDGGTYFCAG
Heterocephalus glaber V35 trav AFSB01228028.1 3049 ASVAQKVTQSQPEISIQEAATVTLDCTYDPTESNYYLFWYKQPPSGQMIFIIRQESYKQQNTTKDRFSVNFQKAAKSFSLKISDSELWDAATYFCALI
Heterocephalus glaber V36 trgv AFSB01228402.1 6215 GLGVTKLEQFQISVSTEVKKSVNIHCRVWSTQFETKPIHWYLQKANQALVHLIQVTSLTTPARAKNNRVSARKDPVTLSSTLTINFVEKEDMAIYYCAGWD
Heterocephalus glaber V37 ighv AFSB01236936.1 1155 PDLVKPSQTLSLTCTVSEFSITACGYGWSWIRQPPGKSLEWMGYIAYSGGTGYSPSLKSHISISRDTAKNQFSLWLNSVTTEDTAMYYCARYTVIN
Heterocephalus glaber V38 ighv AFSB01271139.1 1419 VLSQVQLQESGPDLVKPLHTLSLTCTVSGFSITTSGYCWHWVRQASGKGLEWVGAICASGSTYYSLSLKSRVTITKDTSKNQFSVQMNSVVSEDTAVYHCAR
Heterocephalus glaber V39 igkv AFSB01003007.1 18505 ARCDIQMTQSPSFLFASLGDTVIINCQVSQDITTWLDRYQQKKWDRPKPLIYKASNLQSGVPPRFSGSGSGTDFTLIISRLQPENGATYYCM
Heterocephalus glaber V41 trbv AFSB01006597.1 12475 IKGAEVTQFPRYRVARTGEKLTLQCSQNMNYLTMYWYQQNPGFGLQLIYYSPGTGSIEKGKVPEGHLVSRSETQYFPLTLVSTSANQTSVYFCTS
Heterocephalus glaber V42 trbv AFSB01006597.1 5205 PLETQVTQTPRYLIAKTGKSTIVTCSQNMNHDYMHWYRQDPGLGLKLIYYSINVKIIEKGDVPDGYSVSRKEESFLLTVDQVNTSYTSVYFCATSA
Heterocephalus glaber V43 trbv AFSB01006600.1 7403 SVSSLTPISLMLFFFHLVKREGQRAKMSCVPKKGHNAVYWYQQKQNEELKFLISFQNKKVIDQVDMAKTRFLTEYPQNSPCSLEIKSSELEDSALYLCASSQ
Heterocephalus glaber V44 trbv AFSB01006600.1 4958 FSDDEVTQVPRHLVKRKGQRAKMSCVPKKGHNAVYWYQQKQNEELKFLISFQNKKVIDQVDMAKTRFLTEYPQNSPCSLEIKSSELEDSALYLCASSQ
Heterocephalus glaber V45 trbv AFSB01006602.1 6316 GFGLGALVLQHPSGAICNSGSSVKIECHFVDLQATSVFWYRQLPKQSFVLMATSNMGSSASYEQDFAEAKFPIIHPNLTYSSLTLTSTHPEDSSFYFCGAS
Heterocephalus glaber V46 trbv AFSB01006605.1 1799 FGLCALVSQLPRRAICKTGSSVKIQCRCVDFQAAMVIWYRQFPKQGFTRMAISNEGSSVTYEPGFKRAKFPISHPNLTYSSLTLTSAYPEDSSFYFCGSS
Heterocephalus glaber V47 trav AFSB01006611.1 10335 LTSAAVTQNPRHLVRRRGQEVILSCNPEKKHLYVYWYQQLPEEGPKFLVYLQEEEVLDDSGIRNSRFFAEFPKEGPKVLKIQTAELEDSAVYFCAGSV
Heterocephalus glaber V48 trbv AFSB01006611.1 7305 TMNGGITQTPKFWLIEKGKDVTLGCEQNLNHEAMYWYRQDPGRGLRLIYFSQFVSDIQEGDAAEGYTVSREEKNFFPLTVTSTQKNQTAVYLCASSV
