WGS Statistics
Organism WGS Record. Vs Total IGHV IGLV IGKV TRAV TRBV TRGV TRDV
Haplochromis burtoni AFNZ00000000.1 (AFNZ01) 192 115 4 15 13 40 1 4
Vgene Table
Organism Vgene Locus contig Contig Pos. AA sequence
Haplochromis burtoni Vs213 trdv AFNZ01053355.1 2240 LTAGDSITPQQPEVTETEGESVTLTCSYHTPATSAYLYWYRHHSELQAPQFILWKRGKGGTYEYIPDNRYRSETSDRSTNLTIAALTLADTALYYCALQ
Haplochromis burtoni Vs212 trav AFNZ01053355.1 1463 CRAQKDNVLQAKGEETAAAGGTVTLDCQYNTSSSNHYLYWYKQDGNNSPKFILSRFKVGEGKNEAGDRFSSTLDSSIRSVPLKIQKLQLSDSAVYYCALQ
Haplochromis burtoni Vs211 trav AFNZ01053354.1 3329 LGSMNSIKQERAEEAVAERGNINLTCTYDGSIYNIQWYRQYQRSRPEFLLYITEGGSVHRAVSGFSAHIDKTEKRADLEISSAAVSDSAVYYCAVR
Haplochromis burtoni Vs210 trav AFNZ01053353.1 2561 CKGEDKVIQEQRDVIAAEGDTVTLDCRYETSYTSPTLFWYKQKVNSYPKYMLKSFSETTDKSEEFNNDRFDAEVDKKEKSVPLKIQKLQLSDSAVYYCALQ
Haplochromis burtoni Vs217 ighv AFNZ01053501.1 422 VWSEIKLEQSASEVKRPGERVKMLCTLSGYRLTSCNIFWIRQRPGRALEWIGYMSTGNNSPGYASSFQSRFIITEEDSSSRQYLEITSLTAEDSAVYFCARE
Haplochromis burtoni Vs216 ighv AFNZ01053500.1 7215 VDGQTLTQSEPDLIKRPGESHRLTCTASEFTFRSSCMVWVKQATGKGPEWIAFIHTSSFRYSTYYSQSVQGRFTISRNDSSSKLYLQMDSLKTQDTAVYYCARE
Haplochromis burtoni Vs215 ighv AFNZ01053500.1 5796 VDGQTLTESEPVVKRPGESHRLTCTGSGFTFSSYWMAWVRQAPGKGLEWVATIDVTSKYYAQSVQGRFTISRDNNRQQVYLDMNTLKTEDSAVYYCA
Haplochromis burtoni Vs214 ighv AFNZ01053498.1 1917 TDSQTLTESEPVIKRPGESHRLTCTASGLTFSSNAMVWVRQAPGKGLEWIAFIETSSYSYSAFYSQSVQGRFTISRDDPSSKLYLQMNSLKTEDTAVYYCARK
Haplochromis burtoni Vs219 ighv AFNZ01053504.1 5349 VKCEQLTQPASETVQPGHRLTIACQVSYSMSTYWTAWIRQPAGKGLEWIGSACDGCTSQYKDSLKTKFSISIDSSSKTVTLTGQNLQPDDTAVYYCARD
Haplochromis burtoni Vs218 ighv AFNZ01053504.1 2785 VKCEQLNQPASVIVQPGQRLTITCQVSYSVSSYWTAWIRQPAGKGLEWIGNAVGSSTEYKDSLKSKFSISTDSSSNTVTLTGQNVQPDDTAVYYCARY
Haplochromis burtoni Vs188 trbv AFNZ01052401.1 16200 LTGGSDVSQTPLLWSTEGQSVTMNCSHTKGVAYRQMYWYQQLPGKGMKQIVFTTAYSTHTYESGFSEEKFPATKTNEQTGSLTVEKLVPGDSGVYFCSVS
Haplochromis burtoni Vs187 trbv AFNZ01052401.1 15518 GTDGSGVQQTPILGERMGGSATMYCNHTKGDVYFQMCWYRQLPGQTLELIVFISIAKNGDDYDYGNLSTEKFSASKSVPGSGTLTVKNLEPKDRGLYFCVVS
Haplochromis burtoni Vs186 trbv AFNZ01052401.1 13704 LTDGSDVEQTPTLWERDGESATMQCNHTKDFTYRYMYWFRQLPGETMTLIVFATTGKKDDEHDYGNFDKEKFSASKPVVESGTFTLKNLKPEDKGWYFCAVS
Haplochromis burtoni Vs185 trbv AFNZ01052401.1 10738 LTDGSDVSQTPLLWKSEGQSATMTCNHTKNHDYSQMYWYQQLPGQKIKQIVFTAPKTQHTYESGFSEEKFPATKISYETGSLTVEKLVPGDSGVYFCAVS
Haplochromis burtoni Vs184 trbv AFNZ01052401.1 9857 HVDGSDVTQTPILWKYQGDSATMSCNHTKGDLYFQMYWYRQLPGETMKLIVFTTTGKKDDDQDFGEFSKEKFSVTKPTADKGTFTVKNLKPEDKGWYFCAVS
Haplochromis burtoni Vs182 trbv AFNZ01052399.1 2092 FSFSVRIKQDPFLNSHIGDQSATLSCSQDEDNSYMFWYRQSKSGKIELITYSLGEKVWDTEAPFNKSKYSMSRPSLLRSSLQIHSVAAGDSAVYYCVSRR
Haplochromis burtoni Vs181 trbv AFNZ01052397.1 2403 QASAVIFQQSPSQIVDKNQEVQINCKHDDSSLVIMFWYQQRKENISMTLIGFGYYQQSQNYEGQFKEQFTLTRSSTVEGTLTIKNTDVSHSAVYFCAA
Haplochromis burtoni Vs105 trbv AFNZ01040786.1 886 VIWTNDVTQTPTLLLKTGDSAQMYCHHNLHGSYYHMYWFQQLPGESLRLIVHMLPYKAPDFGNFSQEKYSANKIVSESGAFTVKHLEPSDSGVYLCAVS
Haplochromis burtoni Vs470 ighv AFNZ01055673.1 1382 VKCAQLTQPASETVQPGQRLTITCQVSYSVTGYYTAWIRQPAGKGLEWIGMAAGSTTYYKDSLKSKFSISTDSSNNRVTLSGQNMQPEDTAVYYCARL
Haplochromis burtoni Vs451 ighv AFNZ01052747.1 496 VYGIDLIQADSVIVQPGQSLTITCRVSGYSLTSSSYATNWIRQRDGKQMDWIFTMWYDGSTSKNDALKNKFSMSRDTSARTVTITGQNLQPEDTAVYYCARM
Haplochromis burtoni Vs450 ighv AFNZ01052746.1 339 ADCQTLTESEPAVKRPGESHRLTCTTSGFNFGGYSMHWIRQAPGKGLEWIAYIRYDSAYIYYSQSVQGRFTISRDNSKQQVYLQMNSLKTEDSAVYYCARD
Haplochromis burtoni Vs453 trav AFNZ01053646.1 2675 CKGEDKVIQEQGDVIAAEGDTVTLGCRYETSDQYPYLFWYKQEINNFPKYVLLRGTSGTEDNDQEFPKDRFDAEAKKTENSVPLKIQKLQLSDSAVYYCALR
Haplochromis burtoni Vs452 ighv AFNZ01052750.1 485 VDGQTLTESESVIKRPGESHTLTCTASGFTFSSYWMAWVRQAPGKGLEWIASNYDSSNIYYSQSFRGRFTISRDNSKQQLYLQINSLKTEDFAVYYCA
