WGS Statistics
Organism WGS Record. Vs Total IGHV IGLV IGKV TRAV TRBV TRGV TRDV
Loxodonta africana AAGU00000000.3 (AAGU03) 263 63 2 74 61 46 5 12
Vgene Table
Organism Vgene Locus contig Contig Pos. AA sequence
Loxodonta africana V62 trgv AAGU03015108.1 9373 SQKASSLDMRKISVTKQRGTSVVITCDLDLNVNYIHWYRYREGEALQRLLYYYIPTSAVTMDSGFNSRKYHASGNTATNCKVELKNLEESDSGVYYCAAWD
Loxodonta africana V63 trgv AAGU03015108.1 30671 GLGVLKVEQSQISISTVVKKSIDIYCSVSSRDFENEVIHWYRLKPNQALEHLLYITSTKNPTRSRLGEKDNKVEARKVSHSSTSIFTIHFIEEEDVAIYYCAGWY
Loxodonta africana V64 trgv AAGU03015108.1 35902 VLGQIKLEQSEISVSKLASKSADITCKASSVEYGIHWYRQKPNQTIEHLAYITSTQSTNLVNLGGKKNKLKASINVQESTSILTINFIEKEDGAIYYCAAWD
Loxodonta africana V65 trgv AAGU03015112.1 1569 GNTEMRISQDQLSSTRRPDRTVHISCKLSVVPLENAIVHWYQQKEGEPLKRILYGSSKDYKQDQPNPRMETDVKGNGVFYLIINKVTKEDEATYYCACWD
Loxodonta africana V66 trgv AAGU03015113.1 61733 GDTKMRMSQDQLSSTRRPDRTVHISCKLSGVPLENAFVHWYQQKEGEPLKRILYGSTKSYKQDQSNPRMETDEKENGVLHLKINKVSKEDEATYYCACWD
Loxodonta africana V360 igkv AAGU03067079.1 26077 ASGDTVLTQTLALLSVSLRESASIICRANQSFSDYLSWYQKKPGQPPQLLIYNVDDQYSGIPDRFTGIQSGTEFILTIDNVEADDAADYYCLQVYNF
Loxodonta africana V383 ighv AAGU03070539.1 66731 VLSQVTLKESGPGLIKPSQTLSLTCTVSGFSLSTSGVGVSWIRQPPGKALEWLALIYWDDDKRYSSSLKSRLTISKDNSKKQVYLTMTNTDPVDTATYYCARG
Loxodonta africana V384 ighv AAGU03070539.1 119561 VQCEMQLVESGGDLRKLRRSLRLSCAASGFTFSNYWMNWFCQAPGKGLDWVAEINPNSGTKNYGPSVKGRFTISRENAKNTLYLQMDKLRTQDTARYYCAR
Loxodonta africana V385 ighv AAGU03070539.1 137604 VHCEVQLVESGGDLRKPGGSLKLSCVASGFTFSNYGMNWIRQYPGKGLEWVALIWHDGSKKYYAGSVKGRFTISRDNSKNTLYLQMDSLRSEDTAMYYCAV
Loxodonta africana V386 ighv AAGU03070544.1 29787 THSEVQVVQSGDEVKKPGASVKISCKASGDDFARFYMQWVRQASGKGFEWIGGYDASDSETKYSQKFQGRATITGDTSTNTDYLELNSLSSEDTAVYYCA
Loxodonta africana V387 ighv AAGU03070544.1 35888 PGLVKPSQTLSLTCTVTGGSISSDCAWSWIHQPPGKGLEWLGAVYYSGSSWDTRYGSSIQGRISITADSSKKQFSLQLSSVTSEDTAMYYCAR
Loxodonta africana V388 ighv AAGU03070544.1 50098 VLSQVRLQESGPGLVKPSQTLSITCSVSGFSLTSYDMAWFRQPPGKGLEWVGAIWTGGGRGYNPTVASQVSITRDTSKSQVYFQLSSVTPEDTALYHCAR
Loxodonta africana V389 ighv AAGU03070544.1 68443 VHCEVQLVESGGDLRKPGGSLKLSCVASGFTFSNYDMNWICQYPGKGPEWVAFIQYSGGKKYYADSVKGWFTISRDNSKNTVYLQMDSLRREDTAMYYCAS
Loxodonta africana V390 ighv AAGU03070544.1 100045 VLSQVQLKESGPGLVKPSQTLSLTCTVTGGSISSDYGWNWIRQPPGKGLEWLGVAYYSGSSWKTSYGSSVKGQISITADSSKKQFSLQLSSVTSEDTAVYYCAR
Loxodonta africana V391 ighv AAGU03070544.1 140154 VHSEVQLVQSGAEVKKPGASVKISCKVSGGDFSIYYDSIGWVRQASGQGLEWIGGYNSGDGEAKYSQKFQGRVTITSDESTNTAYMELSSLSSEDTAVYYCA
Loxodonta africana V392 ighv AAGU03070544.1 166593 VLSQVQLKESGPGLVKPSQTLSLTCTVTGDSISSGYAWIWIRQPPGKGLEWLGVGYYGESSWNTNYGSSIQGRISITADSSKNQFSLQLSSATSEDTAVYYCAT
Loxodonta africana V393 ighv AAGU03070544.1 201586 VHCEVQLVESGGDLRKPGGSLKLSCVASGFTFSNYDMKWICQYPGKGPEWVAFIQYSGGNKYYTDSVKGWFSISRDNCKNTVYLQMDSLRREDTAMYYCAS
Loxodonta africana V394 ighv AAGU03070544.1 233191 VLSQVQLKESGPGLVKPSQTLSLTCTVTGGSISSDYAWSWIRQPPGKGLEWLGVGYYSRSSWNTKYGSSVQGRISITADSSKKQFSLQLSSATSEDTAVYYCAR
Loxodonta africana V395 ighv AAGU03070544.1 247213 VLSQVRLQESGPGLVKPSQTLSITCSVSGFSLTSYDMTWFRQPPGKGLEWVGAIWTGGGTGYNPTVASRVSITRDTSKSQVYFQLSSVTPEDTAVYYCAR
Loxodonta africana V396 ighv AAGU03070544.1 300457 VLSQVQLQKSGPGVVKPSQTLSLTCTVTGGSISSDYAWSWIRQPPGKGLEWLGAVYYSESSWDTSYGSSIKGRISITADSSKNQFSLQLSSATSEDTAMYYCAR
Loxodonta africana V397 ighv AAGU03070546.1 54132 VLSQVQLKESGPGLVKPSQTLSLTCTVTGGSISSDYAWSWIRQPPGKGLEWLGVGYYGESSWNTNYGSSLKGRISITADSSKKQFSLQLSSVTSEDTAVYYCAR
Loxodonta africana V399 ighv AAGU03070552.1 26613 VLSQVKLQESDPGLGKPSQTPSLTCAYSGLSLTSYVVSWVRQAPGRGLEWVGVITSSGSMSYYPALASRVSITKDDSKSQVYLKLRSVNPEDTAMYYCA
Loxodonta africana V400 ighv AAGU03070552.1 45067 ALSQVKLQESGPGLVKPSQTLSLTCAVSGFSLTSYGVGWVRQAPGKGLEWVGVIWYNRNKNYNPTLKSRFSITRDTSKSQVYLKLTSVNLENTAMYYCAR
Loxodonta africana V401 ighv AAGU03070555.1 9570 KLQESGPGLVRPSGSLSLTCTVSGFSLTSYGVSWIRQAPGKGLEWLSEVGYDGNKYYNPTLKSRLSFDRHTTKSQVYLKLSSVNLEDPAMYYCARGTMRE
Loxodonta africana V402 ighv AAGU03070557.1 1309 AHSQVQLVQSGPEVKKPGELVKVSCRASGYTFTSYSINWVQQKPGKGLQYIGWINTDTGKPTYHQGFTERYVLSMDTSVSTAYLQISSLNPEDTATYYCAR
Loxodonta africana V403 ighv AAGU03070557.1 34054 AHCEMKLVESGGDLRQPGGSLRLSCVASGFTFDDYGMSWVRQAPGKGLQWVSYISWSGSSIYYAGSVKGRFTTSRDNAKNTLYLQMDRLTQEDTALYYCAT
Loxodonta africana V404 ighv AAGU03070562.1 23778 ASSQVKLQESGPEMVKPSEILSLTCTVSGFSLTSYGVSWIRQAPGKGLEWLGAVAYDGSKYYNPTLKSRLSFDRHTTKSQVYLKLSCVNPNDTAMYYCAR
Loxodonta africana V405 ighv AAGU03070564.1 42035 AHCEVKLVESGGDLRQPGGSLRLSCVASGFTFKDYAMSWFRQASGKGPQWVSSITGDSSNIYYTDSVKGRFTTSRDNAKNTLYLQMDRLTQEDTALYYCAI
Loxodonta africana V406 ighv AAGU03070564.1 65674 ALSQVKLQKSGPGLVRPSESLSLTCTVSGFSLTSYGVSWIRQAPGKGLEWLGTVGYDGSKYYNPTLKSRLSFDRHTIKSQVYLKLSSVNFEDAAMYYCAR
Loxodonta africana V407 ighv AAGU03070565.1 25063 AHCEVKLVESGGDLRQPGGSLRLSCVASGFTFKDAAMSWFRQASGKGPQWVSSITGDSSNIYYTDSVKGRFTTSRDNAKNTLYLQMDRLTQEDTALYYCAI
Loxodonta africana V408 ighv AAGU03070568.1 15046 ALSQVTLKESGPGVIKPSQTLSLTCTFSGFSLSTSNIGVGWIRQPPGKALEWLVTVWWDDDKYYHSSLKSRLTISKDTSKNQVFLRMTSMDPADTATYYCARV
