WGS Statistics
Organism WGS Record. Vs Total IGHV IGLV IGKV TRAV TRBV TRGV TRDV
Pan paniscus AJFE00000000.2 (AJFE02) 182 30 27 27 34 51 6 7
Pan paniscus AJFE00000000.1 (AJFE01) 0 0 0 0 0 0 0 0
Vgene Table
Organism Vgene Locus contig Contig Pos. AA sequence
Pan paniscus V0 trdv AJFE02000016.1 1585 SSVAQKVTQAQSSVSMPVRKAVTLNCLHEASWWSYYIFWYKQLPSKEMIFLIRQGSDELNAKSGRYSVNFKKAAKSVTLTISALQLEDSAKYFCALWE
Pan paniscus V3 ighv AJFE02003265.1 14100 VQCEVQLVESGGGLVQPGGSLRLSCAASGFTFSSYWMHWVRQAPGKGLVWVSRINSDGSSTSYADSLKGQFTISRDNAKNTLYLQMNSLRAEDMAVYYCTR
Pan paniscus V4 ighv AJFE02011107.1 15078 TYSQVQLVQSGHEVKQPGASVKVSCKASGYSFTTYGMNWVRQAPGQGLEWMGWFNTYTGNPTYAQGFTGRFVFSMDTSVGTAYLQISSLKAEDTAMYYCAR
Pan paniscus V5 ighv AJFE02011110.1 45854 VQCEVQLLESGGGLVQPGGSLRLSCAASGFTFSSYWMHWVRQAPGKGLEWVSRINSDGSSTSYADSVKGRFTISRDNAKNTLYLQMNSLRAEDTAVYYCTR
Pan paniscus V6 ighv AJFE02011110.1 53574 VQCEVQLVESGGGLVQPGGSLRLSCAASGFTFSGSAMHWVRQASGKGLEWVGRIRSKANSYATAYAASVKGRFTISRDDSKNKAYLQMNSLKTEDTAVYYCTT
Pan paniscus V7 ighv AJFE02011111.1 11971 VLSQVTLKESGPALVKPTETLMLTCTFSGFSLSTSGMRVSWIHQPPGKALEWHACIDWDDDKYYSTSLKTRLTISKDTSKNQVVLTMTNMDPVDTATYYCARI
Pan paniscus V8 ighv AJFE02011111.1 20884 VQSQVQLVQSGAEVKKPGSSVKVSCKVSGGTFSSYAISWVRQAPGQGLEWMGVIIPILGTANYAQKFQGRVTITADESTSTAYMELSSLRSEDTAVYYCAT
Pan paniscus V9 ighv AJFE02011113.1 30010 VQCEVQLVESGGGLVQPGGSLRLSCAASGFTFSSYAMHWVRQAPGKGLEWVSLIYSGDSTYYADSVKGRFTISRDNSKNTLYLQMGSLRAEDTAVYYCAR
Pan paniscus V10 igkv AJFE02011588.1 6067 ARCDIQVTQSPSSLSASVGDRVTITCRASQGISNGLSWYQQKPGQAPTLLIYAASSLQSGIPSRFSGSGSGTDFTLTISSLQPEDVATYYCLQDYTTH
Pan paniscus V11 trav AJFE02011664.1 6265 TAGQSLEQPSEVTAVEGAIVQINCTYQTSGFYGLSWYQQHDGGAPTFLSYNALDGLEETGRFSSFLSRSDSYGYLLLQDLQMKDSASYFCAVR
Pan paniscus V12 igkv AJFE02012227.1 3910 AKCAIRMTQSPSSLPASTGDRVTITCQASQGIGSYLNWYQQKPGKSPKLLIYYASYLQSGIPSRFSGSGSGTEFTLTIGCLQPEDFATYYCEQSYGTP
Pan paniscus V13 igkv AJFE02012232.1 672 SSGDIVMTQAPLSLPITPGEPASISCRSSQSLLDSDDGNTYLDWYLQKPGQSPQLLIYTLSYRASGVPDRFSGSGSGTDFTLKISRVEAEDVGVYYCMQHIEFP
Pan paniscus V14 igkv AJFE02012232.1 11187 ARCDIQMTQSPSSLSASVGDRVTITCRASQSISNYLSWYQQKPGKAPKLLIYYASTLQSGVPSRFSGSGSGTDFTLTISSLQPEDFATYYCQHGYG
Pan paniscus V15 igkv AJFE02012232.1 33466 ARCDIQLTQSPSSLSASVGDRVTITCRASQGISSYLNWYQQKPGKVPKLLIYSASNLQSGVPSRFSGSGSGTDFTLTISSLQPEDVATYYCQRTYNAP
Pan paniscus V16 igkv AJFE02012232.1 62719 ARCDIRMTQSPSSLSASVGDRVTITCQASQDISNYLNWYQQKPGKAPKLLIYDASNLETGVPSRFSGSGSGTDFTFTISSLQPEDIATYYCQQYDNLP
Pan paniscus V17 igkv AJFE02012234.1 5887 SSGDVVMTQSPRSLPVTLGQPASISCRSSQSLVYSDGNTYLSWIQQRPGQPPRLLIYKVSNRDSGVPDRFSGSGAGTDFTLKISRVEAEDVGVYYCVQGIQLP
Pan paniscus V18 igkv AJFE02012234.1 16461 SSADIVMTQTPLSLSVTPGQPASISCKSSQSLLHSDGNTYLYWYLQKPGQSPQLLIYRVSNRASGVPDRFSGSGSGTDFTLKISRVEAEDVGVYYCMQGIQLP
Pan paniscus V19 igkv AJFE02012234.1 28938 SSGDIVMTQSPLSLPVTPGEPASISCRSSQSLLHSNRYNYLDWYLQKPGQSPQLLIYLGSNRASGVPDRFSGSGSGTDFTLKISRVEAEDVGVYYCMQALQTP
Pan paniscus V20 igkv AJFE02012235.1 6766 SSGDIVMTQTPLSSPVTLGQPASISCRSSQSLVHSDGNTYLSWLQQRPGQPPRLLIYKVSNRFSGVPDRFSGSGAGTDFTLKISRVEAEDVGVYYCTQA
Pan paniscus V21 igkv AJFE02012235.1 23415 SRGEIVLTQSPDFQSVPPKEKVTITCRASQSIGSSLHWYQQKPGQSPKLLIKYASQSISGVPSRFSGSGSGTDFTLTINSLEAEDAATYYCQQSSSL
Pan paniscus V22 igkv AJFE02012236.1 7269 TTGEIVLMQSSATLSLSPGERATLSCRASQSVSSSYLAWYQQKPGQAPRLLIYDASTRATGIPDRFSGSGSGTDFTLTISRLEPEDFAVYYCQQYGS