Haplochromis burtoni Vs510 ighv AFNZ01064871.1 387 VNGQTLTESEPAVKQPGQSHRLTCTTSGFTLSSYWMHWIRQAPGKGLEWIAADTSSSTNYYSQSVQGRFTVSRDNSKQQLYLQMNSLKTEDSAVYYCARD
Haplochromis burtoni Vs109 trbv AFNZ01040788.1 187 FCCSVKIYQPPFTLSREGEKSVTLQCEQDNDEYLYMFWYKHADFRQMQLLTYSINKGIQTTEAPFNETKYFMSRPAVRNSSLHIKRVEPGDSAVYYCASRL
Haplochromis burtoni Vs167 trbv AFNZ01052393.1 1898 SSLSDRVHQNPADMYKNPGQAAEITCSHSIDSYDVILWYKQTENSQLQLLGYMLKTRDVLEPGWMVEIKGSADKDQTCTLTIKDLTLNSSAVYFCAAR
Haplochromis burtoni Vs166 trbv AFNZ01052393.1 813 SSLSDQVIQTPADMYKNHGQRAEINCSHKMTNYDRILWYKQTENSQLQLLGYMLATRDVLEPGWMVEIKGSANKDQTCTLIIKDLTLNSSAVYFCAAR
Haplochromis burtoni Vs161 trbv AFNZ01052392.1 8494 QSQDVFQQPEIRWSYVNKAAHMNCSHNKDKGHNQMYWYIQRPGETMRLIVYTVFGGKPDYGGAPENKYSASKEAIENGALTVNHLQQNDTGVYFCAVS
Haplochromis burtoni Vs163 trbv AFNZ01052392.1 14192 VCLGVEVRQTPSEFITNVGSKVEIFCSHEKTDYRMMLWYQQPPGETAMKLIGYLYFKDAKYEEQYKDHFNITGDLSVNTVKKGYLIVQVAQQEHSAAYYCAASK
Haplochromis burtoni Vs205 trbv AFNZ01052404.1 18156 GSPANDQVDQTPANIYTKGEDAKIHCSHSIQSYEKILWYKQSEKQLQLLGYMNYDKSNPEPGVNVTMDGGAEKDQNCTLTIKDIKASSSGVYFCAAS
Haplochromis burtoni Vs200 trbv AFNZ01052404.1 8971 ASSFSDQVDQTPANIYTNGEEAKIHCSHSVQSFYQILWYQQSNKELQYLGYMYLGKSSVETGVNVTIDGGANKGENCTLTIKDLKVSSSGVYFCAAS
Haplochromis burtoni Vs168 trbv AFNZ01052394.1 284 FSQDVTQQPEIRWSYVNEAAEMNCSHKKDISHNQMYWYIQRPGETMRLIVYTALGGVPDYGGAPKNKYSALKAKAENGALTVNDLQQNDSGVYFCAVS
Haplochromis burtoni Vs198 trbv AFNZ01052404.1 6472 ASSFSDQVHQTPTNIYTNEDQAKIYCSHSISGYYTILWYKQSEEQLQFLGYMLNDKGNPETGVNVMMDGDANEKKNCTLTIKDLKVSSSGVYFCAAS
Haplochromis burtoni Vs398 ighv AFNZ01039603.1 3654 VKCAQLTQPASVIVQPGQRLTITCQVSYSLSGDWTAWIRQPAGKGLEWIGMKYTGDSRYKDSLKSKFSIQLDTSSKTVTLNGQNMQPEDTAVYYCARG
Haplochromis burtoni Vs190 trbv AFNZ01052401.1 18443 VPKSGVHQTPAALIKAPGEEIQIHCNHSNNKLDMIQWYKQSPGKNEMILLGYARFTFTAVEDAFENIYKVTGEGSKLSTFHIPKLRESVDSAMYFCAASA
Haplochromis burtoni Vs446 ighv AFNZ01052741.1 3268 LDGQTLTESGPVVKRPGESHRLTCTASGFTLSSYDMNWIRQVPGKGLEWIAHIWGNGNRAFYSQSVQGRFTISRDNNRQQLYLQMNSLKTEDSAVYYCARD
Haplochromis burtoni Vs447 ighv AFNZ01052742.1 929 VDGQTLTQSEPVVKRSGESHRLTCTASGFTFSSHWMHWIRQAPGKGLEWIALIYTDSSGMFYSDSVRGRFTISRDNSRQQLYLQMNSLKTEDSAVYYCARD
Haplochromis burtoni Vs444 ighv AFNZ01052740.1 2329 IYGQTLTESEPVVKRPGDSHRLTCTASGFTFSSFWMGWIRQAPGKGLEWVATIKYDSGEIYHSQSVRGRLTISRDNNRQQLYLQMNSLKTEDSAVYYCARE
Haplochromis burtoni Vs445 ighv AFNZ01052740.1 729 VYSIDLIQPDSRMVQPGQSLSITCQVFGYSLTDDSYATGWIRQREGKAMDWIFHQWGTSGLRQNDALKDKFSYSRDTSARTVTITGQNLQTEDTAVYYCVR
Haplochromis burtoni Vs442 ighv AFNZ01052739.1 5888 QTITESEPAVTGPGESHRLTCTTFGFSFRSSVWSWIRQARGKGLEWIAFIHTASTPIHYSQSVRGRFTISRDDSSSKVYLQMNNLKTEDTAVYYCARV
Haplochromis burtoni Vs443 ighv AFNZ01052739.1 1084 VDGQTLTESEPALKRPGDSHSLTCTASGFTFSSYYMVWVRQASGKGLEWIAFIYSDSSGAFYSDSVRGWFTISRDNSRQQLYLQMNSLKPEDSAVYYCARD
Haplochromis burtoni Vs440 ighv AFNZ01052738.1 828 WTITESEPAVTGPGESHRLTCTTSGFSFSSEVWNWIRQAPGKGLEWIALVHTSSTPIYYSQSVLGRFTISRDDSSSKVYLQMNNLKTEDTAVYYCARE
Haplochromis burtoni Vs441 ighv AFNZ01052739.1 15204 VYSIDLIQPDARSVQPGQPLTITCQVSGYSMTDNSYATGWIRQREGKAMDWIFHQWGGGDFYKNDALKNKFSYSRDTSARTATITGQNLQPEDTAVYYCVRY
Haplochromis burtoni Vs119 trbv AFNZ01042209.1 899 FSRGVKIDQLQIIFSRERTKNVTLDCKQDDSQYYYMYWYRQSSSGKLELMAYSPGQNSWNIEAPFEKIKYTMSRPSVLESTLQIHPVEPEDTALYYCASRI
Haplochromis burtoni Vs448 ighv AFNZ01052745.1 8366 VYSIDHIQPSSLVEQPGQALTITCRVSGYSLSDGGYGTGWIRQGEEKPLEWIFYTWYSGGTYQDDALKNKFSISRDTSAQTLTITGQNLQPEDTAVYYCIC
Haplochromis burtoni Vs449 ighv AFNZ01052745.1 6822 VVGQTLTQSEPAIKRPGESHRLTCTASGYNFGDRSLVWVRQAPGKGLEWIAYIYWGDGSTSYSQSVQGRFTISKDNSKQQVYLQMNSLKTEDSSVYYCAR
Haplochromis burtoni Vs56 trbv AFNZ01023647.1 7380 DGSDVTQNSTIWKKQGEDGTINCRHTKSVDYFQMYWYRQLPGETMKLVFTSTAKPDHDFGNFSREKFAATKPDAYTGTFTIKNLEPTDKGLYFCAVS