Loxodonta africana V409 ighv AAGU03070568.1 49260 VQAKDHLVQWGEGMVVHSQKLSLFCATYTRSISRYGVSWIRHSPEKGLEWIGIIWGDGSTNYNPNLQSRVSISRDTGKNQVFLQLSTMTAEDAGMYYCAQ
Loxodonta africana V410 ighv AAGU03070569.1 3929 VLSQAQLQESGPGVMKPSQTLSLTCAVSGFSLTSDYMSWVRQAPGKGLEWVSAISYGGITYYTLTLASRVSITSDTFKNQVYLKLNSLNPDDMAVYYCSR
Loxodonta africana V411 ighv AAGU03070570.1 11431 ILSQVQLKESGPGVVKPSQTLPLICAVSGFSLTSYDVGWVCQSPGKGLEWVGAICSGGSTYYNPALKSRLSITRDTSKSQVYLQLTSVNPEDTAVYYCAK
Loxodonta africana V412 ighv AAGU03070570.1 34610 ILSQVQLKESGPGVVKPSQTLSLTCGLSGFSLSSYAAGWVRQAPGKGLEWVGAIASSGSTYYNPALKSRLSITTDTSKGQVYLKLTSVNPEDTAMYYCAG
Loxodonta africana V413 ighv AAGU03070570.1 57260 ILSQVQLKESGPGVVKPLQTLSLTCAVSGFSLTSYGVDWVRQAPGKGLEWVGAIAGSGGSTYYNPTLKSRLSITRDTSKSQVYLQLTSVNPEDMAMYYCAA
Loxodonta africana V414 ighv AAGU03070571.1 33951 VCAQVQLVQSGAEVKSPGQSLKISCKTSGSSFTGYWISWLRQMPGKGLEWMGGIYPGDSDTCYSPSFQGQVTISSENSISTTHLQWSSLKTTDTAMYYCAR
Loxodonta africana V415 ighv AAGU03070572.1 61462 ILSQVQLKESGPGVVKPSQTLSLTCAVSGFSLTSYGVDWVRQAPGKGLEWVGAIAGSGGSTYYNPTLKSRLSITRDTSKSQVYLQLTSVNPEDTVMYYCAT
Loxodonta africana V416 ighv AAGU03070574.1 40173 ILSQVQLKESGPGVVKPSQTLSLTCAFSGFSLTSYVVSWVRQAPGKGLEWVGAIAGSGGSTYYNPALKSRLSITKDTSKSQVYLQLTSVNPEDTAVYYCAK
Loxodonta africana V417 ighv AAGU03070574.1 71020 ILSQVQLKESGPGVVKPSQTLSLTCAVSGFSLSSYGAGWVRQAPGKGLEGVGAIAGSGSTYYNPALKSRLSITKDTSKSQVYLKLSSVNPEDTAMYYCAG
Loxodonta africana V418 ighv AAGU03070574.1 93610 ILSQVQLKESGPGVVKPSQTLSLTCAVSGFSLTSSYMSWVCQAPGKGLEWVGVITDGGSTYYNPTLKSRLSITTDTSKSQVYLQLTSVNPEDMAMYYCAA
Loxodonta africana V419 ighv AAGU03070574.1 117107 ILSQVQLKESSPGVVKPSQTLSLTCALSGFSLTSYAVGWVRQAPGKGLEGVGAIDAYGSTYYNPTLKSWLSITTDTSKSQVHLKLSSVNPEDTDMYYCAI
Loxodonta africana V420 ighv AAGU03070574.1 139514 ILFQVQLKESGPGVVKPSQTLSLTCAVSGFSLTSYAVGWVRQAPGKGLECVGAIWRDGSTYYNPALKSRLSITRDTSKSQVDLKLSSVNPEDTAMYYCAK
Loxodonta africana V421 ighv AAGU03070576.1 4697 ILSQVQLKESGPGVVKPSQTLSLTCAVSGFFLTSYTVGWVRQTPGKGLEWIGGIIAGGSTYYNPTLKSRLSITKDTSKSQVYLQLTSVNPEDTAMYYCTG
Loxodonta africana V423 ighv AAGU03070576.1 25389 ILSQVQLKESGPGVVKPSQTLSLTCAVSGFSLTSYDVGWVRQAPGKGLEWVGAIDNGGSTCYNPALKSRLSITRDTSKSQVYLQLTSVNPEDTAVYYCAK
Loxodonta africana V424 ighv AAGU03070580.1 6653 ILSQVQLKESGPGVVKPSQTLSLTCSVSGVSLSSYAVGWVLQAPGKGLEGVGAIASSGSTYYNPALKSRLSITRDTSKSQVYLQLTSVNPEDTAMYYCAR
Loxodonta africana V425 ighv AAGU03070582.1 13409 ILSQVQLKESGPGVVKPSQTLSLTCSVSGVSLSSYGAGWVRQAPGKGLEWVGAIAGSGSTYYNPALKSRLSITRDTSKSQVYLQLTSVNPEDTAMYYCAG
Loxodonta africana V426 ighv AAGU03070582.1 64068 ILSQVQLRESGPGVVKPSQTLSLTCAVSGFSLTSNHMNWVHQALGKVLELVGVIWSSGDIGYNPSLKSQVSITRDTSKSQVYLQLTSVNPEDMAMYYCAK
Loxodonta africana V427 ighv AAGU03070582.1 71730 ILSQVQLKESGPGVVKPSQTLSLTCAVSGFSLTSSAVGWVRQAPGKGLEWVGAIAGSGGSTYYNPALKSRLSITRDTSKSQVYLQLTSVNPEDTAVYYCAK
Loxodonta africana V428 ighv AAGU03070584.1 11686 ILSQVQLKESGPGVVKPSQTLSLTCALSGFSLSSYGAGWVRQAPGKGLEWVGAIAGSGSTYYNPALKSRLSITRDTSKSQVYLQLTSVNPEDTTMYYCTG
Loxodonta africana V429 ighv AAGU03070584.1 49880 VCAQVQLVQSGAEVKSPGQSLKISCKTSGYSFTSYWISWVRQMPGKGLEWMGGIYPGDSDTRYSPSFQGQVTISSENSISTTYLQWSSLKTTDTAMYYCAR
Loxodonta africana V430 ighv AAGU03070584.1 106032 VLSQVQLKESGPGVVKPSQTLSLTCSVSGSSITTSYYYWSWIRQSTEKGLQWIGYINYSGGTGYNLSLKSRSSISRDTSKNEFSLQLTSVTADDTAVYYCAR
Loxodonta africana V431 ighv AAGU03070586.1 4923 VLSQVQLKESGPGVVKPSQTLSLTCSVSGYSITSGYYWSWIRQSTEKGLQWTGYIAYSGSTGYNPSLKSCSSISRDTSKNEFSLQLSSVTTDDTAVYYCAR
Loxodonta africana V432 ighv AAGU03070586.1 20686 ILSQMQLKESGLGLVKPSQTLSLTCAVSGFSITTSYYCWHWIRQSREKGLQWIAIICYNGGSGYNPSFKSRTSISRDTSKNEFSLQLNSVTADDTAVYYCAR
Loxodonta africana V433 ighv AAGU03070587.1 45517 VLSDLTLRESGPGLVKPMETLSLICSVSGGSVTSSYYWSWIRQHPGKGLEWMGYWSGSASYNQAFQGRVSITANTAKNQFFLQLNFVTTEDTALYYCSR
Loxodonta africana V457 iglv AAGU03074993.1 12223 SVTSSELTQPPSVSVAQGQTASITCSGGNFESYYVHWFQQKPGQAPVLVIFKDSQRPLGIPDRFSGSSSGNTATLTISTVQAEDEADYYCQSGDSSSSD
Loxodonta africana V458 iglv AAGU03074995.1 1173 SVTSSELTQPPSVSVAQGQTASITCSRDNIGSYYIHWYQQKPGQAPVLAICNSNSRPSGTPDRFSGSNSGNTATLTISRVQAEDEADYYCQSGDSSSSA
Loxodonta africana V494 trbv AAGU03080263.1 27640 VRAQTISQWPVVEVRRVGSPLSLQCTVTGTSNPYLYWYRQAPGGPPQLLFFSVGVNDVQTEAPEHLSASRPQDGQFTLSSEKLQPGDSGVYLCAWG
Loxodonta africana V497 igkv AAGU03081090.1 12939 ASGDIVLTQSPASLAKSQGETVTINCKASQSVSSYLNWYQQKPGQAPKLLIYGASDRASGVPDRFSGSGSGTDFTLTINNFQADDAAVYYCLQYNDEP
Loxodonta africana V498 igkv AAGU03081090.1 32983 ASGDIVLTQSPASLAKSQGETVTIKCKASQSVSSYLAWYQQKPGQAPKLLIYDASSRASGVPDRFSGSGSGTDFTLTISNFQADDAAVYYCQQGNN
Loxodonta africana V499 igkv AAGU03081090.1 47945 ASGDIVLTQSPASLAKSQGETVTINCKASQSVSNDLGWYQQKPGQAPKLLIYAASSRASGVPDRFSGSGSGTDFTFTISNFQPEDAAVYYCLQDYNN
Loxodonta africana V500 igkv AAGU03081093.1 2944 ASGDIVVTQSPASVAKSQGETVTINCKASQSVSSYLAWYQQKPGQAPKLLIYKASSRASGVPDRFSGSGSGTDFTLTISNFQAEDAAVYYCQLYYSV
Loxodonta africana V501 igkv AAGU03081094.1 23892 ASGDIVLTQSPASLAKSQGETVTINCKASQSVSSYLNWYQQKPGQTPKLLIYRISNRASGVPDRFSGSGSGTYFTLTINNFQADDAAVYYCQQGNN
Loxodonta africana V502 igkv AAGU03081094.1 47476 ASGDIVLTQSPASLAKSQGETVTINCKASQRVSSYLAWYQQKPGQAPKLLIYGASKRGSGVPDRFSGRGSGTDFTLTINNFQADDAAVYYCQQYDNVP