Heterocephalus glaber V49 trbv AFSB01006616.1 50006 FMDAGIIQTPRYCIICTGKKMTLQCSQNMNHYGMFWYRQDPGQGLRLLHYSGSVSSTAKGDAPEGYSVTRDENEHFPLTLESASTNQTSMYLCASSE
Heterocephalus glaber V50 trbv AFSB01006616.1 38834 LVDAGVTQFPRHLIKAEGGKSTLKCYPDSGHRSVSWYQQDPGQGPQFLAEYFEMSQRTKGSMPGRFSAQQFGDYHSELNMSTLQLADSAVYLCASSL
Heterocephalus glaber V51 trbv AFSB01006616.1 36019 HMEAGITQSPRHKITKTKEKVTLKCHQTNNHDYMYWYRQDPEHGLRLIHYSYEVDRVDKGEVPNGYSVSRANTEDFPLTLDSATLSQSSVYFCGSSF
Heterocephalus glaber V52 trbv AFSB01006616.1 29645 HTNAGVTQTPKQEVTKRGQAVTLRCEPISDHKALYWYRQTVVRRLELLTYFRSLTLMNEGEMPKDRFTAQMPNASFSILKIQPAEPSDSAVYLCASSL
Heterocephalus glaber V53 trbv AFSB01006617.1 21637 PTNTRITQTPRHLIMETTNTKSLKCEQHLKHNAMYWYKQNAKKPLELMFLCNFQEVVQNETVPSRFLPRCPDSSHFYLDLTALEPQDSAVYLCASSQ
Heterocephalus glaber V54 trbv AFSB01006617.1 19954 HMEPRVKQTPSHEVTNMGQNVVLRCEPISNHLYIYWYRQTAEKGMEFMVYLYNNNPGEKADFFKDRFSAEMSKGSYSILKIQPVQLEDSAMYLCASSL
Heterocephalus glaber V55 trbv AFSB01006617.1 7571 PGNAGISQTPKFQVLRTGQRMTLSCTQDLKHDSMYWYRQDPGLGLRLIYYSYDVNNTKKGEVPDGYTVSRLSSKNFPLTLESASPSQASVYFCASSY
Heterocephalus glaber V56 trbv AFSB01006617.1 4292 HTEAGVSQSPSYRVTKKGQNVTFGCAPISGHGFLYWYRQTFEQGLEFLTYFQNELASDTSKMPPERFSAERPEGTFSNLKIQGVQQGDSAVYFCAS
Heterocephalus glaber V57 trdv AFSB01007059.1 6018 SSNAQRIDQPTDVVYKQEGESVTIDCKITFSFSYYIMYWYQQPTSGKMIYLTGLNSEGWSSKEGRYSVVFQKALEVLKLTISALTLSDSAVYFCTITI
Heterocephalus glaber V58 igkv AFSB01025981.1 3178 CRGDVVMTQTPLSLSITPGESVSISCRSSQSLLHSNGNTYLHWFVHKPGQAPRGLIYRISNRYSGIPDRFSGSGSGTDFTLKISRVEAEDAGVYYCVQS
Heterocephalus glaber V59 igkv AFSB01025982.1 1917 STGDVVMTQTPLSLSITSGEPASISCRSSQSLLHSNGKTYLNWIVHKPGQSPRRMIYQVTNRDSWVPDRFSGSGSGTDFTLKISRVEAEDAGVYYCVQG
Heterocephalus glaber V60 igkv AFSB01025986.1 2135 STGDALINQTPFSLSITSGEPASISCRSSQSLLHSSGKIYLNWIVHKPGQSPQQMIYQVTKRDSWVPGRFSGSGSGTDFTLKISRVEAEDTGVYYCVQG
Heterocephalus glaber V61 igkv AFSB01025993.1 5899 STGDVVMTQTPLSLSITPGESASISCRSSQSLLHSNGNTYLYWLVHKPGQAPRGLIYRISNQYSGIPDRFSGSGSGTDFTLKISRVEAEDAGVYYCWQA