Haplochromis burtoni Vs175 trbv AFNZ01052396.1 5910 LCLGVEVHQTPVEVFRTRGDEVQLVCSHGKTDYTFMQWYQKSPGDQALKRIGHLNYNNKEHEKSFEKHFNITGDLSGSKPKNASMFIVDLKPEHSAVYYCAASY
Haplochromis burtoni Vs172 trbv AFNZ01052396.1 2209 HSQDVIQYPEISWGFLNKAAEMNCSHSKDIRYTQMYWYIQRPGETMRLIVYTVFRGNPDYGGAPENKYSAIKEAIENGALTVNNLQQNDSGVYFCAVS
Haplochromis burtoni Vs171 trbv AFNZ01052396.1 194 SSLSDQVFQTPADMYKNQEQTAEINCSHSIAGYDRILWYKQTKSKQLHFLGYMVVSQGAPEPGWRVDIKGSANPHQTCTLIIKDLTLNSSAVYFCAAR
Haplochromis burtoni Vs512 ighv AFNZ01067873.1 635 VNGQTLTESEPAVKQPGQSHRLTCTTSGISFSSYDMVWIRQAPGKGLEWIAYISNGGSSIYYSQSVRGRFTISRDNSREQLYLQMNSLTTEDSAVYYCARR
Haplochromis burtoni Vs468 ighv AFNZ01055574.1 2234 VYSIDLIQSDSIVAQPGQSVTITCQVSGYSLTDRNYATGWIRQSEGKTLEWIVHRWGNGDMAQNNALKNKLLHHTYSSTSSVTLTGVNLQPEDTAVYYCVRS
Haplochromis burtoni Vs85 trbv AFNZ01032170.1 2898 IVLTQTPAVHTVSPGQEIVLNCNIERYDANSVRWYKQVPGTVPQYVLRFHHSSSSPGFGTGFSSDRFNSKSSSNIDYQFIIKRAETGDSAVYYCQTYDDSAS
Haplochromis burtoni Vs408 ighv AFNZ01039609.1 7351 TEAQTLTESESVIKRPGESHRLTCTYSGFGWDIHAVWIRQAAGKGPEWVAWIQSDSSNIHYSQSFRGRFTISRDNSRKQLYLQMNSLTTEDSAVYYCAKE
Haplochromis burtoni Vs367 ighv AFNZ01039586.1 13271 VTGQSMESIPSSPVVKRPGETLSLSCRGSGFTFSCCSMHWIRQPAGKGLEWMGRVYSDASRTDYSSSLQGRIEVTRDNSNSMTYLRLSNLKPEDSAVYYCA
Haplochromis burtoni Vs366 ighv AFNZ01039585.1 853 VVGQTLIESEPAVKRPGESHRLTCTGSGFTFSSYPMNWVRQAPGKGLEWIAFIHTYSTHIYYSQSVQGRFTISRDDSSSKVYLQMNNLKTEDTAVYYCARE
Haplochromis burtoni Vs365 ighv AFNZ01039584.1 784 TEGQTLTESESVVKQPGQSHRLTCTYSGFSGDDHYVWIRQAAGKGLEWIAWIRYDGGSTYYSQSVRGRFTISRDNSRKQVYLQMNSLKTEDSAVYYCARE
Haplochromis burtoni Vs364 ighv AFNZ01039582.1 4479 NISVGTEGQTLTESESVVKRPGDSHTLTCTYSGFSSDIDAAWIRQAAGKGLEWIAYRSSGSSYIHYSQSVRGRFTITRDNSRKQVYLQMSSLTTEDSAVYYCARK
Haplochromis burtoni Vs363 ighv AFNZ01039581.1 1526 TEGQTLTQSESVVKRPGDSHRLTCTYSGFSSDYDTAWIRQAPGKGLEWIAWINYGGSSTYHSQSVRGRFTISRDNSIKQVYLQMNGLTTEDSAVYYCARE
Haplochromis burtoni Vs362 ighv AFNZ01039581.1 2944 VYSIDLIQSDSAVVQPGKSVTITCQVSGYSLTDRNYATGWIRQSEGKTLEWIVLRWGSGVYNQNNALKNKLLHHTYSSTSSVTLTGLNLQPEDTAVYYCVRS
Haplochromis burtoni Vs361 ighv AFNZ01039581.1 4929 VTGQSMESIPSSPVVKRPGETLSLSCRGSGFTFSCCSMHWNRQPAGKALEWLGRVYSSGSGTDYSSSLRGRIEITKDNSNSMTYLRLSNLKPEDSAMYYCAKE
Haplochromis burtoni Vs360 ighv AFNZ01039581.1 6960 VKCEQLFQPDTVTVQPGQSLTITCRVSYSVGNHHTAWIRQPAGKELEFIQSARVGYSTLYKDSLKNKFSINLDSSSNTVTLNGQNVQPEDTAVYYCA
Haplochromis burtoni Vs479 ighv AFNZ01056289.1 1577 VYSIDLIQPESRSVQPGQSLTITCRVSGYSMTDDSYATGWIRQREGKAMDWISHQWGGGTLRQNDDLKNKFSYSRDTSARTATITGQNLQMEDTAVYYCVRY
Haplochromis burtoni Vs478 ighv AFNZ01056289.1 4267 VESQTITQSESVVKRPADFHRLTCTGSNIDFSSRWMAWIRQAPGKGLEWIAIIEYDSDNIFYSQSVQGRFTISRDNSKEELYLQMNSLKTEDTAVYYCARE
Haplochromis burtoni Vs369 ighv AFNZ01039587.1 4869 TEGQTLTESESVIKRPGQSHRLTCTYSGFGGDIYAAWIRQAAGKGLEWIAYISSGSSSIFYSQSVRGRFTISRDNSRKQVYLQMNSLTTEDSAVYYCARE
Haplochromis burtoni Vs251 ighv AFNZ01063432.1 557 VDGQTLTQSEPAVKRPGESHRLTCTASGYTFGDYSLVWVRQAPGKGLEWIAYIYYGDGSTSYSQSVQGRFTISKDNSKQQLYLQMNSLKTEDSAVYYCARN
Haplochromis burtoni Vs471 ighv AFNZ01055675.1 1161 VNGQTLTESEPVTKRPGESHRLTCTVSGFTLGSYYMAWVRQAPGRALEWIAYIGTSSSPIRYSQSVQGRFIISRDDSSSKIYLQMNSLKIEDTAVYYCARR
Haplochromis burtoni Vs262 igkv AFNZ01066736.1 164 SSAEIILTQTPTAQSVVPGQTVSIRCKASSSMGSYLHWYLQKPAESPKLLVSYATSRQSGIPDRFSGSQSGTDFTLTISGVQAEDAGVYYCGQSGYSFP
Haplochromis burtoni Vs263 ighv AFNZ01067900.1 455 TTLMDCEGQTLTESEPVIKRPGDAHRLTCTYSDFSVHEDNVWIRQAAGNGLEWIAYISGGGSYIHYSQSVKGWFTISRDNSRQQVYLQMNSLNNEDSAVYYCA
Haplochromis burtoni Vs399 ighv AFNZ01039606.1 7476 TESQTLTESESVIKRPGDSHRLTCTYSGFSGNYETAWIRQAAGKGLEWIAYISGGSSSYIHYSQSFRGRFTISRDNSRKQVYLQMNSLTSEDSAVYYCARELQ