Loxodonta africana V503 igkv AAGU03081101.1 1397 ASGDIVLTQSPASLAKSQGETVTINCKASQSVSNYLSWHQQKPGQAPKLLIYKASNQASGVPDRFRGSGSGTDFTLTISNFQADDAAVYYCQQDNN
Loxodonta africana V504 igkv AAGU03081103.1 1833 ASGDIIMTQSPASLAASPGGTVTINCKSSQSLFYSSNKKDYLAWYQQKPGQVLKLLIYYASNGASGVPDRFSGSGSGTDFTLTISNFQAEDAAVYFCLQSYD
Loxodonta africana V505 igkv AAGU03081103.1 16839 ATGDIVMTQSPASLAATPGETVTINCKSSQSLFYSSDKKDYLAWYQQKSGQAPKLLISWASTQASGIPDRFSGSGSGTDFTLTISSFQAEDVAVYHCHQVYSSP
Loxodonta africana V522 trav AAGU03084636.1 626 STMAQEVTQDQPATSVVEKMAVTLDCVYKTQDIDYALFWYKQPPSGEMIFLVRQESYNKQNATEGRYSLNFQKEARFISLTITASQLRDSAVYFCALKD
Loxodonta africana V523 trav AAGU03084636.1 11053 GTNGDSVTQTEGPVTLSEGAPTILNCTYQSSYTTSLFWYVQYLNKAPQLLLKSSTETENQGFQANLVKRENSFHLQKRSIQISDSALYYCVMT
Loxodonta africana V524 trav AAGU03084636.1 36951 VTGQQVEQSPSVLSLQEGASCTMTCNFSFSSDTVQWFHQNSGGRLTTLFYVPTGTKQDGRLSARTVTKERHSSLYISSSQTTDSAIYFCAVSHSAPP
Loxodonta africana V525 trdv AAGU03084636.1 51459 SIVAQKVTQVQPAISTEEGAAVTLGCLYETSETNYYIFWYKQLPSGEIIFLILQYSSKPNSKDGRYSLDFQKKDKSISLTISTLQLEDSAKYFCALGK
Loxodonta africana V526 trav AAGU03084637.1 2531 VNGQVEQNPDALHIQEGENVTMNCSYKTTIKNLQWYRQDSGRGLVLQILILSNEKEKPNGRLKATLDTSTKSSFLFITASQAADTATYFCALD
Loxodonta africana V527 trav AAGU03084637.1 14868 VNSQVEQNPEALHIQEDENVTMNCSYKTTLGNLQWYRQDPGRGLVLQILVLSNEKEKPNGRLRVTVDTSTKISFLFITASQAADTATYFCALD
Loxodonta africana V528 trav AAGU03084637.1 49669 STMAQEVTQDQPATSVVEKTAVTLGCVYKTQDTNYVLFWYKQPPSGEMIFLVRQEPYNKQNATEGRYSLNFQKEAKFISLTITASQLRDSAVYFCALKD
Loxodonta africana V529 trav AAGU03084637.1 60076 GSNGDSVTQTEGPVTLSEGAPTILNCTYQSSYTTSLFWYVQYLNNAPQLLLKSSTETENQGFQANLVKSENSFYLQKRSLQISDSALYYCAMR
Loxodonta africana V530 trav AAGU03084637.1 81811 SSGEDQVEQSPRALILQEGDDSSLNCSYSVNYFTGLQWYKQDPGKGPEFLFLLSSVGDKNQKERLRGTLSKQESSLHITASKPEDSATYFCAV
Loxodonta africana V531 trav AAGU03084637.1 120354 VTGQQVEQSPPVLSLQEGASCTMRCNFSISSTSVQWFRQNSGGCLTTLFYIPTGTKQVGRLSATTVTEERHSSLYISSSQTTVSAVYFCAVSHSAAP
Loxodonta africana V532 trdv AAGU03084637.1 134974 SIVAQKVTQVQPAVSRQERMAVTLNCLYETSRTYYYIFWYKQLPSGEITLLIHQDSSKPNSKDGRYSLDFQKKDKSISLTISTLQLEDSAKYFCALWE
Loxodonta africana V533 trdv AAGU03084643.1 25276 SIVAQKVTQVQPAISMQEGTAVTLNCLYETSETYYGIFWYKQLPSGGIIFLILQESSKPNSKEGRYSLDFQKEHKFISLTISSLQLEDSAKYFCALVN
Loxodonta africana V534 trav AAGU03084643.1 41975 VNSQVEQNPEALHIQEGENVTMNCSFKTTIDNLQWFRQDSGRGLVLQILILSDEKEKPNGRLRATLDTSTKSGFLFITASQAADTATYFCALD
Loxodonta africana V535 trav AAGU03084643.1 72946 VNSQVQQNPEALHIPEGENVTMNCSYKTDINNLQWYRQDSGRGLVLQILILSNEKEKPNGRLRATLDTSTKSSFLLITASQAADTATYFCALD
Loxodonta africana V536 trav AAGU03084644.1 7040 GTSGDSVTQTEGPVTLSEGAPMILNCTYQSSYTSLFLFWYVQYLNKAPQLLLKSSTETENQGFQANLVKIENSFHLQKRSLQISDSALYYCAMR
Loxodonta africana V537 trdv AAGU03084644.1 91705 SIVAQKVTQVQPAISMQEGLAVTLSCLYETSEADYFIFWYKQLPSGEIIFVIRQGSFMPSSKDGRYSLDFQKKDKSISLTISTLQLEDSAKYFCALWE
Loxodonta africana V538 trav AAGU03084644.1 116473 GVSSKVNVEQSPQSLNVQKGDSTNFTCSFPSSSFYALHWYSWERAKSPKILFVLLSSGDKSEGRLRATINTKEGFSYLYIKGSQLEDSATYLCAF
Loxodonta africana V539 trav AAGU03084644.1 122228 GNGQQVKQIPEFLLLQEGENFTTYCNSSSTLNNLHWYKQKPGASPVLLIKLVKAGEVKEKRLTAQFGTTRRDSSLHIRATQAADVGTYFCAMAQCCQ
Loxodonta africana V540 trav AAGU03084644.1 132566 ETRAQSVTQPDDQVSVADGAPLQLRCNYSSRAAPCLFWYVQYPNKGLQLVLKYITGETLVKGTEGFEAEFKKSETSFHLRKPSAHWSDSAEYFCAVS
Loxodonta africana V541 trav AAGU03084644.1 143028 ESSQQLEQSPRFLSIQEGENFTTYCNSSSVFTTFQWYRQKPGEGPVLVLMLTKGGNMKKKRLMAQLGEARKDSSLHIAAVQPEDTALYLCAGA
Loxodonta africana V542 trav AAGU03084645.1 30525 ENTQQLEQSPRFLSIQEGENFTTYCNSSSFSTTFQWYRQKPGEGPVLVLVLTKGGDMKKQKRLTAQLGEARKDSSLHIAVVQPEDTAFYLCAG
Loxodonta africana V543 trav AAGU03084654.1 1266 ENTQQLEQSPRFLSIQEGENFTTYCNSSSFSTTFQWYRQKPGEGPVLVLVLTKGGDMKKQKRLTAQLGEARKDSSLHIAVVQPEDTAFYLCAG
Loxodonta africana V544 trdv AAGU03084656.1 22316 CSMAEKVNQNQTTITMQEGEAVTLGCLYETRLSSYTLYWYKQPPNGEMVSLIQQEHSKTNAKQDRYSVNFQKANKSINLIISSLQLADTANYFCALW
Loxodonta africana V545 trav AAGU03084656.1 30325 IRSDAKTTQPSSVESTEGQPVNLPCNHSTISGNEYIYWYRQIPHRGPEYVISGLKDDVTNEMASLIIPTGRKSSTLILPHATLKDTAVYYCMVR
Loxodonta africana V546 trav AAGU03084656.1 44441 VCSQELEQSPQSLIIQEGEDFIINCSSSKTVYTLFWYKQTHGEGPIFFMMLQKGGQEKSHEKVTAKLDEKKQQSSLHVPASEPSHSGIYLCAAD
Loxodonta africana V547 trav AAGU03084656.1 59051 VSGQQLNQSPQPMTIQEGVNFTMNCNSSSTFSTIFWYKQDPGEGLVLLTTLYKGGELTRNGKLTAQFGGTRKDSFLHISASESDDAGTYFCAG
Loxodonta africana V548 trav AAGU03084656.1 74651 VSSDKVIQSPLSLVIQEGDSATLNCSYEVTNFRSLLWYKQKDKAPTLLFTLLSNEIKKSGRLSSTLNKKELLSILHVSTAQPGDSATYLCATE
Loxodonta africana V549 trav AAGU03084656.1 85086 FGSSQSITQSPPEIFGQEGEGVTLYCRYTTHNPNHVLAWFVRHPSRGIFYLISQSSAVSRNARKGRFSVNLQKATKTIILTISAVKPGDSGEYFCAIET
Loxodonta africana V550 trav AAGU03084656.1 109997 YSTAQTVTQSQQQMSVQETESVTLDCTYDTRASNYYLFWYKQPPSGELIFIIRQDDFKQQNVTENRFSVNFQKAAKSFSLRISDSQLDDAALYFCALSG
Loxodonta africana V551 trav AAGU03084658.1 6458 ISGKNEVEQSPPYLSAHEGELITINCSYSIGMTSLQWLQQNPGGGIVSLFLLSLEMKKKERLSATINTKERHSSLHIAASQPRDSATYLCAVE
Loxodonta africana V552 trdv AAGU03084659.1 1237 CSKAQSIHQSTSVMYKQEGESVTLDCHFTVSYSYYRLYWYQQSSSGEMAHIINLYSQNQNAREGRYSVVLQKADKAFKLTISALVRRDSAIYFCAVVDM