Heterocephalus glaber V62 igkv AFSB01026014.1 9342 ARCDIQVTQSPTSLLAAVGDTVTITCRASEDIGYGIHWYQKKSGKAPKLLVYVADELASGVPKRFSGSGSGTDFTLTISSLEPEDVATYYCLQGYDTP
Heterocephalus glaber V63 igkv AFSB01026023.1 9202 ARGDIQVTQSPTSLSAAVGDTVTITCRASEDISYALNWYQQKSGKAPKLMIKAADELAPGVPPRFSGSRSGTDFTLTISSLEPEDVATYYCLQAYSTP
Heterocephalus glaber V64 igkv AFSB01026023.1 5534 ARYDIQLTQSPTSLSAAVGDTVTITCRASEDISIGLNWYQQKPEKAPKLFIYAVDNLETGVPSGFHGSGSGTDFTLTISSLQCEDVATYYCLQYYEDP
Heterocephalus glaber V65 igkv AFSB01026026.1 878 ARCEIRMTQSPSSHSASIGDSVTISCWASQDISKYLAWYQQKPGKAPKLLIYYASSLESAVPLRFSGSGSGTDFTLTISSLQPKDVASYYCQHYYENR
Heterocephalus glaber V66 igkv AFSB01026034.1 20533 ICGDIIMTQSPGSLAVSAGESTTISCKSSQSLLSSSNQKNYLSWYQQKPGQSPKLLISWASTQVSGVPDRFTGSGSGMDFTLTISNLQPEDVADYYCQQGYSAP
Heterocephalus glaber V67 igkv AFSB01026034.1 16608 SNGQIVLTQSPASLAASPGDKVTITCTASSSVSTYYLHWYQQKPGASPKLLVYGTSNLASGVSARFSGSGSGTSYSLIISNVEAEDAATYYCQQYSSS
Heterocephalus glaber V68 igkv AFSB01026048.1 5601 SSGEIVLTQSPAVLSLSPEEKATITCQASQGISSSLHWYQQKPNQAPKLLIKYASESISGVSSRFSGSGSGTDFTLTISSLEPEDVATYYCQQSRSYPS
Heterocephalus glaber V69 igkv AFSB01026057.1 18242 GRCDIQLTQSPSVAASLGELVKLTCQASQGISDYLHWYQQKPGEAPKLLIRYATTLQSGVPSRFSGSGSGTDFTLTINSVEPEDTAIYFCQQSYNTP
Heterocephalus glaber V70 igkv AFSB01026057.1 6825 GRCDIQLTQSPSVAASLGETVKLTCQASQGISNSLHWYQQKPGEAPKLLIRYATTLQSGVPSRFSGSGSGTDFTLTINSVEPEDTAIYFCQQSYNTP
Heterocephalus glaber V71 igkv AFSB01026058.1 23649 ASCDIQMTQSPSSLSASEGNSITITCRASQGISSYLNWYQQKPGKAPKLLIYRASSLESGVPSRFSGSGSGTDFSLTINSVEPEDVATYYCQQGNNWP
Heterocephalus glaber V72 igkv AFSB01026064.1 1901 TTGEIVMTQTPATLSLSPGEEATLTCKASQGISSYLAWYQQKPGQAPRRLIYGASSRATGVPTRFTGSGSGTDFTLRISSLEPEDVAIYYCQQGYSG
Heterocephalus glaber V73 igkv AFSB01026072.1 3668 VRCDIQMTQSPSSLSAPLRDTVTIFCRASQSISNELDWYQQTPGKVPTLVIYSASSLSSGVPSMFSGSGSGRDFTLTISQLEPEDFATYYCQQDYINP
Heterocephalus glaber V74 igkv AFSB01026074.1 4220 GRCDIQMTQSASSLSGSVGDTVAITCTASQNIYSNLQWYQQKPGKAPKLLIYGASSLASGVPPRFSGSGSGTDYTLTISNLEPEDVGTYYCQQDSRYP