Pan paniscus V23 igkv AJFE02012236.1 14876 HILRLQTPLFLGEPSSISCRSGQSPFHRNGNTYLNWFLQKPVQPLRCLIYEVSNRKSGVSGRFSSSGSGTDFILKISRVEAEDVEVYYCLQGTQVP
Pan paniscus V24 igkv AJFE02012238.1 1221 SSGDIVMTQNPPSLPVNPGEPASISCRSSQSLLHSNGYTYLHWYLQKPGQSPQLLIYRVSNRFSGIPDRFSGSGSGSDFTLKISWVEAEDVGVYYCMQA
Pan paniscus V25 igkv AJFE02012238.1 29984 ARCDIQMTQSPSSLSASVGDRVTITCRASQGISNYLAWFQQKPGKVPKRLIYAASSLQSGVPSRFSGSGSGTEFTLTISSLQPEDFATYYCLQHNSYP
Pan paniscus V26 igkv AJFE02012238.1 47441 ARCDIQMTQSPSSLSASVGDRVTITCRASQGISSWLAWYQQKPGKAPKPLIYAASSLQSGVPSRFSGSGSGTDFTLTISSLQPEDFATYYCQQYN
Pan paniscus V27 igkv AJFE02012238.1 62064 TTGEIVLTQSPATLSLSPGERATLSCRASQSVSSYLAWYQQKPGQAPRLLIYGASNRATGIPARFSGSGSRTDFTLTISSVEPEDFAVYYCQQYNNQP
Pan paniscus V28 igkv AJFE02012245.1 2612 ARCAIQLTQSPSSLSASVGDRVTITCRASQGISNRLNWYQQKPGKAPKLLIYDASSLESGVPSRFSGSGSGTDFTLTISSLQPEDFATYYCQQFNSYP
Pan paniscus V29 igkv AJFE02012249.1 2487 TTREIVLTQSPATLSLSPGEKATLSCRASQSVSSYLAWYQQKPGQAPRLLIYDASNRATGIPARFSGSGSGTDFTLTISSLEPEDFAVYYCQQRSNWH
Pan paniscus V30 igkv AJFE02012250.1 11967 VRFDIQMTQSPSFLSASVGDRVSIICRASEGISSDLAWYLQKPGKSPKFFLYDAKDLRPGVSSRFSGRGSGTDFTLTIISLKPEDFATYYCKQDFSYP
Pan paniscus V31 igkv AJFE02016082.1 1158 CNGDIVLTQSPASLAVSPGQRATITCRASESVSFLGINLIHWYQQKPGQPPKLLIYQASNKDTGVPAGFSSSGSGTDFTLTINPVEANDTANYYCLQSKNFP
Pan paniscus V32 iglv AJFE02016101.1 899 SWAQSALTQPPFVSGAPGQSVTISCTGTSSDVGDYDHVFWYQKLLSTTSRLLIYNVNIRPSGISDLFSGSKSGNMASLTISGLKSEVEANYHCSLYSSS
Pan paniscus V34 trdv AJFE02024276.1 100477 RGMLCDKVTQSSPDQTVASGSEVVLLCTYDAVYSNPDLFWYRIRPDYSFQFVFYGDNSRSQAADFTQGRFSVKHILTQKAFHLVISPVRTEDSATYYCAF
Pan paniscus V35 trgv AJFE02038686.1 28745 SQKSSNLEGRTKSVTRETRSSAEITCDLTVTNTFYIHWYLHQEGKAPQRLLYYDVSTARDVLESGLSPGKYYTHTPRRWSWILRLQNLIENDSGVYYCATWD
Pan paniscus V36 trgv AJFE02038687.1 1088 SQKSSNLEGRTKSVIRQTGSSAEITCDLDGGSTGYIHWYLHQEGKAPQRLLYYDSYTSRVVLESGISPGKYDTYGSTRKNLRLILRNLIENDSGVYYCATWD
Pan paniscus V37 trgv AJFE02038688.1 1904 SQKSSNLEGRMKSVTRPTGSSAEITCDLTVINAVYIHWYLHQEGKSPQRLLYYDVSNSRDVLESGLSPGKYYTHTPRRWSWILRLQNLIENDSGVYYCATWD
Pan paniscus V38 trgv AJFE02038688.1 16541 SQKSSNLEGRMKSVTRPTGSSAVITCDLPVENAGYTHWYLHQEGKAPQRLLYYDSYNSRVVLESGISQEKYHTYASTGKSLKFILENLIERDSGVYYCATWD
Pan paniscus V39 trgv AJFE02038688.1 31026 HLEQPQISSTKTLSKTARLECVVSGVTISATSVYWYRERPGEVIQFLVSISYDGTVRKESSIPSGKFEVDRIPETSTSTLTIHNVEKQDIATYYCALWE
Pan paniscus V40 trgv AJFE02038688.1 67998 TSGENLITQLVTSVTKKKGNTAFFECQVKSSTFKKNVCIHWYHQKPDRSLKRILYISSNENVVHEQGVSEERYEARKWQRDWSSSLRIHRVAEQDAGIYYCACW
Pan paniscus V41 trbv AJFE02039630.1 117723 LTEPEVTQTPSHQVTQMGQEVILRCVPISNHLYFYWYRQILGQKVEFLVSFYNNEISEKSEIFDDQFSVERPDGSNFTLKIWSTKLEDSAMYFCASSE
Pan paniscus V42 trbv AJFE02039630.1 125334 PLDTAVSQTPKYLVTQMGNDKSLKCEQNLGHDTMYWYKQDSKKFLKIMFSYNNKELIINETVPNRFSPKSPDKAHLDLHIKSLELGDSAVYFCASS
Pan paniscus V43 trbv AJFE02039630.1 129951 PIDTEVTQTPKHLVMGMTNKKSLKCEQHMGHRAMYWYKQKAKKPPELMFVYSYEKLSINESVPSRFSPECPNSSLLNLHLHALQPEDSALYLCASSQ
Pan paniscus V44 trbv AJFE02039630.1 137830 PVEAGVTQTPRYLIKARGQQVTLSCSPISGHRSVSWYQQTPGQGLQFLFEYFSETQRNKGNFPGRFSGRQFSNSRSEMNVSTLELGDSALYLCASSL
Pan paniscus V45 trbv AJFE02039631.1 1220 PVNAGVTQTPKFQVLKTGQSMTLQCAQDMNHNSMYWYRQDPGMGLRLIYYSVGEGTTDKGEVPDGYNVSRLNKREFSLRLESAAPSQTSVYFCASSE
Pan paniscus V46 trbv AJFE02039632.1 5247 PMEMGVTQTPRHLVMGMTNKKSLKCEQHLGHNAMYWYKQSAKKPLELMFVYNFKEQTENNSVPSRFSPECPNSSHLFLHLHALQPEDSALYLCASSQ