Haplochromis burtoni Vs402 ighv AFNZ01039607.1 928 VKCEQLTQPASVIVQPGQRLTITCQVSYSLGAWTAWIRQPAGKGLEWIGMKQTSTSHYKDSLKSKFSIDLDTSSNTVTLNGQNMQPEDTAVYYCARE
Haplochromis burtoni Vs403 ighv AFNZ01039608.1 3848 TDGQTLTESEPVVKRTGESHRLTCTYSGFSSDIHGAWIRQAAGKGLEWIALIWDDSSGSYYTESVRGRFTISRDNSRKQVYLQMNSLTTEDSAVYYCARE
Haplochromis burtoni Vs400 ighv AFNZ01039606.1 5083 VMCEQLTQPPSVIVQPGQRLTITCQVSYSVGSYYTAWIRQPAGKGLEWIGMRYTGGTHFKDSLKSKFSIDLDSSSNRVTLNGQNMQPEDTAVYYCARV
Haplochromis burtoni Vs485 ighv AFNZ01058710.1 1131 VYSIDLVQPDSMVIQPGQSLTITCQVSGYSLTSHGTAWIRQREGKQLEWILIIWGGGSIDKNDALKNKFSVSRDTSAQTLTITGQNLQPEDTAVYYCART
Haplochromis burtoni Vs401 ighv AFNZ01039607.1 3129 TEGQTLTESESVIKRPGESHRLTCTYSGFSGDFHAAWVRQAAGKGLEWVAWISNGGSISYSQSVRGRFTISRDNSRKQVYLQMNSLTTEDSAVYYCARE
Haplochromis burtoni Vs404 ighv AFNZ01039608.1 1213 VTGQSMESIPSSPVVKRPGETLSLSCRGSGFTFSCCTMHWIRQKPGESLEWMGEGYTDSSKNKYVSSLRGRIEITKDNSNSMVHLSLSNLKPEDSAVYYCA
Haplochromis burtoni Vs406 ighv AFNZ01039609.1 15128 FTGQSMESIPSSPVVKQPGETLSLSCRGSGFTFTCCGMPWIRQQPGKGLEWIGIGFSSSSSNSYASSLRGRVEIHRDDSNSMTYLSLSNFKPEDSAVYYCAR
Haplochromis burtoni Vs407 ighv AFNZ01039609.1 13334 LNGQAMESIPSTPVLKNPHETLSLSCRGSGFNFGSYGMHWIRQPAGKGLEWFGTIWSDASRTEYIASVQGRIEITKDNSNSMTYLRLSNLKPEDSAVYYCAR
Haplochromis burtoni Vs370 ighv AFNZ01039588.1 3330 IKCQTLTQSEPVVKSPGESHRLTCTYSGFSGHYATAWIRQAAGKGLEWIAFIWGESSGSFYSQSVQGRFTISRDNSRQQVYLEMNSLTVEDSAVYYCARQ
Haplochromis burtoni Vs371 ighv AFNZ01039588.1 515 TEGQTLTESESVVKRPGDSHRLTCTYSGFSSDYWNAWIRQAAGKGLEWVATISGSSSSIYYYESVRGRFTISRDNSRKQVYLQMNSLMTEDSAVYYCARE
Haplochromis burtoni Vs372 ighv AFNZ01039589.1 1140 TEGQTLTESESVVKRPGDSHRLTCTYSGFSYDIAAAWIRQAAGKGLEWISLIESGSGSSKYYSQSVQGRFTISRDNSRKQVYLQMSSLTTEDSAVYYCARE
Haplochromis burtoni Vs373 ighv AFNZ01039590.1 11468 VKCEQLTQPASVTVHPGDRLTITCQTSYSLSSARTFWIRQPAGKELECIGSVHVGHSTRYKDSLQNKFSIDIDSSNRTVTLIGQNVQPEDSAVYYCARE
Haplochromis burtoni Vs374 ighv AFNZ01039590.1 10225 LNGQALESIPSTSVLKKPQEAFSLSCRGSGFDFGQYGMHWIRQPAGKTLEWMGAIWYDASKTIYASSVQGRIEITRDNSNSMVHLSLSSLKPEDSAVYYCARK
Haplochromis burtoni Vs375 ighv AFNZ01039590.1 7500 VKCEQLIQTASVTVQPGQRLTITCQVSYSLRSWRTAWIRQPAGKGLEWIGDAHYGHNTYYKDSLKNKFTINLDTSSKTVTLNGQNMQPEDTAVYYCARM
Haplochromis burtoni Vs376 ighv AFNZ01039590.1 5551 INISVGTEGQTLTESESVIKRPGDSHRLTCTYSGFSGDYSNAWIRQAAGKGLEWIAWISSGSSSWYSQSFRGRFTISRDNSRKQVYLQMNSLTIEDSAVYYCARE
Haplochromis burtoni Vs377 ighv AFNZ01039590.1 2409 VDGQIESEPVIKRPGESHRLTCTGSGFTFSSYPMIWVRQAPGKGLEWIAFVHKYSSDFYYSQSVQGRFTISRDDSSSKVYLQMNNLKTEDTAVYYCARE
Haplochromis burtoni Vs379 ighv AFNZ01039592.1 1003 GVKCEQLTQPDSLSVLLGHPLTITCKVSYSVRSYWTHWNRQAPGKGLEWIGRAASGSTPHYSPLLRNKFSISTDSSRNTVILTGQNVQPEDSAVYYCARD
Haplochromis burtoni Vs466 ighv AFNZ01055573.1 1225 VDGQTLRESEPVIKRPGESHRLTCTASGFTFSSYRMVWVRQAPGKGLEWIAFIHTGSSHIYYSQSVQGRFIISRDDSSSKLFLQMNSLKTEDTAVYHCARC
Haplochromis burtoni Vs405 ighv AFNZ01039609.1 16580 VTGQSMESIPSSPVVKQPGETLSLSCRGSGFTFTCCGMSWIRQQPGKGLEWIGVGHIPSSSNRYVSSLIGRIEVSRDDSNSMVHLRLSNLKPEDSAVYYCA
Haplochromis burtoni Vs463 ighv AFNZ01055569.1 4029 VEGQTLTQSEPDLIKRPGESHRLTCTVSGFTISSYAMVWVRQAPGKGLEWIAYIGTLGYPTYYSQSVQGRFTISSDDSSSKLYLQMDSLKTEDTAVYYCARE
Haplochromis burtoni Vs158 trbv AFNZ01052392.1 5015 QSEDVFQQPEINYVNKAAHMNCSHNKDKGHLQMYWYIQRPGETMRLIVYTVFGGKPDYGGALEIKYSASRKTIENGALTVNHLQQNDTGVYFCAVS
Haplochromis burtoni Vs154 trbv AFNZ01052392.1 1381 SSLSDQVHQTPADMFQNQGQTATINCSHSVDGYDRILWYKQTKSKQLHFLGYMFENLRNPEPGVNVTMAGNANKDETCTLTIADLTVSSSAVYFCAAR
Haplochromis burtoni Vs239 ighv AFNZ01060226.1 4587 VKCEQLTQPASLTLQPGQRLTITCHFSYSVSSYWTHWVKQPAGKVLEWIGEECAGQTTHYKDSLRNKFSISTDSSSNTVTLTGQNVQIEDTAVYYCARE
Haplochromis burtoni Vs157 trbv AFNZ01052392.1 4342 LSPSDRVHQEPADMYKTSEDIAKIQCLQSIDDNHNRILWYKQSNSQLQLLGYMVANRGLPETGFNVSIDGSANKDQTCTLTIKRLDFNSSAVYFCAAS