Loxodonta africana V553 trdv AAGU03084666.1 30019 VMSAIVLVPGDQVVTVSVGGSTTLRCTMEGGTISNYYTNWYRKTQGDILTFIYGEGSGYGSNFQDRFQAKTDNSNNQAVLKILKASMSDEGFYYCAID
Loxodonta africana V568 trav AAGU03086513.1 5956 SCWGENVEQHPSTLSVLEGSSSVINCSYSDSALSYFPWYKQEPGKGPQLIIDIHSNKDKYQKQRFTVPLVKKAKNLFLHITAARPGDSAVYLCTAS
Loxodonta africana V590 igkv AAGU03091448.1 4228 ASGDIVLTQSPASLAKTQGETVTIYCKASQSVSSYLNWYQQKPGQAPKLLIYDASSQASGVPDRFSGSGSGTDFTLTIKNFQVDDAAAYYCLLFNK
Loxodonta africana V591 igkv AAGU03091448.1 23563 ASGDVVLTQSPASLAKSQGETVTINCKASQSVSNYLAWYQQKPGQAPKLLIYKASSPASGVPDRFSGSGSGTDFTFTISNFQPEDAAVYYCLAGYNN
Loxodonta africana V592 igkv AAGU03091448.1 58490 ASGDIVVTQSPASLAKSQGETVTINCKASQSVSSYLSWYQQKPGQAPKLLIYGASSRASRVPDRFSGSGSGTDFTFTISNFQAEDAAVYYCQQYYYSA
Loxodonta africana V593 igkv AAGU03091448.1 69868 ANGNIVLTQSPAFLAKSQGETVTINCKASQSVSSYLAWYQQKPGQAPKRLISGASNRNSGVPDRFSGSGSGTDFTFTISNLQPEDAAVYYCQQGYNN
Loxodonta africana V594 igkv AAGU03091450.1 30769 ASGDTVLTQSPGSLAMSPGGTVTINCKSSHSLFYSSNKKDHLAWYQQKPGQAPKLLIYEASNRASGVPDRFSGSGSGTDFTFTISNFQAEDAAVYYCFQNYY
Loxodonta africana V595 igkv AAGU03091453.1 6648 ASGDIVVTQSPASLAKSQGETVTINCKASQSVSKNLAWYQQKPGQAPKLLIYGASSRASGVPDRFSGSGSGTDFTFTISNFQAEDAAVYYCQLYYSA
Loxodonta africana V596 igkv AAGU03091456.1 4022 ASGDIVLTQSPASLAKSQGEMVTINCKTSQSVSSYFNWYQQKPGQAPKLLIYYASKRGSGIPDRFSGSGSGTDFTLTINNFQADDAAVYYCQQDNN
Loxodonta africana V597 igkv AAGU03091456.1 42745 ASGDIVLTQSPASLAKSQGETVTINCKASQSVSSYLAWYQQKPGQAPKLLIYDASSRASGVPDRFSGSGSGTDFTLTISNFQADDAAVYYCQQGNN
Loxodonta africana V598 igkv AAGU03091456.1 57812 ASGDTVLTQSPASLAKSQGETVTINCKASQSVSSNYLSWYQQKPGQAPKLLMYRASSRASGVPDRFSGSGSGTDFTFTISNFQAEDAAVYYCQQGYNNPA
Loxodonta africana V599 igkv AAGU03091460.1 32924 ANGDTVLTQSPASLAMSPGGTVTINCKSSQSLFYSSNKKHYLAWYQQKPGQAPKMLIYEASNRASGVPDRFSGSGSGTDFTLTISNFQAEDAAVYYCFQSYY
Loxodonta africana V600 igkv AAGU03091464.1 1562 ASGDIVMTQSPASLAKSQGETVTINCKASQSVSKNLSWYQQKPGQAPKLLIYAASSRASGVPDRFSGSGSGTDFTFTISNFQPEDAAVYYCFAGYYYQA
Loxodonta africana V601 igkv AAGU03091465.1 6501 ASGDIVLTQSPASLAKSQGETVTINCKASQSVSSYLNWYQPKLGQTPKRLIYSATNRASGVPDRFSGSGSGTDFTLTITNFQAEDAAVYYCLQGYNN
Loxodonta africana V606 trav AAGU03092183.1 22954 GTNGDSVTQTEGPVTLSEGAPMILNCTYQSSYTTSPVLFWYVQYLNNAPQLLLKSSTETEDQGFQANLVKSENSFHLQKRSLQISDSALYYCAMR
Loxodonta africana V607 trav AAGU03092184.1 13448 SSGEDQVEQSPQALILQEGDDSSLNCSYSVNNFKGLQWYKQDPAEGPEFLFLLSSVGDKKQKERLRCTLSKQESSLHMTASKPEDSATYFCAV
Loxodonta africana V608 trdv AAGU03092186.1 24466 SIVAQKVTQVQPAISMQEGLAVTLNCLYETSEADYFIFWYKQLPSGGIIFLILQDSSEPNSKEGRYSLDFQKEHKFISLTISTLQLEDSAKYFCALWE
Loxodonta africana V609 trav AAGU03092188.1 13105 VNSQVEQDPEALHIQEGENVTMNCSYKTTIDNLQWYRQDSGRGLVLQILIRSNEKEKPNGRLRATLDTSTKSGFLFITASQAADTATYFCALD
Loxodonta africana V610 trav AAGU03092188.1 35057 VNSQVEQNPESLHIQEGENVTMTCSYKTAIDNLQWYRQDSGRGLVLQILIRSNEKEKPNGRLRATLDTSTKSSFLFITASQAADTATYFCALD
Loxodonta africana V611 trav AAGU03092189.1 7090 GTSGDSVTQTEGPVTLSEGAHMILNCTYQSSYTPSLFWYVQYLNKAPQLLLKSSTETENQGFQANLVKRENSFHLQKRSLQISDSALYYCAMT
Loxodonta africana V612 trav AAGU03092199.1 2627 GIGAQVVTQPDIHVTVSEGAPLMLRCNYSSSVPLTLFWYIQYAKEDLQVLLKYTSGNMLVSGIKGFETEFRRMENSFHLRKPSAHWRDSAQYFCALR
Loxodonta africana V613 trdv AAGU03092201.1 5359 SIVAQKVTQVQPAISRQERMAVTLNCLYETSEADYYIFWYKQLPSGEIIFVIHQGSSMPSSKDGRYSLDFQKKDKSISLTISALELEDSAKYFCALVN
Loxodonta africana V618 ighv AAGU03092878.1 11520 VHSEVQLVQSGAEVRKPGASVKVSCKASGYTFTSKYMYWVRQASGKGLEWIARHDPEDGKTIYSQKFQGRVTITSDTSTNTAYMELNSLSSEDTAVYYCA
Loxodonta africana V620 ighv AAGU03093124.1 31353 VLSQVQLKESGPGLVKPSQTLSLTCTVTGGSISSGYAWSWIRQPPGKGLEWLGVGYYSRSSWDTSYGSSIKCRISITADSSKNQFSLQLSSVTSEDTAVYYCAR
Loxodonta africana V625 ighv AAGU03093895.1 19535 VHSEIQLEQSGAEVKKPGASVKISCKVSGGDFISEYMQWVRQASGKGLEWIGGYGATEGEAKYSQKFQGRATITSDKSTSTAYLELSSLSSEDTAVYYCA
Loxodonta africana V626 ighv AAGU03093968.1 14191 VLSQVTLKESGPGLIKPSQTLSLTCTVPGFSLSTSGAVVSWIRQPPGKALEWLALIYWDDDKRYSSSLKSRLTISKDNSKKQVYLTMTNTDPVDTATYYCARG
Loxodonta africana V627 igkv AAGU03094033.1 7013 ASGDIVMTQSPASLAKSQGETVTINCKASQSVSSYLSWYQQKPGQAPKLLIYDASSRASGVPDRFSGRGSGTDFTFTISNFQAEDAALYYCQQGYSN
Loxodonta africana V628 igkv AAGU03094033.1 22734 ASGDIVLTQSPASLAKSQGETVTINCKASQSVSSYLAWYQQKPGQAPKLLIYRASSRESGVPDRFSGSGSGTDFTLTINNFQADDAAAYYCQQYNK
Loxodonta africana V629 trbv AAGU03094217.1 8402 PMGAMVTQSPKYHVTRVGKSVNLSCSQNLKHNIMFWYQQKHSQAPKLLFYYYNKDFNNETDTSDNFQPSRPNTSFCGLGIRSPGLGDSAVYLCASSR
Loxodonta africana V631 trav AAGU03094287.1 2720 GVSSQVNVEQSPQSLNVQKGDSTNFTCSFPSSSFYALHWYSWERAKSPKILFVLLSSGDKSEGRLRATINTKEGFSYLYIKGSQLEDSATYLCAF
Loxodonta africana V632 trav AAGU03094287.1 8498 GNGQQVKQIPEFLLLQEGENFTTYCNSSSTLNNLQWYKQKPGASPVLLIKLVKPGEVKEKRLTAQYGTTRRDSSLHIRATQAADVGTYFCVMAQCCQ
Loxodonta africana V633 ighv AAGU03094291.1 13354 ILSQVQLKESGPGVVKTSQTLSLTCAVSGFSLTSSYMSWVCQAPGKGLEWVGVITDGGSTYYNPTLKSRLSITTDTSKSQVYLQLTSVNPEDMAMYYCAG
Loxodonta africana V634 ighv AAGU03094410.1 6138 VLSQVQLKESGPGVVKPSQTLSLTCSVSGLSITTSNYYWNWIRQSTEKPLQWIGYITYSGSTGYNPSFKSRSSISRDTSKNEFSLQLTSVTADDTAVYYCAR