Pan paniscus V47 ighv AJFE02045057.1 259 VLSQVQLQQWGPGLVKPSETLSLTCAVYGGSISSSGYYWSWIRQPPGKGLEWIGEINHSGSTNYNPSLKSRVTISVDTSKNQFSLKLSSVTAADTAVYYCAR
Pan paniscus V48 ighv AJFE02045060.1 281 VLSQVTLKESGPVLVKPTETLTLTCTISGFSLSNAGMGVSWIRQPPGKALEWLAHIFWNDEKSYSTSLKSRLTISKDTSKSQVVLTMTNMDPVDTATYYCTRR
Pan paniscus V49 ighv AJFE02045062.1 4713 THAQVQLVQSGAEVKKPGATVKISCKASGYTLTELSMHWVRQAPGKGLEWMGGFDPEDGETIYAQKFQGRVTMTEDTSTDTAYMELSSLRSEDTAVYYCAT
Pan paniscus V50 ighv AJFE02045062.1 12792 VQCEVQLVESGGGLVKPGGSLRLSCAASGFTFSNYYMHWVRQAPEKGLEWVSTISGSGGSTWYPDSVKGRFTISRDNSKNTLYLQMNSLRAEDTAVYYCAR
Pan paniscus V51 ighv AJFE02045062.1 23648 VQCEVQLVESGGGLVKPGGSLRLSCAASGFTFSSYSMNWVRQAPGKGLEWVAYISSPSGSSTYYADSVKGRFTISRDNSKNTLYLQMNSLRAEDTAVYYCAR
Pan paniscus V52 ighv AJFE02045066.1 1268 VQCEVQLVESGGALVKPGGSLRLSCAASGFTFSSYGMHWVRQAPGKGLEWVSYISYDSSYIYYADSVKGRFTISRDNAKNSLYLQMNSLRAEDTAVYYCAR
Pan paniscus V53 ighv AJFE02045073.1 1388 VQCEVQLVESGGGLVQPGGSLRLSCAASGFTFDDYGMSWVRQAPGKGLEWVSLISWDGGSTYYADSVKGRFTISRDNSKNSLYLQMNSLRAEDTALYYCAR
Pan paniscus V54 ighv AJFE02045076.1 2852 VLSQLQLQESGPGLVKPSETLSLTCTVSGGSISSYYWSWIRQPPGKGLEWIGNIYYSGSAYYNPSLKSRVTISVDTSKNQFSLKLSSVTAADTAVYYCAR
Pan paniscus V55 ighv AJFE02045076.1 17269 VQCEVQLVESGGGLVQPGGSLRLSCAASGFTVSSYHMSWVRQAPGKGLEWVSVIYSGGSTYYADSVKGRFTISRDNSKNTLYLQMNSLRAEDTAVYYCAR
Pan paniscus V56 ighv AJFE02045076.1 31193 VCAEVQLVQSGAEVKKPGESLKISCKGSGYSFTSYWIGWVRQMPGKGLEWMGIIYPGDSDTRYSPSFQGQVTISADKSISTAYLQWSSLKASDTAMYYCA
Pan paniscus V57 ighv AJFE02045076.1 52921 VQCEVQLVESGGGLVQPGRSLRLSCTASGFTFGDYAMSWIRQAPGKGLEWVGFIRSKAYGGTTEYAASVKGRFTISRDDSKSIAYLQMNGLKTEDTAVYYCTR
Pan paniscus V58 ighv AJFE02045076.1 68148 VQCEDQLVESGGGLVQPGGSLRPSCAASGFAFSSYVLHWVRRAPGKGLEWVSAIGTGGDTYYADSVMGRFTISRDNAKKSLYLQMNSLIAEDMAVYYCAR
Pan paniscus V59 ighv AJFE02045076.1 75872 AHSQVQLVQSGAEVKKPGASVKVSCKASGYTFTSYTISWLRQAPGQGLEWMGVISPSDGSTSYAQKFQGRVTMTRDTSTSTVYMELSSLRSEDTAVYYCAR
Pan paniscus V60 ighv AJFE02045076.1 79997 AYSQMQLVQSGAEVKKPGSSVKVSCKASGYTFTYRYLHWVRQAPGQALEWMGWITPYNGNTNYAQKFQDRVTITRDRSMSTAYMELRSLRSEDSAVYYCAR
Pan paniscus V61 ighv AJFE02045078.1 1092 VQCEVQLVESGGGLVQPGGSLRLSCAASGFTFSNSDTNWVHQAPGKGLELVSGVSWNGSRMHYADSVKGRFIISRDNSRNSLYLQTNSLRAEDTAVYYCVR
Pan paniscus V62 trav AJFE02070018.1 2014 MYLVLGTTGQNTDQPTEMTATEGAIVQINCTYQTSGFNGLFWYQQHAGEAPTFLSYNVLDGLEEKGRFSLFLSRSKGYSYLLLKELQMKDSASYLCAVR
Pan paniscus V63 trav AJFE02070020.1 29014 GLRAQSVAQPEDQVKVAEGNPLTVKCTYSVSGNPYLFWYVQYPNRGLQFLLKYITGDNLVKGSYGFEAEFNKSQTSFHLKKPSALVSDSALYFCAVR
Pan paniscus V64 trav AJFE02070021.1 2588 TLNLAKTTQPISMDSYEGQEVNITCSHNNIATNDYITWYQQFPSQGPRFIIQGYKTNVTNEVASLFIPADRKSSTLSLPRVSLSDTAVYYCLVG
Pan paniscus V65 trav AJFE02070021.1 15310 MTRGEDVEQSLFLSVREGDSSVINCTYTDSSSTYLYWYKQEPGAGLQLLTYIFSNMDMKQDQRLTVLLNKKDKHLSLRIADTQTGDSAIYFCAES
Pan paniscus V66 trav AJFE02070021.1 34875 VKSQKIEQNSEALNIQEGKTATLTCNYTNYSPAYLQWYRQDPGRGPVFLLLIRENEKEKRKERLKVTFDTTLKQGVFHITASQPADSATYLCAL
Pan paniscus V67 trav AJFE02070021.1 49200 ANGENQVEHSPHFLGPQQGDVASMSCTYSVSRFNNLQWYRQNTGMGPKHLLSMYSAGYEKQKGRLNAILLKNGSSLYITAVQPEDSATYFCAVD
Pan paniscus V68 trav AJFE02070021.1 63492 DARAQSVSQHNHHVILSEAASLELGCNYSYGGTVNLFWYVQYPGQHLQLLLKYFSGDPLVKGIKGFEAEFIKSKFSFNLRKPSVQWSDTAEYFCAVN
Pan paniscus V69 trav AJFE02070021.1 77624 GINGDSVVQTEGQVLLSEGDSLIVNCSYETTQYPSLLWYVLYPGEGPQLLLKAMKANDNGRNKGFEATYRKETTSFHLEKDSVQESDSAVYFCALS