Haplochromis burtoni Vs153 trbv AFNZ01052391.1 429 VSSTYMVQQTPPSIIKKVGQSVSSEIHCSHSVSSFNRILWYKQDKHRALKFLGYLNVNSPNPEDDVKGKISFNGDGRKHSNLTISNVSVTDSAVYFCAA
Haplochromis burtoni Vs491 ighv AFNZ01059257.1 872 VKCEHLTQPGAVTVQPGQRLTIICQVSYSVSSYSTAWIRQSAGKNLEWIGQQCHGCTPAYKDSLKNKFSISTDSSSNTVTLNGQNVQPDDTAVYYCARY
Haplochromis burtoni Vs490 ighv AFNZ01058714.1 1230 VKCEQLTQSASLTLQPGHRLTITCQVSYSMSSYWTHYIRQPAGKGLEWIGRACDGCTSEYKDSLKTKFSISTESSSNTVTLTGQNVQVEDTAVYYCARE
Haplochromis burtoni Vs493 ighv AFNZ01059262.1 3308 VEGQTLTQSEPDLIKRPGESHRLTCTASGFTFRDYEMVWVRQATGKGPEWIAFISISTHSYATFYSQSVQGRFTISRDDSSSKVYLQMNSLKTEDTAVYYCARE
Haplochromis burtoni Vs492 ighv AFNZ01059259.1 1674 VNGQTLTESEPAVKQPGQSHRLTCTTSGFSFSSYYMAWIRQGPGKGLEWIASIRYGGGSTWYSQSVQGRFTISRDNSREQLYLQMNSLKTEDSVVYYCARE
Haplochromis burtoni Vs495 ighv AFNZ01060217.1 1561 RLTESEPVVKRPGESHKLTCTGSGFTFSDYWMAWVRQAPGKALEWVANIRYDSAYIYYSQSVQGRFTISRDNSKQQLYMQMNSLRTEESAVYYCARD
Haplochromis burtoni Vs497 ighv AFNZ01060221.1 1911 VDGQTLTQSEAAVKRPGDSHRLTCTGSGYSFGGYGMHWIRQAPGKGLEWIAYIYSDGSGTFYSDSVRGRFTISRDNSKQQLYLQMNSLKPEDSDVYYCA
Haplochromis burtoni Vs389 ighv AFNZ01039598.1 6335 TEGQTLTESGPVVKRPGDSHRLTCTYSGFSGDIYAVWVRQAAGKGLEWIARISDDSNYISYSQSVRGRFTISRDNSRKQLYLQMSSLTTEDSAVYYCARE
Haplochromis burtoni Vs388 ighv AFNZ01039598.1 9759 VDGQTLTESEPAVKRPGDSHRLTCTASGFSFSSFEMNWVRQSPGKGLEWVAYINSGGGSKHYSQSVQGRFTISRDNSREQVYLQMNSLRTEDSAVYYCVRE
Haplochromis burtoni Vs385 ighv AFNZ01039597.1 3369 VNISVGTEGQTLTESEPVVKRPGDSHRLTCTYSGFNYNIDGVWVRQAAGKGLEWIAYISRSSAIFYSQSFRGRFTISRDNSRKQVYLQMNSLTTEDSAVYYCAEQ
Haplochromis burtoni Vs384 ighv AFNZ01039597.1 4951 TTLMDCEGQTLTESEPVIKRAADSHRLTCTYSDFSVHEDNVWIRQAPGNGLEWIAYIIGGGSYIHYSQSVKGRFTISRDNSRQQVYLQMNSLNNEDSAVYYCA
Haplochromis burtoni Vs387 ighv AFNZ01039598.1 12031 TEGQTLTESQSVIKRPGDSHRLTCTYSGFSSDHWNAWIRQAAGKGLEWISAISDSSAYIYYSQSVQGRFTISRDNSRKQVYLQMNSLTTEDSAVYYCARE
Haplochromis burtoni Vs386 ighv AFNZ01039597.1 1219 VKCEQLTQPASVTVQPGQRLTITCQVSYSLSTYWTGWIRQPAGKGLEWIGVKSTGSSYYKDSLKNKFSIDLDTSSNTVTLNGQNMQPEDTAVYYCARE
Haplochromis burtoni Vs381 ighv AFNZ01039596.1 378 VQCEQLTQKASETVQPGQRLTITCQVSYSVTGRWTAWIRQPTGKGSRVGATLAYKDSLKNKFSISLDSSINTVTHTGQNMQPEDTVVYYCARD
Haplochromis burtoni Vs380 ighv AFNZ01039595.1 1117 IDGQTLTQSEPVVKKPGESQKLTCTTSGLSFSSWWMAWIRQAPGKGLEWIATEANGGTNYYSQSVRGRFTASRDNSREQLFLQMNNLKTEDSAVYYCARD
Haplochromis burtoni Vs383 ighv AFNZ01039597.1 6620 VQCEQLTQPAYVTKQPGQRLSITCQVSYSVGGYYTAWIRQPAGKGLEWIGSKYTGASYYKDSLKSKFSIDLDSSSNTVTLNGQNMQPEDTAVYYCARD
Haplochromis burtoni Vs382 ighv AFNZ01039597.1 8622 VDGQTLTESEPAVKRPGQSHRLTCTTSGFTFSSYAMDWVRQAPGKGLEWIAFIHTGSSEIYYSQSVQGRFTISRDDSSSKLYLQMNNLKTEDTAVYYCARD
Haplochromis burtoni Vs322 iglv AFNZ01026210.1 7294 VSGVTVLTQKPPVLSVRKGETATMDCNLGTVTGSNARWYKQVPGEVPQFVLRFHHSWGSPTYGSGFSAPKFTSTHQSTTDYRLIIKNVEEGDSAVYYCK
Haplochromis burtoni Vs120 trbv AFNZ01042210.1 622 LTVVVLQSGDQISDPGRKVLLECKMGPGFSMGSYTMFWYRQNHHRAPIEFLVKEYEKPVGRLESFIDTSKNNFSLQITELHMNDSSTYYCAA
Haplochromis burtoni Vs125 igkv AFNZ01045536.1 585 SAGQNVVVTQSATKSVQLGQTVNINCKVSTQVAQYSGSKYYLAWYHQKTGEAPKALIYLTSDRLSGISSRLSGSGAGNGLDFTLSISAVQADDAGVYYCQS
Haplochromis burtoni Vs124 igkv AFNZ01045535.1 129 SSGQIIVTQSPGAQSVVAGQSVSITCRTSTSVSNYLHWYLQKPGKAPKLLIYKATNRQSGVSDRFSGSGSGTDFTLTIRGVQAEDSGVYYCQQGSNL
Haplochromis burtoni Vs238 ighv AFNZ01060226.1 1226 VDGQTLTQSEPDLIKRPGESHRLTCTASGFTFRDYEMVWVRQATGKGPEWIAFISTSTYSYATFYSQSVQGRFTISRDDSSSKLYLQMNSLKTEDTAVYYCARE
Haplochromis burtoni Vs482 trav AFNZ01057465.1 11198 CKGEDKVIQEQGDVIAAEGDTVTLYCKYETTSAFPYLFWYKQDVNDYPKYVLRRDASGTENAQEFPKNRFDAELNKTSVSLKIQKLQLSDSAVYYCALR
Haplochromis burtoni Vs411 ighv AFNZ01039616.1 469 VTGQSMESIPSSPVVKQPGETLSLSCRGSGFTFTCCTMNWVRQQPGKALEWIGIGFSSSSSNSYASSLRGRIEVSRDDSNSLTHLRLSNLKPEDSAVYYCAR