Heterocephalus glaber V75 igkv AFSB01026096.1 10444 VLCDIQMTQSPSYLSASLGDTVTITCQASQSVSSYLNWYQQKPGKAPTLLIYNSNNLQSEVSSRFSGSGSRTDFTLSISNLEPEDVATYYCLQHNSSP
Heterocephalus glaber V76 igkv AFSB01030068.1 4898 ARCNIQMIQSPSSFLASIGDTVTISCRASQGINNYLVWYQQKPGKPPKLLIYLASNLESGVPARFSVSGSGTDYSLTINSVEAEDVGTYYCHQHNSYP
Heterocephalus glaber V77 ighv AFSB01061480.1 421 VEAEVQLLESGGGLVQPEGSLKLSCAASGFTFSNYAMHWIRQAPGNQLEWISLISYDSSYINYADSVKGRFTISRDNAKNTLYLQMNSLRTGDTAVYYCAR
Heterocephalus glaber V78 ighv AFSB01061482.1 3862 VLSDLTLRESGPSLVKPSQTLSLTCTVTGGSISSYAWSWIRQPPGKALQWMGYYAGGSTNYNPAFQDRISITGDAGKNQIFLQLNSVTTEDTAVYYCA
Heterocephalus glaber V79 ighv AFSB01061483.1 853 VLSDLTLRESGPSLVKPSQTLSLTCTVTGGSISSYAWSWIRQPPGKALQWMGYYAGGSTNYNPAFQDRISITGDAGKNQIFLQLNSVTTEDTAVYYCA
Heterocephalus glaber V80 ighv AFSB01061490.1 6559 VQAEVQLMESGGNLVQPGKSLKLSCVASGFTFSDYYMHWVRQAPGKGLEWISYISGGSGDIQYADSVKGRFTISRDNAKNTLYLQMNSLKAEDTAVYYCAR
Heterocephalus glaber V81 ighv AFSB01061497.1 2812 VLSQVQLQESGPGLVKPSQALSLICSVSGYSITSGYYWSWIRQPQGKGLQWMGWISSGGSTAYNPSLKSQISISRDTSKNQFSLQLNSVTAEDTAMYYCAR
Heterocephalus glaber V82 ighv AFSB01061500.1 4812 VQSEVQLMESRGGLVQSGESLRLSCAASGFIFSDYWMSWVGQAPGKGLEWVALLRDKGKSHTTEYATYVKGRFTISRDDYKSTIYLQMNSLKVGDIAMYYCAR
Heterocephalus glaber V83 ighv AFSB01062491.1 10022 KTWCSLGGRGSLQLSCAALGFAFSDFGISCVHQASGNGVEWFSVIRYHSSCINCACSMKGQFTTSKANSKNMLYLQMKCLRTEDTAVYYCAR
Heterocephalus glaber V84 igkv AFSB01078626.1 36579 TSGNTVLTQSPAFLSVTPGESISITCRASESVSDYVTWYQQKPGQAPRILIYDADNQYSGVSDRFTGIQSGTEFIFKISSVEGDDAGTYFCQQDYSVP
Heterocephalus glaber V85 igkv AFSB01078626.1 32352 SDTSGQTLLTQSPASLALSPGEMATLTCRASQSVSNYLAWYQQKPGQAPRLLIYGASSRATGIPARFIGSGSGTDFTLSISSLEPEDIAVYHCYQYSNWY
Heterocephalus glaber V86 igkv AFSB01078626.1 17440 ARCDIQMTQSPSSLSASIGDTVTISCQASQDINKYLAWYQQKPGKAPKLLIYYASNLESGVPARFSGSGSGTDYTLTINSVEAEDVGTYYCQQHQSYP
Heterocephalus glaber V87 igkv AFSB01078626.1 9959 ARCDIQMTQSPSSLSPSIGDTVTISCRASQSINKYLTWYQQKPGKAPKLLIYYASSLASGVPQRFSGSGSGTDFTLTINSVEAEDAGTYYCQQYNSYP