Loxodonta africana V635 trbv AAGU03094591.1 9454 HMDAAVTQTPRNQITRTGDNGTLQCAQDMNHYSMYWYREDPGLGLRLIHYSTDVDDTNKGDIPDGYSVSRSNKEHFPLTVKSAVPSQTAVYFCARSA
Loxodonta africana V636 ighv AAGU03094697.1 4725 VHSEVQLVQSGAEVKKPGASVKISCKFSGDDFSSYYMQWVRQASGKGLEWIGAYDPEDGETEYSQKFQGRATITGDTSTNTVYLELNSLSSEDTAVYYCAI
Loxodonta africana V637 ighv AAGU03094740.1 6644 ILSQVQLKESGPGVVKPSQTLSLTCAVSGFSFSSYVVSWVCQSPGKGLEWVGAIAGSGSTSFNPTLKSRLSITKDTSKSQVYLKLTSVNPEDTAMYYCAG
Loxodonta africana V638 trav AAGU03094823.1 5847 ENTQQLEQSPRFLSIQEGEIFTTYCNSSSVFTTFQWYRQKPGEGPVLVLVLTKGGDMKKQKRLTAQLGEARKDSSLHIAVVQPEDTAFYLCAG
Loxodonta africana V640 igkv AAGU03094867.1 3947 ASGDIVLTQSPASLAKSQGETVTINCKASQSVSNDLDWYQQKPGQAPKLLIYKASSRASGVPDRFSGSGSGTDFTFTISNFQPEDAAVYYCMQDYNN
Loxodonta africana V641 ighv AAGU03095162.1 3243 ILSQVQLKESGPGVVKPSQTLSLTCALSGFSFSSYAMSWVHQASGKGLEWVGVIDSGGSTYYNPTLKSRLSITKDTSKSQVYLKLTSVNPEDTAIYYCAG
Loxodonta africana V647 igkv AAGU03095780.1 751 ASGDIVLTQSPASLAKSQGETVTINCKASQSVSSYLAWYQQKPGQAPKLLIYAASSRASGVPDRFSGSGSGTDFTFTISNFQAEDAAVYYCQQPYNP
Loxodonta africana V729 ighv AAGU03018583.1 686 VLSHVWLQESGPGLVKPSQTLSITCSVSGFSLTSYDMTWFRQPPGKGLEWVGAIWTGGGTGYNSTVASRVSITRDTSKSQVYFQLSSVTPEDTALYYCAR
Loxodonta africana V983 igkv AAGU03067048.1 98364 ASGDIIMTQSPASLTASPEGTVTINCKASQSLFYSSDNKDYLNWYQQKPGQAPKLLIYFASNRDSGVPDRFSGSGSGTDFTLTISNFQAEDAAVYYCMQNYDD
Loxodonta africana V984 igkv AAGU03067048.1 63909 TSGDIIMTQSPASLAASPGGMVTINCKASQSLFDSSDKKDYLNWYQQKPGQAPKLLIYLASKRDSGVPDRFSGSGSGTDFTLTISNFQAEDAAVYYCMQNYDD
Loxodonta africana V985 igkv AAGU03067048.1 20440 ASGDIILTQSPASLAASQGGTVTINCKASQSLYSSSNKKDLLAWHQQKPGQAPKQLIYYASTRASGVPDRFSGSGSGTDFTLTISNFQAEDAAVYYCQQGYNT
Loxodonta africana V986 igkv AAGU03067048.1 4281 ASGDIIMTQSPASLAASPGGTVTINCKASQSLYSSTYKKDLLAWHQQKPGQAPKLLIYDASSRASGVPDRFSGSGSGTDFTLTISNFQAEDAAVYYCQQSQELP
Loxodonta africana V987 igkv AAGU03067053.1 4883 TSGDIIMTQSPASLAASPGGTVTINCKASQSLFDSSNNKDYLNWYQQKPGQAPKLLIYLASNRDSGVPDRFSGSGSGTDFTLTISNFQAEDAAVYYCQQGYNT
Loxodonta africana V988 igkv AAGU03067056.1 4989 ASGDILMTQSPVSLAAAPGEMVTFNHKCSQSVKSSLAWYQPKPGQAPKLLVYSASTQASEAPICFSGSGHGTGFTVTINSLQSQNVANYYCQQNYDIL
Loxodonta africana V989 igkv AAGU03067057.1 20667 ASGDIIMTQSPASLAASQGGTVTINCKASQSLFDSSNKKDLLAWHQQKPGQAPKRLIYYASTRASGVPDRFSGSGSGTDFTLTISNFQAEDAAVYYCQQSNKLP
Loxodonta africana V990 igkv AAGU03067057.1 4581 ASGDIIMTQSPASLAASPGGTVTINCKASQSLYSSTYKKDLLAWNQQKPGQAPKLLIYDASSRASGVPDRFSGSGSGTDFTLTISNFQAEDAAVYYCQQSQELP
Loxodonta africana V991 igkv AAGU03067061.1 4773 ASGDLIMTQSPASLAVSPGGTVTINCKASQSLFDSSYEEDLLAWYQQKPGQAPKLLIYLASNRGSGVPDRFSGSGSGTDFTLTISNFQAEDAAVYYCQQSNKLP
Loxodonta africana V992 igkv AAGU03067065.1 27311 ASGDIVMTQPPATLAVSPGERVTINCKASRSVSNYVAWYQQKPGQAPKPLIYKASNLASRVPDRFSGSGSGTDFTPTISNFQADDAAVYYCLQHYN
Loxodonta africana V993 igkv AAGU03067066.1 8984 ASGDIIMTQSPASLAAPPGGTVTINCKASQSLFYSSSNKDYLNWYQQKPGQAPKRLIYWASSRDSGVPDWFSGSGSGTDFTLTISNFQAEDTAVYYCQQGYKS
Loxodonta africana V994 igkv AAGU03067069.1 4426 ASGDVIMTQSPASLAASPGGTVTINCKSSQSLFGSSYKKDYLAWYQQKPGQAPKVLIYWASSRASGVPDRFSGSGSGTDFTLTISNFQAEDAAVYYCQQGYNDP
Loxodonta africana V995 igkv AAGU03067074.1 34506 ASGDIIMTQSPASLAASPGETVTINCKANQNLLYSSNKKDYLDWYQQKPGQAPKLLIYRASSRASGVPDRFSGSGSGTDFTLTISNFQAEDPAVYYCLEIYNT
Loxodonta africana V996 igkv AAGU03067074.1 1965 ASGDITMTQSTAFLAASPGVTVTINCKASQSVFSSSDKKDYLAWYQQKPGQAPKRLIYYASTRASGVPDRFSGSGSGTDFTLTISNFQAEDTAVYYCQQGYNT
Loxodonta africana V997 igkv AAGU03067077.1 60387 ASGDTVLTQFPASLVKSQGETLTINCKASQSVSSYLHWCQQKPGQDPKLLIYYASKWTSGVPDRFSGSGSGTDFTLTVNNFQAEDAAVYYCQQSYNN
Loxodonta africana V998 igkv AAGU03067077.1 641 ASGDIVLTQSPASLAASPGGTVTINCKASQSLFYSSNKKDYLDWYQQKPGQAPKLLIYWASSRASGVPDRFSGSGSGTDFTLTISNFQAEDAAVYYCLQGYKS
Loxodonta africana V999 igkv AAGU03067081.1 125247 SSGDIVMTQTPLSLPVTLGEPATIFCKSSESLVDSDGNTYLNWFQQKPGQPPRLLIYLVSNRLSGFSDRFVGSGSGTDFTLKISRVQAEDVAVYYCMQATKDP
Loxodonta africana V1000 igkv AAGU03067081.1 109136 ANGDTVLTQTPALLSVSLRESASIICRANQSISDYLSWYQKKPGQPPKLLIYDADDRYSGIPARFTGIQSGTEFILTISNVEADDAADYYCLQVYKS
Loxodonta africana V1001 igkv AAGU03067081.1 45162 SSGDIVMTQTLLSLPVTLGEPATISCKSSESLVDRDGDTYLSWYQQKPGQPPRPLIYKVSNRLSGVPDRFVGSGSGTDFTLKISRVEADDVAVYYCMQSTKVL
Loxodonta africana V1002 igkv AAGU03067081.1 4255 SSGDVVMTQTPLSLPITLGEPATISCKSSKSLVHSDGNTYLSWYQQKPGQPPQLLIYKVSNRLSGVPERFVGSGSGTDFTLKISRVEADDVAVYYCMQSTKFP
Loxodonta africana V1003 igkv AAGU03067082.1 30603 TRAEILLTQSPAFLSVTLGDNVAITCKASQDIDEDLQWYQQKPGEAPKLIIKGVSTLISGVPPRFSGSGYGIDFTLRINNIKSEDVTYYFCQQDDNFA
Loxodonta africana V1004 igkv AAGU03067083.1 106947 SSGDIVMIQAPLSLPVTLGEPATISCKSSQSLVHSNENTYLYWYQQKPGQPPQLLIYEVSNWYSGVPDRFSGSGSGTDFTLKISRVEADDVAVYYCQQN
Loxodonta africana V1005 igkv AAGU03067083.1 100617 SSGDIVMTQTPLSLPITLGEPATISCKSSESLVDSDGYTYLYWYQQKPGHPPRLLIYEVSNRYSGVPDRFSGSGSGTDFTLKISKVEAEDVAVYYCMQATKD
Loxodonta africana V1006 igkv AAGU03067083.1 60979 SSGDIVMTQTPLSLPVTLGEPATISCKSSESLVDSDGDTYLSWYQQKPGQPPRLLIYEVSNRLSGVPDRFVGSGSGTDFTLKISRVEADDVAVYYCMQDTKVP