Pan paniscus V70 trav AJFE02070021.1 91697 GSGKNQVEQSPQSLIILEGKNCTLQCNYTVSPFNNLRWYKQDTGRGPVSLTIMTFSENTKSNGRYTATLDADTKKSSLHITASQLSDSASYICVVS
Pan paniscus V71 trav AJFE02070021.1 107428 VWSQRKEVEQDPGPFNVPEGATVAFNCTYSNSASQSFFWYRQDCRKEPKLLMSVYSSGNEDGRFTAQLNRASQYISLLIRDSKLSDSATYLCAV
Pan paniscus V72 trav AJFE02070021.1 118640 TVRAQSVTQPDIHITVSEGASLELRCNYSYGATPSLFWYVQSPGQGLQLLLKYFSGDTLVQGIKGFEAEFKRSQSSFNLRKPSVHWSDAAEYFCAVG
Pan paniscus V73 trav AJFE02070021.1 134911 VNGENVEQHPSTLSVQEGDGAVIKCTYSDSASNYFPWYKQELGKGPQLIIDIRSNMGEKKDQRIAVTLNKTAKHFSLHITETQPEDSAVYFCAAS
Pan paniscus V74 trav AJFE02070021.1 154374 VWSQQKEVEQNSGPLSVPEGAIASLNCTYSDRRSQSFFWYRQYSGKSPELIMSIYSNGDEEDGRFTAQLNKASQYVSLLIRDSQPSDSATYLCAV
Pan paniscus V75 trav AJFE02070021.1 160865 GTRAQSATQLDSHVSVSEGALVLLRCNYSSSVPPYLFWYVQYPNQGLQLLLKYTTGATLVKGINGFEAEFKKSETSFHLTKPSAHVNDAAEYFCAVS
Pan paniscus V76 trav AJFE02070022.1 18239 VSRGESVGLHLPTLSVQEGDNSIINCAYSNSASDYFIWYKQESGKGPQFIIDIRSNMDKRQGQRVTVLLNKTVKHLSLQIAATQPGDSAVYFCAEN
Pan paniscus V77 trav AJFE02070022.1 24124 PGIAQKITQTQPGMFVQEKEAVTLDCTYDTSDPSYGLFWYKQPSSGEMIFLIYQGSYDQQNATEGRYSLNFQKARKSANLVISASQLGDSAMYFCAVRE
Pan paniscus V78 trav AJFE02070022.1 40937 RTRGDSVTQMEGPVTLSEEAFLTINCTYTATGYPSLFWYVQYPGEGLQLLLKATKADDKGSNKGFEATYRKETTSFHLEKDSVQASDSAVYFCALS
Pan paniscus V79 trav AJFE02070022.1 65331 VWSQQKEVEQDPGPLSVPEGAIASLNCTYSNSAFQYFMWYRQYSRKGPELLMYTYSSGNKEDGRFIAQVDTSSKYISLFIRDSQPSDSATYLCAMS
Pan paniscus V80 trav AJFE02070022.1 78782 GTRAQSVTQLDSQVFEEAPVELRCNYSSSVSVYLFWYVQYPNQGLQLLLKYLSGSTLVKGINGFEAEFKKSETSFHLRKPSVHISDAAEYFCAVS
Pan paniscus V81 trav AJFE02070022.1 90572 GTRAQRVTQPEKLLSVFKGAPVELKCNYSYSGSPELFWYVQYPRQRLQLLLRHISRESIKGFTADLNKGETSFHLKKPFAQEEDSAMYYCALS
Pan paniscus V82 trav AJFE02070022.1 97789 VNSQQGEEDPQALSIQEGENAIMNCSYKTSINNLQWYRQNSGRGLVHLILIRSNEREKHSGRLRVTLDTSKKSSSLLITASRAADTASYFCATD
Pan paniscus V83 trdv AJFE02070022.1 107859 SSMAQKVTQAQTEISVVEKEDVTLDCVYETRDTTYYLFWYKQPPSGELVFLIRRNSFDEQNEISGRYSWNFQKSTSSFNFTITASQVVDSAVYFCALSE
Pan paniscus V84 trav AJFE02070023.1 1079 LSGEDQVTQSPEALRLQEGESSSLNCSYTVSGLRGLFWYRQDPGKGPEFLFTLYSAGEEKEKERLKATLTKKESFLHITAPKPEDSATYLCAVQ
Pan paniscus V85 trav AJFE02070023.1 12993 VSSKQEVTQIPAALSVPEGDNLVLNCSFTDSAIYSLQWFRQDPGKGLTSLLLIQSSQREQTSGRLNASLDKSSGRSTLYIAASQPGDSATYLCAV
Pan paniscus V86 trav AJFE02070023.1 31160 VRGIQVEQSPPDLILQEGANSTLRCNFSASVNNLQWFHQNPWGQLINLFYIPSGTKQNGRLSATTVATERYSLLYISSSQTTDSGVYFCAVEPQCSP
Pan paniscus V87 trdv AJFE02070023.1 56534 SSVAQKVTQAQSSVSMPVRKAVTLNCLHEASWWSYYIFWYKQLPSKEMIFLIRQGSDELNAKSGRYSVNFKKAAKSVTLTISALQLEDSAKYFCALWE
Pan paniscus V88 trbv AJFE02070504.1 41727 VRSQTIHQWPATLVQPVGSPLSLECTVEGTSNPNLYWYRQAAGRGLQVLFYSVGIGQISSEVPQNLSASRPQDRQFILSSKKLLLSDSGFYLCAWS
Pan paniscus V89 trbv AJFE02104443.1 7870 GSRLSAVVSQHPSRVICKSGTSVNIECRSLDFQATTMFWYRQLRKQCLMLMATSNEGSKVTYEQGVKKDKFPINHPNLTFSALTVTSAHPEDSSFYICSAR
Pan paniscus V90 trbv AJFE02104444.1 3466 SMDTKVTQRPRLLVKANEQKAKTDCVPIKRHSYVYWYHKTLEEELKFLIYFQNEEIIQKAEIINERFSAQCPQNSPCTLEIQSTESGDTAWYFCANSK
Pan paniscus V91 trbv AJFE02104444.1 36553 LMEAEIYQTPRHRVIGTGKKITLECSQTMGHDKMYWSRSRNGITPHPPFLWVNSTEKGDLSSESTVSRIRIERFPLTLESASPSHTSQYLCASSE
Pan paniscus V92 trbv AJFE02104454.1 8638 SVFSAVISQKPSRDICQRGTSMTIQCQVDSQVTMMFWYCQQPGQSMTLIATANQGSEATYESRFVIDKFPISRPNLTFSTLTVSNRRPEDSSIYLCSVE