Heterocephalus glaber V88 igkv AFSB01078628.1 7899 VSGDIILTQTPASLSASPGETVSISCQASADVNREMSWIRIKLGQRLEPLISHITTLASGVPARYSSSGSGTSYVFSISPVEPGDSGEYYCMHDYGWP
Heterocephalus glaber V89 ighv AFSB01082955.1 1002 VLSQVQLQESGPGLVKPSQTLSLTCTVSGFSITTSNYWWSWIRQPPGKSLEWMGLISYSGGTSYSPSLKNRISISRDTDKNQFFLQLNSVTTEDTAMYYCAR
Heterocephalus glaber V91 igkv AFSB01110151.1 766 ARCDIQMTQSPSSLSPSIGDTVTISCRASQGINNYLAWYQQKPGKPPKLLIYYASSLASGVPTRFSGSGSGTDFTLTIKSVEAEDVGTYYCQQGNSLP
Heterocephalus glaber V93 trav AFSB01123617.1 3103 QQKEKHDQQQVKQSPSFLTNQEGKISILNCTYEQSTFDYFPWYRQFPGKGPTFLIAISSYTNEKQDGRFTIFHRGSSKHLSLHISDSQLEDSATYFCAA
Heterocephalus glaber V94 trav AFSB01123630.1 33189 GSNGDLVTQTEGKVTLSEEALLTVNCSYDTTGFPVLFWYVQYPRGAPQLLLKATKAKDKGSNKGFEATYDKATSSFHLEKASVQESDSAVYYCALG
Heterocephalus glaber V95 trav AFSB01123630.1 14967 RTHGDSVTQMRGQVTLSEHSVLTINCTYTASRYPALFWYVQYPGEGPQVLLKAMKANEQGRNKGFEATYDKETSSFHLEKASVQESDSAVYYCALG
Heterocephalus glaber V96 trav AFSB01123630.1 7171 VSSQQKEVEQSPETLSVLEGAMASLNCTYRDSASWYFMWYRQYPGKGPELLMSIFSSGDKEEGRFIVQLSTASQHISLYIRDSQQSDSATYLCAV
Heterocephalus glaber V97 trav AFSB01123635.1 10934 RICGQSVTQTRGQVSTAEGGLLTINCTYTASGYPTLFWYVQYSGEGPQLLLKAVTVNEKGRNKGFEATYDKATSSFHLEKASVQESDSAVYYCALS
Heterocephalus glaber V98 trdv AFSB01123640.1 1370 SSVAQKVTQVQSAISRPEREAVTMDCSYETTFSAYYIFWYKQLPKGDMIFLIRQHSSDLSAKSGRCSLNFQKVAKAISLTISDLEMGDTAKYFCAFR
Heterocephalus glaber V99 trav AFSB01123644.1 1261 GSRAQSVAQPDHHVTVSERAPLLLKCNYTYGATVSLFWYVQHPGRGFQLLLKYVAGPSLVTGIRGFKAEFKKSETSFHLEKASVQWSDAAMYFCAVS
Heterocephalus glaber V101 trav AFSB01123646.1 17547 VSSQQKEVEQSPESLIVPEGAIASLNCTCRDSAFRNFNWYRQYPGKGPELLMSMYSSGDKEEGRFKMQLNTASQLVSLHIRGSQHSDSAVYLCAV
Heterocephalus glaber V102 trav AFSB01123646.1 6401 VSTKQKEVEQSPETLSVPERAMVSLNCTYRDSASQNFRWYRQYPGKGPELLMSMYSIGDQEEGRFTMQLNRASRHVSLYIRDSQHSDSATYLCAV
Heterocephalus glaber V103 trav AFSB01123647.1 16516 GVRGVEVEQSPSASSLQEGTSSKLRCDFSSVMNTVHWFRQNPGGGLISLFFMAPGTKQNGRLESTFNFKERYSTLQITASDLGDSGFYLCAGE