Loxodonta africana V1076 trbv AAGU03080267.1 5658 SMFGVLVSQKPSRDICQNGTSVTIQCQVDGQVADMFWYHQPPQQGLTLIATASQGSEAMYENGFTKDRFPISCPSLTFSILTVSKCSPKDSGVYLCSAG
Loxodonta africana V1077 trbv AAGU03080268.1 57612 STDTEVTQTPAQLVRPREQKAKMDCVPINRHNTVLWYRKKLGEELKFLISFQNQEVVDKSGMPDERFSAQCPRSSLCNIEIRSTEPGDSGVYFCASSA
Loxodonta africana V1078 trbv AAGU03080268.1 31926 SMGTGITQTPRNRITQTGRSIIPECSQTKGYTAMYWYRQDPGRGLQLIYYCLDVNNINKGEVSEGYSVSQKEQAKFSLSLGTTTPNRTALYLCAIGY
Loxodonta africana V1079 trbv AAGU03080268.1 28328 PMRADVSQTPRHYVTGMGKKITLECSQTTDYDYMYWYRQDPGRELQLIHYSYSVNSTEKAEHSSRWTVSRRTKKHFPLTLESASPAESSRYLCASSL
Loxodonta africana V1080 trbv AAGU03080268.1 22137 VKDAVITQSPRQQILERGKELTLECSQDMNHFAMYWYRQDPGHGLRLIFYSSGTGSITDGDVSGGYHVSRDEIQNFPLTLRLASPNQTAVYLCASSE
Loxodonta africana V1081 trbv AAGU03080268.1 19145 PAEPGVTQTPRYRIANRGEKLTLDCAQDLDNEVMYWYRQDPGQGLQLLHYSVNVNIMEKGDLPDGYQVSREKKGRFPLTLESAVPNQTALYLCASSF
Loxodonta africana V1082 trbv AAGU03080268.1 11969 SVFGVLVSQNPSRDICQNGTSVTIQCQVNSQVTYMFWYRQSPGQGLTLIATANQGSEAKYENGFAEDRFPINYPNLIFSTLTVSNSSPEDSGVYLCSTG
Loxodonta africana V1085 trbv AAGU03080269.1 78464 PMGAMVTQSPKYHVTRVGKSVNLSCSQNLKHNIMFWYQQKHSQAPKLLFYYYNKDFNNETDTSDNFQPIRPNTSFCGLGIRSPGLGDSAVYLCASSR
Loxodonta africana V1086 trbv AAGU03080269.1 69248 PTLCALVSQHPSLAICKNGTSVKIECRVTGIQTTTMLWYLQLPEQDFTLIATSNQGSGIAYEEGFTKDTFRINHPDLTFSTLTVTSAQAQDSGLYFCGAS
Loxodonta africana V1087 trbv AAGU03080269.1 65555 PMGAMVIQSPKYHVTRAGKLVNLSCSQNLNHNAMYWYQQKHSQAPKLLFYYFNTEFNNETDTSDNFQPSRPNTSFCGLGIRSPGMGDSAVYLCASSR
Loxodonta africana V1088 trbv AAGU03080269.1 63526 SLDAEVTQMLRYLLKRKGQKVNMDCVLTIRHSCVYWYQQIPTKEFKFLISFQNKYVLSGNEMPKERFSAECHQDSACSLEIQLVALQDSAMYHCASRL
Loxodonta africana V1089 trbv AAGU03080269.1 59564 ITDSGISQTPKYLVQEEGRDVSLDCEQSFGDDAMYWYRQDPGQGLKLVYCSPVTNDVQEGDAAAGYSASREKKERFPLAVTRAQRNQTALYLCASSK
Loxodonta africana V1090 trbv AAGU03080269.1 40554 HTDAGVTQTPRHKITRTGGKVTLQCFQDLNHNYMLWYRQDPGLGLRLIYSSAGAGVTDKGDIPDGYNVSRPKTEHFLLTLGSAAPSQTAVYFCASSL
Loxodonta africana V1091 trbv AAGU03080269.1 12841 PMGATVTQSPKHHIARVGKSVNLSCSQNLNHDVMYWYQQKESQAPKLLFYYYDTEFNNGTDTSDNFQPSRPNTSFCGLGIRSPVVGDSATYLCASSR
Loxodonta africana V1092 trbv AAGU03080270.1 1712 ITDCGISQTPKYLVREEGRDVSLDCEQSFGDDAMYWYQQDPGQGLKLVYCSPVTNDVQEGDAAAGYSASREKKERFPLAVTRAQRNQTALYLCASSK
Loxodonta africana V1093 trbv AAGU03080271.1 11613 SFDTKVTQMPRYLLKGKGQKVKMDCVLTKRHSYVYWYQQIPTKELKFLISFQNKYVLSGNEMPKERFSDKCPQDSACILEIQLVALQDSAMYLCAS
Loxodonta africana V1094 trbv AAGU03080271.1 7807 PTLCALISQHPSLAICKNGTSVKIECRVTGIQATTMLWYLQLPEQDFTLITTSNQGSGIAYEEGFTKDTFRINHPDLTFSTLTVTSAQAQDSGLYFCGAS
Loxodonta africana V1095 trbv AAGU03080271.1 4113 PMGAMVIQSPKYHVTRAGKLVNLSCSQNLNHNAMYWYQQKHSQAPKLLFYYFNTEFNNETDTSDNFQPSRPNTSFCGLGIRSPGMGDSAVYLCASSR
Loxodonta africana V1096 trbv AAGU03080271.1 2080 SLDAEVTQRPRYLLKRKGQKVNMDCVLTIRHSCVYWYQQIPTKEFKFLISFQNKYVLSGNEMPKERFSAECHQDSACSLEIQLVALQDSAMYHCASRL
Loxodonta africana V1097 trbv AAGU03080273.1 2886 PMGAMVTQSPKYHVTRVGKSVNLSCSQNLKHNAMYWYQRKHSQAPKLLFYYYDKDFNNETDTSDNFQPSRPNTSFCGLGIRSPGLGDSAVYLCASSK
Loxodonta africana V1100 trbv AAGU03080275.1 8579 PMGAMVIQCPKYHFTRVGKSVSLSCSQNLNRDAMYWYQQKHSQAPKLLFYYFDTELNNETDTSDNFQPSRPNSSFCGLGIHSPGVGDSAVYLCASSR
Loxodonta africana V1101 trbv AAGU03080276.1 12377 HMDAGITQTPRHKITRTGENVTLQCTQYMSHLYMYWYRQDPGLGLRLIHYSTSVDDTKKGDIPDGYSVSRSSTEHFPLTLGSAAPSQTAVYFCASSY
Loxodonta africana V1102 trbv AAGU03080276.1 7041 HTDAGVTQTPRHKITRTGGKVTLQCFQDLNHDYMLWYRQDPGLGLRLIHFSVGAGVTDKGDIPDGYNVSRPKTEHFLLTLGSAAPSQTAVYFCASSL
Loxodonta africana V1103 trbv AAGU03080278.1 4041 HTDAGVTQTPRHKITRTGGNVTLQCTQDRNDLYMYWYRQDPGLGLRLIHYSNGVPDTNEGDVPEGYSVTRSDTEHFPLMVGSAAPSQTAVYFCASNV
Loxodonta africana V1104 trbv AAGU03080283.1 6426 HMDAGVTQSPRHQITMAGGNMTLQCSQDMNHPYMYWYRQDPGLGLRLIHYSTIDGGTYEGDVPKGYSVSRSNTEHFLLTLGSATPSQTAVYFCASSV
Loxodonta africana V1106 trbv AAGU03080288.1 13692 HTNAGVTQNPRHKITRTGENMTLQCTQNMDHEYMYWYRQDPGLGLRLIHYSVRVGDTENGDIPEGYSVSRSKKEHFHLTLGSAAPSQTAVYFCASSY
Loxodonta africana V1107 trbv AAGU03080288.1 1235 HMDAAIIQTPRHQITRTGGNVTLQCAQDMNHYSMYWYRQDPGLGLRLIHYSTNVDDTKKGDIPDGYNVSRSKKEHFPLTVKLAIPSQTAVYFCASSA
Loxodonta africana V1108 trbv AAGU03080289.1 15691 HTNAGITQNPRHKITRTGGNVTLQCTQNMDLNAMYWYRQDPGLGLRLIHYSVGVGEAENGDIPEGYSVSRSKKEHFPLTLGSAAPSQTAVYFCASSY
Loxodonta africana V1109 trbv AAGU03080289.1 3211 YTDAGIRQTPRHKITKTGGNMTLQCTQYMNQNSMYWYRQDPGLGLRLIHYSNSVPDTYKGDIPDGYSVSRSNKEHFPLTLGSAAPSQTAVYFCASSY
Loxodonta africana V1110 trbv AAGU03080292.1 37068 HTNAGVTQNPRHKITRTGGNVTLQCTQNMNHEYMYWYRQDPGLGLRLIHYSVRVGDTENGDIPEGYSVSRSKKEHFHLTLGSAAPSQTAVYFCASSY
Loxodonta africana V1111 trbv AAGU03080292.1 10142 QTGAGVSQAPKHRVTKKGQAVALRCDPISGHVGLFWYRQTLGQGLVLLTYFQNKDEADKSGMADDRFSAERPEGSSSTLRIQPVEPGDSAVYLCASSLETAWH
Loxodonta africana V1112 trbv AAGU03080293.1 2998 HTNAGVTQNPRHKITRTGGNLTLQCTQNMDHNAMYWYRQDPGLGLRLIHYSVRVSDTENGDIPEGYSVSRSKKEYFHLTLGSATPSQTAVYFCASSY
Loxodonta africana V1113 trbv AAGU03080294.1 2549 SVSSGQTGPGVSQAPKHRVTKKGQAVALRCDPISGHVGLFWYRQTLGQGLVLLTYFQNEKEADKSGMADDRFSAERPEGSSSTLRIQPVEPGDSAVYLCASSL