Pan paniscus V93 igkv AJFE02000028.1 3712 SSGDIVMTQTPLSLPVTPGEPASISCRSSESLLDTDDEYTYLNWYLQKPGQSPQLLIYEVSNRASGVPDRFSGSGSGTDFTLKISRVEAEDVGVYYCMQALQTP
Pan paniscus V94 igkv AJFE02002289.1 1292 ARCDIQMTQSPSSLSASVGDRVTITCRASQGIRNDLGWYQQKPGKAPKLLIYAASSLQSGVPSRFSGSGSGTDFTLTISSLQPEDFATYYCLQDYNYP
Pan paniscus V95 igkv AJFE02002352.1 822 ARCAIRMTQSPSSLSASTGDRVTITCRASQGISSYLAWYQQKPGKAPKLLIYAASTLQSGVPSRFSGSGSGTEFTLTISCLQSEDFATYYCQQYYSYP
Pan paniscus V96 igkv AJFE02003455.1 4738 TSGDIVMTQTPLSLPVTPGEPASISCRSSQSLLDSDDGNAYLDWYLQKPGQSPQLLIYEVSNWASGVPDRFSGSGSGTDFTLKISRVEAEDVGVYYCMQALQTP
Pan paniscus V97 trdv AJFE02010527.1 10724 SSVAQKVTQAQSSVSMPVRKAVTLNCLHEASWWSYYIFWYKQLPSKEMIFLIRQGSDELNAKSGRYSVNFKKAAKSVTLTISALQLEDSAKYFCALWE
Pan paniscus V98 trav AJFE02010527.1 3625 VSSILNVEQSPQSLHVQEGDSTNFTCSFPSSNFYALHWYRWETAKSPEALFVMTLNGDEKKTGRISATLNTKEGYSYLYIKGSQPEDSATYLCAF
Pan paniscus V99 iglv AJFE02010827.1 36527 SVTSYVLTQPPSVSVAPEQTARITCGGNNIGSKSVHWYQQKPGQAPVLVIYDDSDRPSGIPERFSGSKSGNTATLTISRVEAGDEADYYCQVWDSSSKH
Pan paniscus V100 iglv AJFE02010827.1 28606 SVVSSELTQDPAVSVALGQTVRITCQGDSLRSYYASWYQQKPGQAPVLVIYGNNNRPSGIPDRFSGSSSGNTASLTITGAQAEDEADYYCSSLDSSGNH
Pan paniscus V101 iglv AJFE02010827.1 12608 SWAQSALTQPPSVSGSPGQSVTISCTGTSSDVGSYNRVSWDQQPPGKAPKLMIYEVSKRPSGVPDRFSGSKSGNTASLTISGLQAEDEADYYCSSYTSS
Pan paniscus V102 iglv AJFE02010828.1 2918 SVTSYVLTQPPSVSVAPGQTARITCGGNNIGSKSVHWYQQKPGQAPVLVVYDDSDQPSGIPERFSGSKSGNTATLTISRVEAGDEADYYCQVWDSSSDH
Pan paniscus V103 iglv AJFE02010829.1 34520 SVASYELTQPSSVSVSPGQTARITCSGDVLAKNYARWFQQKPGQAPVLVIYKDSERPSGIPERFSGSSSGTTVTLTISGAQVEDEADYYCYSAADNN
Pan paniscus V104 ighv AJFE02010857.1 3784 AHSQVQLVQSGAEVKKPGASVKISCKASGYTFTSYGISWVRQAPGQGLEWMGWIDAYYGNTNYAEKLQGRVTMTTDTSRRTAYMELRRLRSDHTAVYYCA
Pan paniscus V105 iglv AJFE02017581.1 18194 SVASYELTQPPSVSVSPGQTASITCSGDKLGDKYAYWYQQKSGQSPVLVIYQDSKRPSGIPERFSGSNSGNTATLTISGTQAMDEADYYCQAWDS
Pan paniscus V106 iglv AJFE02017582.1 5118 LCALPVLTQPPSASASLGASVKLTCTLSSEHSTYTIEWYQQRPGRSPQYIMEVKSDGSHSKGDGIPDRFMGSSSGADRYLTISNLQSDDEAEYHCGE
Pan paniscus V107 iglv AJFE02017584.1 28558 SEASYELTQPPSVSVSPGQTARITCSGDALPKQYAYWYQQKSGQAPVLIIYEDSKRPSGIPERFSGSSSGTMATLTISGAQVEDEADYYCYSTDSSGNH
Pan paniscus V108 iglv AJFE02017584.1 17548 SWAQSALTQPPSASRSPGQSVTISCTGTSSDIGGYNYVSWYQQHPGKAPKLMIYEVSKRPSGVPDRFSGSKSGNTASLTVSGLQAEDEADYYCSSYAGSNN
Pan paniscus V109 iglv AJFE02017586.1 14432 SWAQSALTQPPSVSGSPGQSVTISCTGTSSDVGGYNYVSWYQQHPGTAPKLMIYDVSKRPSGVPDRFSGSKSGNTASLTISGLQAEDEADYYCCSYAGSYS
Pan paniscus V110 iglv AJFE02017587.1 7409 SATSYELTQPHSVSVATAQTARITCRGNNIGSKAVHWYQQKPGQDPVLVIYSDSNRPSGIPERFSGSNSGNTATLTISRVEAGDEADYYCQVWDSSSDH
Pan paniscus V111 iglv AJFE02017588.1 2551 SVASYELTQPPAVSVSPGQTARISCSGDVLRDNYADWYPQKPGQAPVLVIYKDGERPSGIPERFSGSTSGNTTALTISRVLTKGGADYYCFSGD
Pan paniscus V112 igkv AJFE02020628.1 28061 SWAQSVLTQPPSVSAAPGQKVTISCSGSSSDIGNYAVSWYQQLPGTAPKLLIYENNKRPSGISDRFSGSKSGTSATLGITGLWSEEEANYYCLAWDSSLRA
Pan paniscus V113 iglv AJFE02020628.1 22528 SWAQSVLTQPPSVSGAPGQRVTISCTGSSSNIGAGYDVHWYQQLPGTAPKLLIYENNKRPSGVPDRFSGSKSGTSASLAITGLQAEDEADYYCQSYDSSLSG
Pan paniscus V114 iglv AJFE02020628.1 4826 SLSQPVLTQPPSFSASPGESARLTCTLPSDINVGSYNIYWYQQKPGSPPRYLLYYYSDSDKGQGSGVPSRFSGSKDASANTGILVISGLQSEDAADYYCMI
Pan paniscus V115 iglv AJFE02020631.1 24086 SWAQSVLTQPPSVSGTPGQRVTISCSGSSSNIGSNTVNWYQQLPGTAPKLLIYSNNQRPSGVPDRFSGSKSGTSASLAVSGLRSEDEADYYCAAWDDSLNG