Heterocephalus glaber V104 trav AFSB01123647.1 9534 SSIAQKVTQAQPPMSVQEMETTILHCTYDTSDTNYGLFWYKQPGSGEMVFLIRQESYSQQNATEGRYSLNFQKASKSIQLVISASQLEDSAVYFCALRE
Heterocephalus glaber V105 trdv AFSB01123650.1 9804 PSVGQKVTQVQPPTSRPEGETVTLDCSYETSWNSHYIFWYKQLLSGEMIFLIRQSSSATTGQSGRYSVRKVGYSISYSMGLTISTLQMDDSARYFCALWE
Heterocephalus glaber V106 trav AFSB01123654.1 3528 GSNGDSVTQTEGQVTLSERTSLTVNCSYKTTQYPALFWYVQYPGEAPQLLLKASKDKDKGSKKGFEATYDKETSSFHLQKVSVQESDSATYYCALS
Heterocephalus glaber V107 trav AFSB01123656.1 3843 VNGQQLNQSPQSITVQEGEDISMNCSSSSTFSNFQWYKQNPGEGLVLLLILYKSDELSRNGRLTAQLGGTRKDSFLSLQASKPDDTATYFCAE
Heterocephalus glaber V108 trdv AFSB01123657.1 23126 SREVTQVQPSISKLVWEGVALDCSYETIWSFYDVFWYKQLPSGKMIFLIHQRSNSGNARSGRCSVRFQKAANCISLIILPLLMEDSAKYFCVLGE
Heterocephalus glaber V109 trav AFSB01123657.1 15081 GSGAQSVAQPDRHVAVWEGDPLLLRCNYTYSGAPYLFWYVQYPGQGPQFLLRYMSGAPVVTGIRDFKAEFKKSETSFHLEKSSAHWSDTATYYCAVS
Heterocephalus glaber V110 trav AFSB01123657.1 4256 PSTEQLQQSPGFLSIEEGKDVTMHCNSSSVFPKIQWYRQKPGGGPVFLMALVKGGEVKEQKSLTAQFGEERKSSSLRITTAQPGDSGTYICAG
Heterocephalus glaber V111 trav AFSB01123669.1 16180 VSSQQKEVEQSPETLSVPEGAIASFSCTYRDSASQNFRWYRQYPGKGPKLLMSIYSSGDQEEGRFTVQLNRASRHVSLYIRDSQHSDSATYLCAA
Heterocephalus glaber V112 trav AFSB01123669.1 5496 VSSQQKDVEQSPESCNVLEGAIVSLNCTYRSSASDYFTWYRQFSGKGLVFLMAAYSKDDKKEGRFRMQVSKASRYVSLDIRDCQQSDSATYFCAVR
Heterocephalus glaber V113 trav AFSB01123669.1 4188 VSSQQKDVEQSPESCNVLEGAIVSLNCTYRSSASDYFTWYRQFSGKGLVFLMAAYSKDDKKEGRFRMQVSKASRYVSLDIRDCQQSDSATYFCAVR
Heterocephalus glaber V114 trav AFSB01123671.1 10570 VRGMQVEQSPPALILQEGANSTLSCSFSASVTTVQWFRQDPGGLLSSLFYIPSGTKQNGRLEVTTVPKERHSSLSISSSQPTDSATYFCAAAHSAPL
Heterocephalus glaber V115 trav AFSB01123675.1 19965 VNNQRGEVPQALNIQEGENATMNCSYKSSIMNLEWYRQDASGGPVLLILMRSNEKEKHSGRLRATLETSTKRSSLSITAARAADTAAYFCATD
Heterocephalus glaber V116 trav AFSB01123675.1 14762 TSMGQKIVQAQTEISVLEKEAVSMDCVYETSDPTYSLFWYKQPPSGEMILLIRQDSYSEHNATEGRYSLNFQKAASSIRLTITASQLLDSAVYFCAGRE