Haplochromis burtoni Vs227 igkv AFNZ01055683.1 1633 CSGQVTVTQPPVVTSTPGSTVTLTCRTNQAVGGCGAGQCMFWYQQKSGQIPKLLIRHVSISHSGTPSRFSGSGSRSDFSMTISGVQAEDAAVYYCKSVHSGPV
Haplochromis burtoni Vs486 ighv AFNZ01058711.1 6144 VYSIDLIQPDSRIVQPGQSLTITCQVSGYSVTSYGTAWVRQREGNPLEWINIIWSGGSTDNNNALKNKFSISRDTSAQTVTITGRNLQPEDTAVYYCA
Haplochromis burtoni Vs487 ighv AFNZ01058711.1 3231 VYCIDLNQPESRVVQPGQSMTITCRVSGYSVTDGSYGTCWIRQREGKQMDWIFCIWSDGSSSKNDALKNKFSISRDTSAQTVTITGQNLQPEDTAVYYCARY
Haplochromis burtoni Vs410 ighv AFNZ01039609.1 1433 TEGQTLTESESVIKRPGESHRLTCTYSGFSGNINGAWIRQAAGKGLEWVAWIRHDSNEIYYSQSVRGRFTISRDNSRKQVYLQMNSLTTEDSAVYHCAKE
Haplochromis burtoni Vs488 ighv AFNZ01058713.1 1732 VKCEQLTQPASLTVRPGQRLTITCHFSYSVSSYWTHMVRQPAGKGLEWIGEARAGYTTYYKDSLKNKFSISTDSSSNTVTLTGENVQPEDTAVYYCARE
Haplochromis burtoni Vs489 ighv AFNZ01058713.1 585 VWSEVKLEQSPSEVKGFGERVKMSCALSGYTLTENDIHWIRQRPGRALEWIGYMSTGYNSPSYGSSFQHRFIMTEEDSSRRQYLDINSLTAEDSVVYFCA
Haplochromis burtoni Vs412 ighv AFNZ01039617.1 2321 VTGQSLESVPSSPVVKRPGETLSLSCRGSGSEFTCCAMSWIRQQPGKGLEWIGISFTDTSRNRYVSSLIGRMGVSRNDSNYIVYLRLSNLRPEDSAVYYCARD
Haplochromis burtoni Vs257 igkv AFNZ01066449.1 553 SSGDVILTQTPEVQSVVPGQTVSIRCKASSSMGSYLHWYLQKPSEAPKLLVYYATNRHSGVSDHFSGSGSGTDFTLTISGVQAEDAGVYYCGQSGYSRP
Haplochromis burtoni Vs256 trav AFNZ01065889.1 1099 VICEELTALDTQKSSLEQSSVTLSCRYSKPVVGTYYFFWYQQYPGKPPKFLISHSDKGQLTSDLVSRLSVKVNETLMSLQISSAAVSDSAVYYCALQ
Haplochromis burtoni Vs409 ighv AFNZ01039609.1 5565 TEGQTLTESESVIKRTGDSHRLTCTYSGLSSDIHAAWIRQAAGKGLEWIAVIWGDSSGSFYSQSVTGRFSISRDNSKKQVYLQMNSLTTEDSAVYYCARE
Haplochromis burtoni Vs253 ighv AFNZ01064309.1 55 VDCQTLTESEPVVKRPGESHRLTCTGSGFTFSSHLMGWVRQAPGKGLEWVATIDVTSKYYAQSVQGRFTISRDNNRQQVYLDMNTLKTEDSAVYYCA
Haplochromis burtoni Vs252 igkv AFNZ01064254.1 118 SRGQITVTQPGGVRSSVGGSVSIKCRTSQNVRVWKNNHLLAWYQQKDGGIPKLLIHSATTRESGIPARFTGSGSNSDFTLTISGVQAEDAAVYYCQS
Haplochromis burtoni Vs83 iglv AFNZ01032169.1 7370 IVLTQTPSVHTVSPGQQAVLNCNIERYDGNYVRWYKQVPGEAPQYVLRFLHSGSSLEFGTGFSSDRFNSKSSSNIDYQFIIKRAETGDSAVYYCQT
Haplochromis burtoni Vs82 iglv AFNZ01032167.1 1832 VSGVTVVTQKPVLSVRKGETATMDCNLGTVTDSAARWYKQIPGGVPQYVLRFRHDWSSPTYGSGFSSPKFTSTHQSTTDYRLIISNVEEGDSAVYYCQTY
Haplochromis burtoni Vs396 ighv AFNZ01039601.1 2234 VNCEQLTQSPSVILQPGQRLTITCQVSYSLGYLTAWIRQPAGKGLEWIGVKNTGGSYYKDSLKSKFSIDLDTSSKTVTLNGQNMQPEDTAVYYCARG
Haplochromis burtoni Vs397 ighv AFNZ01039602.1 1940 VKCEQLTQPEFVTVQPGQRLTITCQASYSLSSWRTAWIRQPAGKGLEWIGGAHYGHNTHYKDSLKNKFTINLDTSSKTVTLNGQNMQPEDTAVYYCARG
Haplochromis burtoni Vs394 ighv AFNZ01039601.1 6435 TEGQTLTESESVIKRPGDSHRLTCTYSGFSGDIYAHWIRQTAGKGLEWIAYINPGSSSIYYSQSVRGRFTISRDNSRKQVYLQMNSLTTEDSAVYYCARE
Haplochromis burtoni Vs395 ighv AFNZ01039601.1 4173 VKCEQLTQPASVNVQPGQHLTITCQVSYSLSSDWTAWIRQPAGKGPEWIGVKSTGSSHYKDSLKSKFSIDLDTSSNTVTVNGQNIEPEDTAVYYCVRE
Haplochromis burtoni Vs392 ighv AFNZ01039599.1 2870 NISLGTEGQTLTESESVVKRPGDSHRLTCTYSGFSSNYETAWIRQAAGKGLEWIAYVSSSSSYIYYSQSVRGRFTISRDNGRKQVYLQMNSLTTEDSAVYYCARE
Haplochromis burtoni Vs390 ighv AFNZ01039598.1 4802 VDGQTLTESEPVIKRPGESHTLTCTASGFTFRDYYMAWVRQAPGKGLEWVAYISSGGGSKHYSQSVRGRFTISRDNSRQQLYLQMNSLRTEDSAVYYCARE
Haplochromis burtoni Vs391 ighv AFNZ01039598.1 875 VDGQTLTESEPVVKRPGESHTLTCTASGFSFSGYWMGWVRQAPGKGLEWVATLDSGSGSSKYYSQSVRGRFTISRDNSRQQLYLQMNSLKTEDSAVYYCARE
Haplochromis burtoni Vs235 ighv AFNZ01059966.1 1180 VFGQTLTESEPAVKQPGESHRLTCKASGFTFNSNWMAWVRQAPGKGLERVSTVRNDGGNSYYAQSVQGRFTISRDDSRQQVYLQMNNLKTEDSAVYYCARD
Haplochromis burtoni Vs234 ighv AFNZ01059963.1 944 VDGQILTESESVVKRPGESHRLTCTASGFTFSNHGMSWVRQAPGKGLEWIAYISTASYPIYYSQSVQGRFTISRDDSSSKVYLQMSSLKTEDTAVYYCARR
Haplochromis burtoni Vs237 ighv AFNZ01060025.1 3185 VYSIDLTQPDSRIVQPGQSLTITCQVSGYSITSYGTCWVRQRDGKQMDWINCMWYIGNTANNDALKNKFSVSRDTSAQTVTITGQNLQPEDTAVYYCAR