Pan paniscus V116 iglv AJFE02020631.1 9924 SNSQTVVTQEPSLTVSPGGTVTLTCASSIEAVTSGYYPNWFQQKPGQAPRALIYSTSNKHSWTPARFSGSLLGGKAALTLSGAQPEDEAEYYCLLYYGGA
Pan paniscus V117 iglv AJFE02020631.1 2391 SLSQPVLTQPTSLSASPGASARLTCTLRSGINVGSYYISWYQQKPGSPPRYLLNYYSDSDKGQGSGVPSRFSGSKDASTNAGLLLISGLQSEDEADYYCAIWYS
Pan paniscus V118 iglv AJFE02020632.1 8506 SNSQAVVTQEPSLTVSPGGTVTLTCSSSTGAVTSGHYPHWFQQKPGQAPRTLIYDTSNKHSWTPARFSGSLLGGKAALTLSGAQPEDEAEYYCWLSYSGA
Pan paniscus V119 iglv AJFE02020632.1 2109 SLSQSVVTQPASLSASPGASASLTCTLRSGINVGTYRISWYQQKPGSPPRYLLRYKSDSDKQQGSGVPSRFSGSKDASANAGILVISGLQSEDEADYYCMI
Pan paniscus V120 iglv AJFE02020634.1 1463 SWAQSVLTQPPSVSAAPGQKVTISCSGSSSNIGNNYVSWYQQLPGTAPKILIYDNNKRPSGISDRFSGSKSGTSATLGITGLQTGDEADYYCGTWDSSLSA
Pan paniscus V121 iglv AJFE02022796.1 9462 SVVQAGLTQPPSVSKGLRQTATLTCTGNSNNVGNQGAAWLQQHQGHPPKLLSYRNNNRPSGISERFSASRSGNTASLTITGLQPEDEAEYYCSAWDSSLS
Pan paniscus V122 iglv AJFE02022797.1 20397 SLSQPVLTQSSSASASLGSSVKLTCTLSSGHSSYIIAWHQQQPGKAPRYLMKLEGSGSYNKGSGVPDRFSGSSSGADRYLTISNLQSEDEADYYCETWDS
Pan paniscus V123 iglv AJFE02022797.1 1687 SWANFMLTQPHSVSESLGQTVTISCPRSSGSIASNYVQWYQQRPGSAPTTVIYEDNRRPSGVPDRFSGSIDRSSNSASLTISGLKSEDEADYYCQSYDSS
Pan paniscus V124 iglv AJFE02022799.1 84872 SLSQLVLTQSPSASASLGASVKLTCTLSSGHSSYAIAWHQQQPEKGPRYLMKLNSDGSHSKGDGIPDRFSGSSSGAERYLTISSLQSEDEADYYCQTW
Pan paniscus V125 iglv AJFE02022799.1 16701 VDSQTVVTQEPPFSVSPGGTVTLTCGLSSGSVSTSYYPSWYQQTPGQAPRTLIYSTNTRSSGVPGRFFGSIIGNKAALTITGAQADDESDYYCLLYMGSGI
Pan paniscus V126 iglv AJFE02022800.1 2360 SWAQSALTQEASMSGTVGQKVTLSCTGNSNNVGNYAVGWYQQISHGAPKTVMFGNSLPSGIPDRFSGSKSGTTASLTISGLQPEDEADYYCPTWDYSLS
Pan paniscus V127 trdv AJFE02024276.1 167743 VSLDIILEPDTKALTVLIGEAATLRCSITGGDLKNYQMSWYKKSEDNSLILVSKLSNNSNDNLGNNFKVKIDTLKSQLMLDIQKATTQDVRTYYCASD
Pan paniscus V128 trdv AJFE02024276.1 146935 VMSAIELVPEHQTVTVSMGVPATLSCSMKGEAIGNYYINWYRKTQGNTMTFIYRERDIYGPGFKDNFQGDIDIAKNLAVLKILAPSERDEGSYYCAC
Pan paniscus V129 trav AJFE02024278.1 22249 GTSSNSVKQTGQITVSEGASVTMNCTSASTGYPTPFWYVQYPSKPLQLLQRETMENSKNFGGGNIKDKNSPVVKYSVQVSDSAVYYCLLGDTVLK
Pan paniscus V130 trav AJFE02024278.1 16469 VSAARNEVEQSPQDLTAQEGELITINCSYSVGINALHWLQQHPGGGIVSLFMLSSGKKKHGRLIATINIQEKHSSLHITASHPRDSAIYICAV
Pan paniscus V131 trav AJFE02024279.1 100225 VSSQELEQSPQSLIVQEGKNLTINCTSSKTLYGLYWYKQKYGEGLIFLMMLQKGGEEKSHEKITAKLDEKKQQSSLHITASQPSHAGIYLCGA
Pan paniscus V132 trav AJFE02024279.1 86280 VSGQQLNQSPQSMFIQEGEDVSMNCTSSSIFNTRLWYKQDPGEGPVLLIALYKAGELTSNGRLTAQFGITRKDSFLNISASIPSDVGIYFCAG
Pan paniscus V133 trav AJFE02024279.1 81519 VSSEDKVVQSPLSLVVHEGDTVTLNCSYEVTNFQSLLWYKQEKKAPTFLFMLTSSGIEKKSGRLSSILDKKELFSILNITATQTGDSAIYLCAVE
Pan paniscus V134 trav AJFE02024279.1 27111 FSMAQTVTQSQPEMSVQEAETVTLSCTYDTSESDYYLFWYKQPPSRQMILVIRQEAYKQQNATENRFSVNFQKAAKSFSLKISDSQLGDAAMYFCAYRS
Pan paniscus V135 trav AJFE02024279.1 5169 LSGELKVEQSPLFLSTQEGKNYTIYCNYSTTSDRLYWYRQDPGKSLESLFVLLSNGAVKQEGQLMASLDTKARLSTLHITAAVHDLSATYFCAV
Pan paniscus V136 trav AJFE02024280.1 4176 IMGDAKTTQPNSMESNEEEPVHLPCNHSTISGTDYIHWYRQLPSQHPEYVIHGLTSNVNNRMASLTIAEDRKSSTLILHRATLRDAAVYYCILR
Pan paniscus V137 ighv AJFE02045456.1 2083 VLSQVTLKESGPTLVKPTQTLTLTCTFSGFSLSTSGVGVGWIRQPPGKALEWLALIYSDNDKRYSPSLKSRLTITKDTSKNQVVLTMTNMDPVDTATYYCAHR
Pan paniscus V138 ighv AJFE02045464.1 347 VQCEVQLVESGGGLVQPGGSLTLSCAASGFTFSSYWMSWVRQAPGKGLEWVANIKKDGSEKYYADSVKGRFTISRDNAKNSLYLQMNSLRAEDTAVYYCAT