Heterocephalus glaber V117 trav AFSB01123675.1 5500 WSHGDSVTQTEGPVILSEWAPLILNCTYQTTYSASFLFWYVQYFNTAPQLLLKSTTENQRTENQGFEATLVKSHSSFHLQKPSLQLADSAVYYCALG
Heterocephalus glaber V118 trav AFSB01123678.1 7477 VSSQQEVEQSPESLSVPEGAIASLNCTYRDSASQYFRWYRQYPGKGPEFLVSMYSSGDKEEGRFTMQLSTASRHVSLYIRDSQHSDSATYLCAV
Heterocephalus glaber V119 trav AFSB01123684.1 25084 RVNGDSVTQTEGQVTLFERASLTVNCSYETKQYLNLFWYVQYLGEGPQLLLKAMKANDQGRNKGFEATYDKATSSFHLEKASVQESDSAVYYCALG
Heterocephalus glaber V120 trav AFSB01123684.1 13929 SRGEQVEQRPSTLRVQEGDSSIINCTYSDSASSYFPWYKQEPGKGPQFIIDIRSNKEKEQKQRLIVLFNKAAKHVSLHITATQPGDSAVYFCAAS
Heterocephalus glaber V121 trav AFSB01123684.1 4703 GIHGDSVTQMPGQTTVSEGVFLTVNCTYTAKATNYPSLFWYVQYPGKTPQLLFRVSKAKDKGGNKGFEATYDKETSSFHLEKFSVQESDSAVYYCALS
Heterocephalus glaber V122 trav AFSB01123685.1 6575 RNNGDSVTQTEGQVALSEKDSLTLNCSYESSLYPALFWYVQYPGESLQLLLKATKDKEKGSKKGFAATYNKEASSFHLEKASVEQSDSAVYYCAVS
Heterocephalus glaber V123 trav AFSB01123688.1 7344 RTYGDSVTQTEGQITVPEEAMLVINCTYTATGYPALFWYVQYPGEGPQLLFRVSKANNKGSNKGFEATYDKETSSFHLKKSSVQEPDSAVYYCALS
Heterocephalus glaber V124 trav AFSB01123689.1 829 DARAQSVSQPDAQVIVREGAPLELRCKYTYAGVVYLFWYVQYPGQGLQPLLKYYSGDTRVQGIKGFEAEYSKSQSSFHLRKRFAHWSDTAEYFCALS
Heterocephalus glaber V125 trav AFSB01123690.1 11083 MSGGEQVEQHPSFLSVLEGDRAVISCTYTDSAFSNFYWYKQEPGTGLQLLIYIISNVDNRKDRRFIVFLNKKDKHLSLNITAACPGDSATYFCAA
Heterocephalus glaber V126 trav AFSB01123692.1 1904 TGSLAETTQPISMDSYEGQDVNLTCNHPNIATNEYIFWYRQVHHQGPRFVIQGYKTNGANEVASLFIPEDRKSSTLSLRHVALRDTGVYYCIVRG
Heterocephalus glaber V127 trav AFSB01123707.1 3973 MCPLTGAAGQTIEQPTELMAMEGASAQVNCTFQTSGFNGLSWYQQHEGRAPVFVSYNVLDGLQNKSRSSTFLHHSDGYSYLLLKELQMKDSASYFCAVR
Heterocephalus glaber V128 ighv AFSB01155659.1 12207 IHSQVQLVQPGAEVKRPGESVKVSCKGSGYTFTDYAISWVKQVPGKGLQWMGWINTKTSKPTYAEGFTGRFVFSLDASVSTAYLQISSLQAEDMAVYYCT
Heterocephalus glaber V129 trav AFSB01171196.1 17182 IRAQIKVEQSPQVQILQERRNSSLTCNYSTSINSMQWFQQNQEGRLISLFYIASGEQQKGRLKATVNFKERYSQLYIRDSQPEDSASYFCAVQ