Haplochromis burtoni Vs236 ighv AFNZ01060024.1 2232 VKREQLTQPASMLVQPGQHLTITCQVSYSLSSYYTAWIRQPAGKALEWMSDDETVKDSLKNKFCVELDSSSNTVTLKGQNLQPEDTAVYYCARRR
Haplochromis burtoni Vs233 igkv AFNZ01058720.1 181 SDASSSVTQSPVFKAAALGETVSLSCTASEGVDDDLSWYLQKPGQPPKLLFYQISSRESDTPSHFSSSGSEPEFTLTINGVQAADAGDYYCMGAYTGPE
Haplochromis burtoni Vs132 trav AFNZ01048072.1 1396 CKGEDKVIQEQGDVIAAEGDTVTLHCKYETTSAYAYLFWYKQEVNKFPKYVLRRDTASEDNAQDFPKNRFDAELNKTSVPLKIQKLQLSDSAVYYCALR
Haplochromis burtoni Vs133 trav AFNZ01048075.1 123 GNSLEDDITASSAEVFSSEGRTVTVSCNYSVQAQNLQWYRQDPGSAPQFLLLITDTSEPTVVRATPPNPRLTAALDKERNRVNLEISSAAVSDSAVYYCALQ
Haplochromis burtoni Vs131 trav AFNZ01048071.1 13164 CKGEDKVIQEQGDVIAAEGDTVTLGCRYETSYTNPTLIWYKQEVNSYPKYMLHCVSTSIIKTEEFNNNRFDAKINEKQKSVPLKIQKLQLSDSAVYYCALQ
Haplochromis burtoni Vs136 trav AFNZ01049545.1 9664 EDKVIQEQGDVIAAEGDTVTLGCTFETSASYSYLFWYKQELNDFPKYVLQRGTTGTADNAQEFPKDRFDAEVDKKEKSVPLKIQKLQLSDSAVYYCALK
Haplochromis burtoni Vs137 trav AFNZ01049548.1 178 CRAQKDNVLQSKGEETAAAGGTVTLGCLYNSSTTTNYLFWYKQDGNNSPKFILMRYSGDDGNTAEEFKERFSSTLDSSSRSVPLKIQKLQLSDSAVYYCALQ
Haplochromis burtoni Vs135 trdv AFNZ01049545.1 7807 LTAGDSLTPQQPEVSKTEGESVKLTCSYETSYTHPELHWYRHHSDLQAPQFILWKGAKDYSRYEYIPDKRYESETSSTSTNLTIAALTLADTALYYCALE
Haplochromis burtoni Vs63 trbv AFNZ01023648.1 4834 LTDAKDVTQTPMLWEQQGNNATMDCSHTKGAFYVQMYWYRQLPGENMELIVFTTTAKKYDHDFGKFSKEKYSATKTEVHDGTFTVKNLEPKDSGWYFCAVS
Haplochromis burtoni Vs62 trbv AFNZ01023648.1 3318 LIDAKDVTQTLMLWEQRGNNATMDCSHTKGPTYYQMYWYRQLPGENMELIVFTTTAKKYDHDFGKFSKEKYSATKTEAHDGTFTVKDLEPKDSGWYFCAVS
Haplochromis burtoni Vs61 trbv AFNZ01023648.1 2313 VSSTYNVLQTPPSIIKKVGQSVSSEIHCSHNVSIFERILWYKQDKHRAPQFLGYLNLNFPYPEEDVKGKISFNGNGKKHSNLTISNVSVTDSAVYFCAAS
Haplochromis burtoni Vs60 trbv AFNZ01023648.1 1034 ASDTKSLSQTPPSIIRRIGESVQSEIKCSHSIKDYEVILWYKQDQHQTLEILGYVNLQFVNKESNPSGNISFDGDGRKKSALTIYNLKFSDSAVYFCAAK
Haplochromis burtoni Vs438 igkv AFNZ01052221.1 727 HLSAVIQSATVKQETGVRFAAVGDNVTLRCFYESQVAMHFSWYRQFLGSQPKRLSTIYKYDKPSEVLHTLEKNPRFSVERKEGTNHLQISGVRLSDSATYYCGS
Haplochromis burtoni Vs240 ighv AFNZ01060226.1 7815 LKCEQLNQPASVIVQPGHRLTITCQVSYSVSSWYTAWIRQPAGKGLEWVGMAATGSTTYYKDSLKSKFSISIDSSSKTVTLTGQNLQPDDTAVYYCARD
Haplochromis burtoni Vs241 ighv AFNZ01060227.1 225 LKCEQLNQPASVIVQPGQRLTITCQVSYSGYWTAWIRQHAGKGLEWIGMALGSSTEYNDSLKSKFSISTDSSSKTVTLTGQNMQPDDTAVYYCARY
Haplochromis burtoni Vs242 ighv AFNZ01060301.1 1628 VDGQTLTQSEPVVKRPGESHSLTCTGSGFDFSNYWMHWVRQAPGKGLEWVATIQVTSTYYSQSVRGRFTISRDNTRQQVYLQMNSLKTEDSAAYYCARE
Haplochromis burtoni Vs243 ighv AFNZ01060302.1 1015 VNGQTLTESEPAVKQPGESHRLTCTTSGISFSSYSMAWIRQAPGKGLEWIALKALGSGKYYSQSVQGRFTVSRDNSREQLYLQMNSLKTEDSAVYYCARE
Haplochromis burtoni Vs244 ighv AFNZ01060302.1 3203 VWCDIRLDQPPSEDKRPGETVKISCVTSGYTMTSYSINWIRQKPGKALEWMGWINTDTTVASYASAFQNRFTFTQDVPSSTQYLEIKSLTAEDSAVYFCAR
Haplochromis burtoni Vs245 igkv AFNZ01060710.1 141 SRGQYTVTQPGAVSSAVGGTVNIKCKISHTVINSDSVEWYQHKQGEPPKLLIYWSNRRASSISSRFTGSGSNSDFTLTISGVQAEDAAVYYCKG
Haplochromis burtoni Vs248 igkv AFNZ01062094.1 114 CSGQVTVTQPPVVTSTPGSTVTLTCRTNSAVGTCNSKPCMYWYQQKSGQTPKLLIKHGSIIQSGTPSRFSGSGSSSDFSMTISGVQAEDAGVYYCKSVHNGPV
Haplochromis burtoni Vs249 igkv AFNZ01062140.1 3593 PQVPVTQPGAVSSAVGEPVNIKCTTGQDVFFDSNSKHRLSWYQQKDGGVPKLLIYYASTRASGIPDRFTGSGSNKDFTLTISGVQAEDAAVYYCKGEFNV
Haplochromis burtoni Vs469 ighv AFNZ01055574.1 566 VDGQTLTESEPVIKRPGESHRLTCTASGFIFSDYAMVWVRQAPGKALEWIAHLTKPTGSTKSYSQSVQGRFTISRDNEKQQVYLEMNSLKTEDSAVYYCARR
Haplochromis burtoni Vs226 trav AFNZ01055355.1 1065 VTQTSEVPQLISLTVVDLGDNVTFGCEVSEKELKSFHWYKQSLGHLPQSVASVILDKITLSDAFKDSRFTLNKEIFTIRNVSKEDEATYFCQTRKAY
Haplochromis burtoni Vs57 trbv AFNZ01023647.1 10223 RTYGSDVNQASMLWKNQGEDATLNCSHTKNVEFYQMYWYRQLPGEPMKQMVYTIPNAQPDFEPDFRDEKFSVTKPDAHSGTLTVKNLVPGDQGLYFCAVS