Pan paniscus V139 ighv AJFE02045469.1 768 AHSQVQLVQSGAEVKKPGASVKVSCKASGYTFTSYDINWVRQATGQGLEWMGWMNPNSGNTGYAQKFQGRVTMTRDTSISTAYMELSSLRSEDTAVYYCAR
Pan paniscus V140 ighv AJFE02045472.1 1100 VQCEVQLVESGGGVVQPGRSLRLSCAASGFTFSNYAMHWVRQAPGKGLEWVSVISSSGSYIYYADSVKGRFTISRDNAKNSLYLQMNSLRAEDTALYYCAK
Pan paniscus V141 ighv AJFE02045478.1 1548 VQCQVQLVESGGGLVKPGGSLRLSCAASGFTFSNHYMSWIRQAPGKGLEWVSYISYDSSYINYADSVKGRFTISRDNAKNSLYLQMNSLRAEDTAVYYCAR
Pan paniscus V142 igkv AJFE02047612.1 1369 TRCDIQMTQSPSSLSASVGDRVTITCRASQGISNYLAWYQQKPGKAPKLLIYYASRLESGVPSRFSGSGSGTDYTLTISSLQPEDFATYYCQQYNSNP
Pan paniscus V143 trbv AJFE02070505.1 119399 SMDADVTQTPRNRITKTGKRIMLECSQTKGHDRMYWYRQDPGLGLRLIYYSFDVKDINKGEISDGYSVSRQAQAKFSLSLESAIPNQTALYFCATSD
Pan paniscus V144 trbv AJFE02070505.1 105356 LMEADIYQTPRYLVIGTGKKITLECSQTMGHDKMYWYQQDPGMELHLIHYSYGVNSTEKGDLSSESTVSRIRTEHFPLTLESARPSHTSQYLCASSE
Pan paniscus V145 trbv AJFE02070505.1 60835 PLEAQVTQNPRYLITVTGKKLTVTCFQNMNHEYMSWYRQDPGLGLRQIYYSINVEAIEKGDVPEGYNVSRKEKRNFPLILESPSPNQTSLYFCASSL
Pan paniscus V146 trbv AJFE02070505.1 55548 LVDVKVTQSSRYLVKRMGEKVFLECVQDMDHENMFWYRQDPGLGLRLIYFSSDVKMKEKGDIPEGYSVSREKKERFSLILESASTNQTSMYLCASSI
Pan paniscus V147 trbv AJFE02070505.1 36763 SVFSAVISQKPSRDICQRGTSLTIQCQVDSQVTMMFWYRQQPGQSPTLIATANQGSEATYETGFVIDKFPISRPNLTFSTLTVSNMSPEDSSIYLCSVE
Pan paniscus V148 trbv AJFE02070506.1 34168 LSNAGVMQNPRHLVRRRGQEARLRCSPVKGHNHVYWYRQLPEEGLKFMVYLQKENIIDESGMPKERFSAEFPKEGPSILRIQQAVRGDSAAYFCAS
Pan paniscus V149 trbv AJFE02070506.1 31048 TVDGGITQSPKYLFRKEGQNVTLNCEQNLNHDAMYWYRQDPGQGLRLIYYSQIVNDFQKGDIAEGYSVSREKKESFPLTVTSAQKNPTAFYLCASSI
Pan paniscus V150 trbv AJFE02070506.1 23183 GSGLGAVVSQHPSRVICKSGTSVKIECRCLDFQATTMFWYRQFPKQSLMLMATSNEGSKATYEQGVEKDKFLINHASLTLSTLTVTSAHPEDSSFYICSAR
Pan paniscus V151 trbv AJFE02070506.1 13227 STDTKVTQRPRLLVKASEQKAKMDCVPIKGHSYVYWYRKKLEEELEFLVYFQNEELIQKAEIINERFLAQCPKNSSCTLEIQSTESGDTALYFCASSK
Pan paniscus V152 trbv AJFE02070506.1 4170 SFHAKVTQTPGHLVKGKGQKTKMDCTPEKGHVFVYWYQQNQNKEFMLLISFQNEQVLQETEMHKTRFSSQCPKNTPCSLAILSSEPGDTALYLCASSQ
Pan paniscus V153 trbv AJFE02070507.1 19870 LIDAGVTQTPRHKVTEMGQEVTMRCQPILGHNTVFWYRQTMMQGLELLAYFRNRAPLDDSGMPKDRFSAEMLDATLATLKIQPSEPRDSAVYFCASGL
Pan paniscus V154 trbv AJFE02070507.1 13046 HKEAGVTQFPSHSVIEKGQTVTLRCDPISGHDNLYWYRRVMGKEIKFLLHFVRESKQDESGMPNNRFLAERTGGTYSTLKVQPAELEDSGVYFCASSQ
Pan paniscus V155 trbv AJFE02070507.1 2923 SPGEEVTQTPKHLVRGEGQKAKLYCAPIKGHSYVFWYQQVLKKEFKFLISFQNENVFDKTGMPKERFSAKCLSNSPCSLEIQATKLEDSAVYFCASSQ
Pan paniscus V156 trbv AJFE02070508.1 10891 LIEAGVVQSPRYKIIEKKQPVAFWCNPISGHNTLYWYWQNLGQGPELLIRYENEEAVDDSQLPKDRFSAERLKGVDSTLKIQPAELGDSAVYLCASSL
Pan paniscus V157 trbv AJFE02070508.1 5296 HTDAGVIQSPRHEVTEMGQEVTLRCKPISGHNSLFWYRQTMMQGLELLIYFNNNVPIDDSGMPKDRFSAKMPNASFSTLKIQPSEPRDSAVYFCASSL
Pan paniscus V158 trbv AJFE02070509.1 178508 HTGAGVSQTPSNKVTEKGKDVELRCDPISGHAALYWYRQSLGQGPEFLIYFRGTGAADDSGLPNDRFFAVRPEGSVSTLKIQRTEQGDSAVYLCASSL
Pan paniscus V159 trbv AJFE02070509.1 173688 PVEAGVTQSLTHLIKTRGQQVTLRCSPISGHSSVSWYQQALGQGHQFISEYANELRRSEGNFPNRFSGRQFHDYCSEMNVSALELGDSALYLCARSL
Pan paniscus V160 trbv AJFE02070509.1 162993 HRDAEITQSPRHKITETGRQVTLVCHQTWNHNNMFWYRQDLGHGLRLIHYSYGVQDTNKGEVSDGYSVSRSNTEDFPLTLESAASSQTSVYFCASSE
Pan paniscus V161 trbv AJFE02070509.1 155242 LSEAEVAQSPRYKITEKSQAVAFWCDPISGHATLYWYRQILGQGPELLVQFQDESVVDDSQLPKDRFSAERLKGVDSTLKIQPAELGDSAMYLCASSL