Heterocephalus glaber V130 trav AFSB01171199.1 4011 GSRAQSVAQADLHVTVIEGAPLQLKCNYNYGATPYLFWYVQHPGQGLQLLLKYLGGASLIKGARSFEAEFKKSENSFHLEKTSAHWSDTAMYFCALS
Heterocephalus glaber V131 trav AFSB01171207.1 4426 RHGQQVKQTPQFQYIKEGENFTTYCNFSGILNNLQWYKQKPGGCPVFLMILTKGAEVKKQERLTAQFGGKRKDSSLHITATQTTDVGTYFCAV
Heterocephalus glaber V132 ighv AFSB01188089.1 856 VQAEVQLLESGGGLVQPGGSLRLSCAASGFTFSDYWMSWIRQAPGKGLEWVGEINQNSGTIRYPDSVKGRFTISRDNAKNTLYLQMNSLKTEDTAVYYCAR
Heterocephalus glaber V133 trav AFSB01192685.1 2840 ISMTQTVIQSQPEISIQEAATVTLDCTYDTTESNYYLFWYQQLPSGQMIFIIRQESYKQQNTTKDRFSVNFQKAAKSFSLKISDSELRDAAIYFCAFA
Heterocephalus glaber V134 ighv AFSB01202573.1 708 VLSQVQLQESGPGLVKPSETLSLICTVSGFSLTSYNVHWVRQAPGKGLEWIGVIWSGGSTNYNSALQSRVSISRDTSKSQVSLTLSSLRSEDTAVYYCAR
Heterocephalus glaber V135 ighv AFSB01233625.1 1767 VLSQVQLQESGPGLVKPSETLSLICTVSGFSLTSYNVHWVRQAPGKGLEWIGVIWSGGSTNYNSALQSRVSISRDTSKSQVSLTLSSLRSEDTAVYYCAR
Heterocephalus glaber V136 ighv AFSB01236886.1 6913 VQAEVQLVESGGDLVQPGGSLRLSCAASGFTFSNYWMNWVRQAPGKGMEWVGNINQNGGSTNYPDSVKGRFTISRDNGKNTLYLQMNSLRTEDTAVYYCAR
Heterocephalus glaber V137 ighv AFSB01237624.1 4118 VLSDLTLQESGPSLVKPSQSLSLTCTVTGGSLSSYAWSWIRQPPGKALQRMGDYYLESTSYNPDLQDRISITADTGKNQIFLQLNSVTTEDTAVYYCA
Heterocephalus glaber V138 ighv AFSB01237646.1 15764 VLSQVQLQELGPGLVKPSQTLTLTCTISGDTVSSTSATWDWIRQPLGRSLQWLGRTYYRSNWNYEYAPSLQGRLTITPDTSKNQFSLQLSSVSTEDTAMYYCAR
Heterocephalus glaber V139 ighv AFSB01237648.1 5963 VLSDPTLRESGPSLVKPSQTLPLTCTVTGGSVTSSYYWSWIRQPPGKALQWMGWWSGSTNYNPAFEGRISITADTAKNQFFLQLNSVTTEDTAVYYCA
Heterocephalus glaber V140 ighv AFSB01237649.1 3639 VHGQVQLVQSGAEVRRPGASVKVSCKASGYTFTNYFMHWVQQSPGQGLEWIGRIDPSDGETKYAQKFQGRLSLTADTSSTTAYMELSDLRSEDTAMYYCA
Heterocephalus glaber V141 trbv AFSB01263121.1 397 FSDDEVTQVPRHLVKRKGQRAKMSCVPKKGHNAVYWYQQKQNEELKFLISFQNKKVIDQVDMAKTRFLTEYPQNSPCSLEIKSSELEDSALYLCASSQ
Heterocephalus glaber V142 trgv AFSB01271087.1 2248 GLGQLEQPKIVISRATDKSASIPCKATTNNFKSVDIHWYRQKPKKEFEHLMYVRTAYNQRPLGGTNKKLEASKNFDTFASTLKINVLKKEDEATYYCTYWD