Loxodonta africana V1114 trbv AAGU03080295.1 539 HTNAGVTQNPRHKITRTGENMTLQCTQNMDHEYMYWYRQDPGLGLRLIHYSLGVGEAENGDIPEGYSVSRSKKEHFHLTLGSAAPSQTAVYFCASSY
Loxodonta africana V1115 trbv AAGU03080298.1 430 HTDAGIRQTPRHKITRTGGNVTLQCTQDMNHNSMYWYRQDPGLGLRLIHYSNGVPDTYKGDVPEGYSVSRSNTKDFPLMVGSAAPSQTSVYFCASSV
Loxodonta africana V1116 trbv AAGU03080300.1 15697 HTNAGVTQNPRHKITRTGENMTLQCTQNMDHNAMYWYRQDLGLGLRLIHYSVGVGDAGNGDIPEVYSVSRSKKGHFHLTLRSATSSQTAVYFCSTSSY
Loxodonta africana V1117 trbv AAGU03080300.1 3410 HMDAAVTQTPRHQITRTGGNVTLQCAQDMNHYSMYWYRQDPGLGLRLIHYSTDVDDINKGDIPDGYNVSRSNKEHFPLTVKSAIPSQTAVYFCASSA
Loxodonta africana V1118 trbv AAGU03080304.1 1455 HTDAGITQTPRHKITRTGGNLTLQCTQDMNHNFMYWYRQDPGLGLRLIHYSNGVPDTYKGDVPEGYNVSRSNTKDFPLMVGSAAPSQTSVYFCASSV
Loxodonta africana V1119 trbv AAGU03080305.1 2330 HTDAGITQSPRHQITRTGGNVTLQCSQDMNHRYMYWYRQDPGLGLRLIHYSTNDGGTYEGDVPNGYSVSRPNAEHFRLTLGSATPPQTAVYFCASSY
Loxodonta africana V1120 trbv AAGU03080306.1 21946 SADTGITQRPKYLVIGMGNKKSLMCEQSLKHNSMYWYKQVSDKPPELMFRYDYQKLATNETVPGRFSPECPDSSHLYLHMDALELGDSAMYLCASSK
Loxodonta africana V1121 trbv AAGU03080306.1 20334 HSESGVSQTPGHQVTAMEEEVTLRCDPVSGHFTLYWYRQTPGKKMEFLVSFYKEDLSEKSEMFKGWFSAERPNGSFSTLRIQHVEPGDSAVYLCASSK
Loxodonta africana V1122 trbv AAGU03080306.1 7421 HMDAGITQTPRHKITRTGGNMSLQCTQDMNHNSMYWYRQDPGLGLRLIHYSNGVLDIKKGDIPDGYNVTRSKKEHFPLMLGSAAPSQTAVYFCASSY
Loxodonta africana V1124 igkv AAGU03081111.1 44946 ASGDIVLTQSPASLAKSQGETVTINCKASQSVSSFLNWYQQKPGQAPKLLIYYASNRVSGVPDRFSGSGSGTDFTLTINNFQADDAAAYYCQQFNK
Loxodonta africana V1146 trdv AAGU03084667.1 56106 EGMLCNKVIQSATEQTVRLDSEATLLCTYETEHSNSHLYWYRMRPDHPFQFVLYRDNTRSKDADFTQGRFSVKHSQTQRTFHLVISSVRAGDSATYYCAC
Loxodonta africana V1156 trdv AAGU03086504.1 4268 SIVTQKVTQVQPAISMHEGLAITLNCLYETSEAVYYIFWYKQLPSGEIIFVIRQGSSMPSSKDGRYSLDFQKKDKSISLTISALELEDSAKYFCALVN
Loxodonta africana V1157 trav AAGU03086508.1 154643 GTSGDSVTQTEDQITLSEGAFLTVNCTYTATGYPSLFWYIQRPGEGLQLLLKAAKDNNKGTKEGFEATYNQKTSSFHLGKASVRQSDSAVYYCALS
Loxodonta africana V1158 trav AAGU03086508.1 141688 VNGNNQVEQSPWSLIILEGENCTFQCNSSVSPFNNLRWYKEDAGRGPVSLIIMTYSESQKSNGRYTATLDANAKRSFLHLTGSQLSDSASYICAVS
Loxodonta africana V1159 trav AAGU03086508.1 108525 APSQQKGVEQPGSLSIPEGAIASLNCTYEDRNSQYFMWYRQYYGKGPEFLISVYSKDENKQGRFTTQLNKGSQYVFLLIADSQPSDSATYLCAV
Loxodonta africana V1160 trav AAGU03086508.1 92578 GTRTQTVTQPKDHIFVFEGTPVQMKCNYSYSGSPVLSWYVQYPKKGLKLLLRHITGNSIKGFTTDLDKGKMTFHLKKQSAQEEDSAMYYCALD
Loxodonta africana V1161 trav AAGU03086508.1 82074 VNSQVEQNPEALHIQEGENVAMNCSYKANIDTLQWYRQDSGRGLVLQILIRSYEKEKPNGRLKATLDTSTKSSFLFITASQAADTATYFCALD
Loxodonta africana V1162 trav AAGU03086508.1 69449 VNSQVEQNPEDLHIQEGENVTMNCSYKTDINNLQWYRQDSGRGLVLQILIRSFEKEKPNGRLRATLDTSTKSSFLFITASQAADTATYFCALD
Loxodonta africana V1163 trav AAGU03086508.1 62056 GTNGDSVTQAEGSVTLPKGAPLTLNCTYQTSYSAFLFWYVLYLNKAPEFLLKCSSESWKADHRGFQANHVKSDSSFHLNNPSVQISYSAVYYCVLS
Loxodonta africana V1164 trav AAGU03086508.1 58365 STMAQEVTQDQPATSVVEKKAVTLDCVYKAQDINYALFWYKQPPSGEMIFLVRQEPYNKQNATEGRYSLNFQKEAKFISLTITGSQLRDSAVYFCALKD
Loxodonta africana V1165 trav AAGU03086508.1 47913 GTNGDSVTQTEGPVTLSEGAPMILNCTYQSSYAPSLFWYVQYLNKAPQLLLKSSTETENEGFQANLVKSENSFHLQKRSVQISDSALYYCAMT
Loxodonta africana V1166 trav AAGU03086508.1 25785 SSGEDQVEQSPRALILQEGDDSSLNCSYSATYFRSLQWYKQDPGEGPEFLFLLYSVGEKKQKERLRGTLSKQESSLHITASKPEDSATYFCAV
Loxodonta africana V1167 trav AAGU03086509.1 2366 GNNGDTVTQTEGQVTLSEGDFLTVNCSYTAKEYPTLLWYVQYPNEGLQLLLKAAKDNDKGSYKGFEATYSRETSSFHLEKASVQESDSAVYYCALN
Loxodonta africana V1168 trav AAGU03086511.1 12413 GNNGDTVTQTEGQVTLSEGSLVAVNCSYTTTRYPALFWYVQYPDEGLQLLLKATRANEKGSNKGFEATYNKEASSFHLEKASVQESDSAVYYCALS
Loxodonta africana V1169 trav AAGU03086511.1 5639 EARAQSVTQPDGPVSVSEGASLELRCNYSYGATPNLFWYAQYPSQGLQLLLKYISGNPLVKGIKGFEAEFRKSESSFNLRKHSAHWDDSAEYFCVVS
Loxodonta africana V1170 trav AAGU03086513.1 2440 FSTAQKVTQARQAMMVQEEEAVTLYCTYDTSGRSFSLFWYKQPSSGEMILLIRQDSYNQENATEGRYSLNFQTATKSIDLIISASQLGDSAVYFCALRE
Loxodonta africana V1171 trav AAGU03086515.1 3095 EARAQSVTQPDGPVSVSEGASLELRCNYSYGATPYLFWYAQYPSQGLQLLLKYISGNHLVKGIKGFEAEFRKSENSFNLRKSSVRWNDSADYFCVLS
Loxodonta africana V1172 trav AAGU03086516.1 62831 MGRGEKVEQSPSFLSVQEGESSAFNCTYTDSTSTYFFWYKQEPGKGLQFLKSILSSDGKKQEQRLTLLVNTKEKYFSLHFEDTHPGDSATYLCAVR
Loxodonta africana V1173 trav AAGU03086516.1 35751 MGRGEKVEQSPSFLSVQEGESSAFNCTYTDSTSNYFLWYKEEPGKGLQFLKSIFSSEGKKQEQRLTLLVNTKEKYFSLHIEDTHPGDSATYFCAVR
Loxodonta africana V1174 trav AAGU03086516.1 22506 GTNGDPVTQTEGPVTLSEGASMILNCTYQSSSTTVSLFLFWYVQYLNKAPQLLLKSSTRRENQGFQANLVNSDSSFHLKKSSVQMSDMAMYYCALS
Loxodonta africana V1175 trav AAGU03086516.1 2501 AIRAQSVTQPNVPVTVSEGASLELRCNYSYSSGTPYLYWYVQYSNKGLQFLLKYITGDIQVKGLKGFEAEFRKSESSFNLRKHSAHLNDSAEYFCAVS
Loxodonta africana V1176 trav AAGU03086517.1 719 GNNGDAVTQTEGQVTLSEGDFLIVNCSYTSSQYPALFWYVQYADGGLQLLLKAATDNDKGSYKGFEATYNKKTSSFHLEKASVQESDSAVYYCALN
Loxodonta africana V1177 trav AAGU03086520.1 44681 MVTGEKVEQSPSFLSVQEGESSAFNCTYTDSGSTYFFWYKQEPGKGLQFLIRTLASEDKKQEERLTVLSNTKEKHFSLHIEDTHLGDSATYFCASR
Loxodonta africana V1178 trav AAGU03086520.1 20067 MVRGEKVEQSPSFLSVQEGESSAFNCTYTDSGSTYFFWYKQEPGKGLQFLIRILKNEDKKQEERLTVLLNTKEKHFSLHIADVHLGDSATYFCASR