Pan paniscus V162 trbv AJFE02070509.1 137849 HRDAGITQSPRHKITETGRQVTLMCHQTWSHSYMFWYRQDLGHGLRLIYYSAAADITDKGEVPDGYVVSRSKTENFPLTLESATRSQTSVYFCASSE
Pan paniscus V163 trbv AJFE02070509.1 111910 PVNGGVTQTPKFQVLKTGQSMTLQCAQDMNHDYMYWYRQDPGMGLRLIHYSAGAGITDKGEVPNGYNVSRSNTEDFPLSLVSAAPSQTSVYFCASSY
Pan paniscus V164 trbv AJFE02070509.1 107697 HTGAGVSQSPRYKVAKRGRDVALRCDSISGHVTLYWYRQTLGQGSEVLTYFRSDAQRDKSGRPSGRFSAERPERSVSTLKIQRTEQGDSAVYLCASSL
Pan paniscus V165 trbv AJFE02070509.1 99771 SVETGVTQSPTHLIKTRGQQVTLRCSPQSGHNTVSWYQQALGQGPQFIFQYYREEENGRGNFSPRFSGRQFPNYSSELNVNALELDDSALYLCASSL
Pan paniscus V166 trbv AJFE02070509.1 93327 PVNAGVTQTPKFRILKIGQSMTLQCAQDMNHNYMYWYRQDPGMGLKLIYYSVGAGITDKGEVPNGYNVSRSTTEDFPLRLESAAPSQTSVYFCASSY
Pan paniscus V167 trbv AJFE02070509.1 80311 PVDAGVTQSPTHLIKTRGQHVTLRCSPISGHKSVSWYQQALGQGPQFIFEYYEKEERGRGNFPDRFSARQFPNYSSELNVNALLLGDSALYLCASSL
Pan paniscus V168 trbv AJFE02070509.1 70679 HTGAGVSQSPRYKVTKRGQDVTLRCDPISGHVALYWYQQALGQGPEFLTYFNYEAQPDKSGLPNDRFSAERPEGSNSTLTIQRTEQRDSAMYLCASNL
Pan paniscus V169 trbv AJFE02070509.1 62860 SVDAGVTQSPIHLIKTRGQQVTLRCSPQSGHDTVSWYQQVLGQGPQCIFEYYEEEERQRGNFPDRFSGHQFPNYSSELNVNALLLGDSALYLCASSL
Pan paniscus V170 trbv AJFE02070509.1 55562 PVNAGVTQTPKFRILKTGQSMTLQCARDMNHGYMSWYRQDPGMGLRLIYYSAAAGTTDKEVPNGYNVSRLNTEDFPLRLVSAAPSQTSVYFCASSY
Pan paniscus V171 trbv AJFE02070509.1 51282 SISTDHTGAGVSQSPRYKVTKRGQDVTLRCDPISSHATLYWYQQALGQGPEFLTYFNYEAQPDKSGLPNDRFSAERPEGSISTLTIQRTEQRDSAMYLCASSL
Pan paniscus V172 trbv AJFE02070509.1 42837 PVDAGVTQSPTHLIKTRGQHVTLRCSPISGHTSVSWYQQALGQGPQFIFQYYEKEERGRGNFPDRFSARQFPNYSSELNVNALLLGDSALYLCASSL
Pan paniscus V173 trbv AJFE02070509.1 35527 PVNAVVTQTPKFQVLKTGQSMTLQCAQDMNHDCMSWYRQDPGMGLRRIHYSVAAGITDKGEVPDGYNVSRSNKEDLPLRLESAAPSQTSVYFCASSY
Pan paniscus V174 trbv AJFE02070509.1 30867 HTGAGVSQSPKYKVTKRGQDVALRCDPISGHVSLFWYQQALGQGPEFLTYFRNEAQLDKSGLPSDRFFAERPEGSVSTLKIQRTQQEDSAVYLCASSL
Pan paniscus V175 trbv AJFE02070509.1 22663 PVEAGVTQSPTHLIKTRGQQVTLRCSPISGHTSVYWYQQALGLGLQFLLWYDEGEERNRGNFPRRFSGRQFPNYSSELNVNALELEDSALYLCASSL
Pan paniscus V176 trbv AJFE02070509.1 13439 HADTGVSQDPSHKITKRGQNVTFRCDPISEHNRLYWYRQTLGQGPEFLTYFQNEAQLEKSRLLSDRFSAERPKGSFSTLEIQHTEQGDSAIYLCASSL
Pan paniscus V177 trbv AJFE02070509.1 6918 SVAAGVIQSPRYLIKEKRETATLKCYPIPRHDTVYWYQQGPGQDPQFLISFYEKMQSDKGSIPDRFSAQQFSDYHSELNMSSLELGDSALYFCASSS
Pan paniscus V178 trbv AJFE02070510.1 45597 PLDTAVSQTPKYLVTQMGKKESLKCEQNLGHNAMYWYKQDSKKFLKTMFIYSNKEPILNETVPNRFSPDSPDKAHLNLHINSLELGDSAVYFCASSQ
Pan paniscus V179 trbv AJFE02070510.1 42144 PMEMGVTQTPRHLVMGMTNKKSLKCEQHLGHNAMYWYKQSAKKPLELMFVYSLEERVENNSVPSRFSPECPNSSHLFLHLHTLQPEDSALYLCASSQ
Pan paniscus V180 trbv AJFE02070510.1 33844 PVNAGVTQTPKFRVLKTGQSMSLLCAQDMNHEYMYWYRQDPGMGLRLIHYSVGEGTTAEGEVPDGYNVSRLKKQNFLLGLESAAPSQTSVYFCASSY
Pan paniscus V181 trbv AJFE02070510.1 2333 PVIAGITQAPTSQILAAGRSMTLRCTQDMRHNAMYWYRQDLGLGLRLIHYSNTAGTTGKGEVPDGYSVSRANTDDFPLTLASAVPSQTSVYFCASSD
Pan paniscus V182 trbv AJFE02070511.1 811 PVNAGVTQSPKFRVLKTGQSMTLQCAQDMNHNYMYWYRQDPGMGLRLIHYSAGEGTTAKGEVPDGYNVSRLNTQNFLLRLESAAPSQTSVYFCATSE
Pan paniscus V183 ighv AJFE02119967.1 6054 AQSRVQLAQSGAEVKKPGASVKVSCKASGYTFTSYRMHWVCQAHAQGLEWMGLVCPSDGSTSHAQKFQGRVTITRDTSMSTAYMELSSLRSEDTAMYYCVR
Pan paniscus V184 ighv AJFE02119983.1 4399 VQCEVQLVESGGGLVQPGGSLRLSCAASGFTFSDHYMSWVRQAQGKGLELVRLIRNKANSYTTEYAASVKGRFTISREDSKNTLYLQMSSLKTEDLAVYYCAR