Loxodonta africana V1179 trav AAGU03086529.1 872 TVGQDIQQPTELTAMEGESVQVNCKYQTSGFNGLFWYQQSDGGAPTFLFYNVLERLEGRGRYSSFLNRSSAYSYLHLTELQMKDSARYLCAVR
Loxodonta africana V1211 igkv AAGU03091886.1 20726 ASGDTVLTQSPASLAKSQGETVTINCKASQSVSSYLHWYQQKPGQAPKLLIYRASSRASGVPDRFSGSGSGTDFTFTISNFQPEDAAVYYCQQGYSYQA
Loxodonta africana V1212 igkv AAGU03091886.1 9888 ASGDIVLTQSPASLAKSQGETVTINCKASQSVSNYLAWYQQKLRQAPKQLISRASNRDPGVPDRFSGSGSGTDFTLTIINFQAEDATVYYCMQGYNN
Loxodonta africana V1213 igkv AAGU03091890.1 13353 ASGDIVLTQSPASLAKSQGETVTINCKASQSVSSYLNWYQQKPGQAPKLLIYYASDRASGVPDQFSGSGSGTDFTLTISNFQADDAAAYYCQQYNK
Loxodonta africana V1214 igkv AAGU03091891.1 1860 ASGDIVLTQSPASLAKSQGETVTINCKASQSVSSYLAWYQQKPGQAPKLLIYAASSRASGVPDRFSGSGSGTDFTLTINNFQADDAAAYYCQQFNK
Loxodonta africana V1215 igkv AAGU03091893.1 11257 ASGDIVLTQSPASLAKSQGETVTINCKASQSVSSYLSWYQQKPGQAPKLLIYYASDQASGVPDRFSGSGSGTDFTFTISNFQPEDAAVYYCLAGYYNQA
Loxodonta africana V1216 igkv AAGU03091898.1 55669 ASGDTVLTQSPTSLAKSQGETVTINCKASQSVSSYLYWYQQKPGQAPKLLIYAASSRASGVPDRFSGSGSGTDFTFTISNFQAEDAAVYYCQQGYNN
Loxodonta africana V1217 igkv AAGU03091898.1 37316 ASGDIVLTQSPASLAKSQVETVTINCKASQSVSSYLSWYQQKPGQAPKLLIYDASSRASGVPDRFSGSGSGTDFTLTISNFQADDATVYYCQQPYNP
Loxodonta africana V1218 igkv AAGU03091898.1 8564 ASGDIVVTQSPASLAKSQGETVTINCKASQSVSSYLSWYQQKPGQAPKLLIYWASSRASGVPDRFSGSGSGTDFTFTISNFQPEDAAVYYCIAGYYNEA
Loxodonta africana V1219 igkv AAGU03091899.1 36805 ASGDIVLTQSPASLAKSQGETVTINCKASQSVGSYYLSWYQQKPGQAPKLLIYDASSRASGVPDRFSGSGSGTAFTLTISNFQADDAAVYYCQQYNNEP
Loxodonta africana V1220 igkv AAGU03091899.1 12134 ANGNIVLTQSPAFLPKSQGEMVTINCKASQSVSSYLAWYQQKPGQAPKRLIYSASNRASGVPDRFSGSGSGTDFTFTISNFQAEEAPVYYCQQGYNN
Loxodonta africana V1223 igkv AAGU03092964.1 23281 ASGDIVLTQSPASVAKSQGETVTINCKASQSVSSYLAWYQQKPGQAPKQLIYAASSRASGVPDRFSGSGSGTDFTFTISNFQPEDAAVYYCFAAYSYEA
Loxodonta africana V1224 igkv AAGU03092964.1 10365 ASGDIVMTQSPASPAMSQGEMVTIDCKASQSVSNYLAWYQQKPGEGPKRLISGASNQDSGVPDWFSGSGSGTDFTLTISNFQAEDAALYYCLQGYNN
Loxodonta africana V1225 igkv AAGU03092968.1 53832 ASGDTVLTQSPASLAKSQGETVTINCKASQSVSNYLSWYQQKPGQAPKLLIYKASSRASGVPDRFSGSGSGTDFTFTISNFQPEDAAVYYCQQSYNN
Loxodonta africana V1226 igkv AAGU03092968.1 40995 ASGDTVLTQSPASLAKSQGETVTINCKASQSVSSYLHWYQQKPGQAPKLLIYKASSRASGVPDRFSGSGSGTDFTFTISNFQPEDAAVYYCQQDYSYQA
Loxodonta africana V1227 igkv AAGU03092968.1 11470 ASGDIVLAQSPTSLAKSQGETVTINCKASQSVSSYLYWLQQKPGQAPKLLIYGASNQASGVPDRFRGSGSGTDFTLTISNFQADDAAVYYCLQGNN
Loxodonta africana V1228 trav AAGU03093192.1 7992 GSNGDSVTQTEGPVTFSEGAPMILNCTYQSSYTSPVLFWYVQYLNNAPQLLLKSSTETENQGFQANLVKRENSFHLQKRSVQISDSALYYCAMT
Loxodonta africana V1229 trav AAGU03093193.1 33187 VNSQVEQNPEALHIQEGENVTMNCSFKTTIDNLQWFRQDSGRGLVLQILILSDEKEKPNGRLRATLDTSTKSGFLFITASQAADTATYFCALD
Loxodonta africana V1230 trav AAGU03093193.1 20832 VKSQVEQNPEALHIQEGENVTMNCSYKTTLGNLQWYRQDSGRRLILQILILSNEKEKSNGRLRVTVDTSTKISFLFIAVSQAADTATYFCALD
Loxodonta africana V1232 ighv AAGU03093851.1 511 VHCEVELVESRGDLTKPGGSLKLSCVASGFTFSNYDMNWIRQYPGKGLEWVAFIQYSGGKKYYLDSVKGWFTISRDNSKNTVYLQMDSLRREDTAMYYCAS
Loxodonta africana V1233 ighv AAGU03093853.1 21932 VLSQVQLKESGPGLVKPSQTLSLTCTVTGGSISSDYAWSWIRQPPGKGLEWLGVGYYSRSSWNTKYGSSVQGRISITADSSKKQFSLQLSSVTSEDTAVYYCAT
Loxodonta africana V1234 ighv AAGU03093853.1 9652 VLSHVWLQESGPGLVKPSQTLSITCSVSGFSLTSYDMTWFRQPPGKGLEWVGAIWTGGGTGYNPTVASRVSITRDTSKSQVYFQLSSVTPEDTAVYYCAR
Loxodonta africana V1235 igkv AAGU03093931.1 16845 ASGDIVLTQSPASLAKSQGETVTINCKASQSVSNYLAWYQQKPGQAPKLLIYKASSPASGVPDRFSGSGSGTDFTFTISNFQPEDAAVYYCQQSYNN
Loxodonta africana V1236 igkv AAGU03093931.1 4014 ASGDTVLTQSPASLAKSQGETVTINCKASQSVSSYLNWLQQKPGQAPKLLIYAASSRASGVPDRFSGSGSGTDFTFTISNFQPEDAAVYYCIAGYYSEA
Loxodonta africana V1237 ighv AAGU03093977.1 8249 QLKESGPGVVKPSQTLSLTCAVSGFSLTSSAVGWVRQAPGKGLEWVGGIHSGGSTYYNSALKSRLSITRDTSKSQVYLQLTSVNPEDTAMYYCAK
Loxodonta africana V1238 trdv AAGU03094043.1 4009 SIVAQKVTQVQPAVSTEEGAAVTLRCLYETSETYYYIFWYKQLPSGEIIFVIHQGSSMPSSKDGRYSLDFQKKDKSISLTISALELEDSAKYFCALVN
Loxodonta africana V1239 igkv AAGU03094083.1 22452 ASGDIVITQSPASLAKSQGETVTINCKASQSVSNYLAWYQQKPGQAPKLLIYGASSRASGIPDRFSGSGSGTDFTFTISNFQPEDAAVYYCQQSYNN
Loxodonta africana V1240 igkv AAGU03094083.1 9678 ASGDIVVTQSPASLAKSQGETVTTNCKASQSVSKNLGWYQQKPGQAPKLLIYDASNRASGVPDRFSGSGSGTDFTFTISNFQPEDAAVYYCFAGSYNEA
Loxodonta africana V1241 igkv AAGU03094525.1 8858 ASGDIVLTQSPASLAKSQGETVTINCKASQSVSSYLNWYQQKPGQAPKLLIYYASSRASGVPDRFSGSGSGTDFTLTISNFQADDAAVYYCQQSNN
Loxodonta africana V1243 igkv AAGU03094691.1 6238 ASGDIVLTQSPASLAKSQGETVTINCKASQSVSNYLSWYQQKPGQAPKLLIYAASSRASGVPDRFSGSGSGTDFTFTISNFQAEDAAVYYCLAGYSYQA
Loxodonta africana V1244 igkv AAGU03094743.1 5670 ASGDIVMTQSPASLAKSQGETVTINCKASQSVSSYLAWYQQKLGQALKQLISRASNPDPGVPDQFSGSGSGTDFTLTITNFQAEDATVYYCMQGYNN
Loxodonta africana V1245 igkv AAGU03094873.1 3494 ASGDIVLTQSPASLAKSQGETVTINCKASQSVSSYLSWYQQKPGQAPKLLIYAASSRASGVPDRFSGSGSGTDFTFTISNFQPEDAAVYYCFAGSYNEA
Loxodonta africana V1246 trbv AAGU03095666.1 1074 ITDSGISQTPKYLVREEGRDVSLDCEQSFGDDAMYWYQQDPGQGLKLVYYSPVTNDVQEGDAAAGYSASREKKQRFPLAVTRAQRNQTALYLCASSK