Haplochromis burtoni Vs224 trdv AFNZ01053635.1 2396 LTAGDSITPQRDKVTATEGESVKLTCSYETTSSYPLLHWYRHHSDLQAPQFILWKGGRQQTGQYIPDKRYKSETSSTSTNLSIAALTLADTALYYCALE
Haplochromis burtoni Vs221 ighv AFNZ01053504.1 14482 VKCEQLTQSTAVTVQPGQPLTITCQVSYSLSGAWTHWIRQPAGKPLEWISRDTAVKDSLNNKFSAELDSSSNTVTLNGQNLQPEDTAVYYCAREP
Haplochromis burtoni Vs169 trbv AFNZ01052394.1 1678 VCLGVEVGQTPSEFITNVGSRVEIFCSHEKTDYRVMLWYQQPPGETAMKLIGFLNFQAFTFDQDQYKDHFDFTGDLSGDTAKNGSLIVKVTQHEHSAVYYCAARY
Haplochromis burtoni Vs342 igkv AFNZ01031971.1 9217 SQMFSFEHQESHFISAQVGGKVTLKCLYDAHVSARVFWFKQNLGQKPKIVSHFFKYNVNNSFSEELKNNPRFTLDKQDGKYHLTIKDLQVSDSATYYCVQYS
Haplochromis burtoni Vs58 trbv AFNZ01023647.1 11059 DGSDVTQTSMIWKKQDEEATINCNHTKDYTYSQMYWYRQLPGETMKLVVFTSTAKPDHDFGNFSREKFAATKPDAYTGTFTVKDLEPTDKGLYFCAVS
Haplochromis burtoni Vs59 trbv AFNZ01023647.1 12131 ASDTKSANQTPPSIIKRIGESVESEIKCSHSIPGYQVILWYKQDEKGVLQFLGYLNLELTKTEKDGKGKISFDGDGQKYSNLAISDVSVTDSAVYFCAAS
Haplochromis burtoni Vs464 ighv AFNZ01055570.1 1462 VNGQTLTESEPVVKRPGQSHRLTCTASGFTFRDYWMVWVRQAPGKGPEWIAFISTSTYSYATSYSQSVQGRFTISREDSSSKVYLQMDSLKTEDTAVYYCARG
Haplochromis burtoni Vs465 ighv AFNZ01055573.1 6937 VKCEQLTQPGSETVQPGQRLTITCQGSYSLSSHWTGWIRQPAGKGLEWIGARYTGEAAYKDSLKNKFSIDLDTSSKTVTLIGQNMQPDDTAMYYCARD
Haplochromis burtoni Vs467 ighv AFNZ01055574.1 4151 IDGQTLTESEPVVKRPGESHTLTCTASGFTFRDYQMAWVRQAPGKGLEWIALLSSPSGGSKYYSQSVQGRFTISRDNDKQQVYLQMSSLATADSAVYYCAR
Haplochromis burtoni Vs428 igkv AFNZ01046586.1 4417 CSGQVTVTQPPVLTSTPGNNVTLTCRTSQAVYRFDDGDDAMYWYQQKSGQAPKLLIKYAKTLQSGTPTRFSGSGSSSDFSMTISGVQTEDAAVYYCQS
Haplochromis burtoni Vs429 igkv AFNZ01046592.1 2138 CSGQMTVTQPPVETSTPGSTVTLNCWASSAVFRYNGVHQVISWYQQKSGQIPKLLIKYATTLESGTPSRFSGSGRNTDFSMTISGVQAEDAAVYYCLCLGV
Haplochromis burtoni Vs507 trdv AFNZ01063898.1 3222 LTAGDSITPQQAEVTKTEGKSVTLTCDYQTDEDNIYLHWYRHDSDLQAPQFILRKGAKGYTGEYIPDKRYGSQTTDKSTTLRITALTLADTALYYCALQ
Haplochromis burtoni Vs506 trav AFNZ01063822.1 5579 CKGEDKVIQEQGDVIAAEGDTVTLRCRFETSDASPTLFWYKQEVDSYPKYMLKCFSETTDKAEEFNNDRFDAKINKAEKSVPLKIQKLQLSDSAVYYCAVR
Haplochromis burtoni Vs505 ighv AFNZ01063280.1 1307 VKCEQMTQPASVIVQPGQRLTITCQVSYSLGSWRTAWIRQPAGKGLEWIGMKYTGDSVYKDSLKNKFSIDLDTSSKAVTLNGQNMQPEDTAVYYCARE
Haplochromis burtoni Vs504 ighv AFNZ01063280.1 5410 INISIGSEGQTLTESEPVVKRPGDSHTLTCTYSGFSGDYSNAWIRQAAGKGLEWVAMINSGSGSWYSQSFRGRFTISRDNSRKQVYLEMSSLTTEDSAVYYCARY
Haplochromis burtoni Vs509 igkv AFNZ01064696.1 3318 SSGEQVLTQTRGSQSVVPGQTVSVRCKASSSVGSNLNWYLQKDGESPKLLVYSASSRQSGISDRFSGSGYGTDFTLTISRVQAEDAGVYYCQHY
Haplochromis burtoni Vs183 trbv AFNZ01052401.1 8905 GADGSDVQQTLSLWDRQGQSATMQCNHTKGSDYLWMYWFRQLPGETMTLIVFATTGKKDNEHDYGDFDTEKFSASKTVAETGTFTVNKLEPKDQGWYFCAVS
Haplochromis burtoni Vs162 trbv AFNZ01052392.1 12462 SSLSDRVHQDPADMYKEQGQTAQITCSHSIDNYNIILWYKQTNSQLQLLGYMLGTTQFPEPGVTVTMDGSADKDKTCTLTIKDLFMNSSAVYFCAAR
Haplochromis burtoni Vs84 iglv AFNZ01032169.1 14729 VSGVTVVTQKPPVLSVRKGETATMDCNLGTVTNEPAWWYKQIPGGVPQYVVRFRHDWSSQYYGSGFSSPKFTCTHQSTTDYRLMIKNVEEGDSAVYYCETW
Haplochromis burtoni Vs368 ighv AFNZ01039586.1 7888 TEGQTLTESESVVKRPGDSHRLTCTYSGFSSDYWNVWIRQAAGKGLEWISAISDSSTYIYYSQSVQGRFTISRDNSRKQVYLQMNSLTTEDSAVYYCARD
Haplochromis burtoni Vs378 ighv AFNZ01039590.1 845 VNTSVGTEGQTLTESEPVVKRPGDSHRLTCTYSGFSSDIYANWIRQAAGKRLEWIVYIDPSSGIYYSQSVRGRFTISRDNSKKQVYLQMNSLTSEDSAVYYCAR
Haplochromis burtoni Vs496 ighv AFNZ01060220.1 914 IKGQTLTQSDSAVKRPGESHRLTCTGSGYNFAGFGMDWIRQAPGKGLEWIAYIWSDGSSTYYSQSVQGRFTISKDNNRQQVYLQMNSLKTEDSAVYYCA
Haplochromis burtoni Vs255 trbv AFNZ01064830.1 581 VSLSDQVHQTPADMYKNPNETATLRCLHTISTYNRILWYKQSQGGQLQLLGYMWGSRPTLEANVSATLDGSADENKNCTLTIEKLQQDSNAVYFCAAS
Haplochromis burtoni Vs393 ighv AFNZ01039600.1 496 VKCEQLTQPASVIVEPGQRLTITCQVSYSLGYWTAWIRQPAGKALEWIGMKYTGDSRYKDSLKSKFSIDLDTSSNTVTLNQQNMQPEDCAVYYCAR
Haplochromis burtoni Vs220 ighv AFNZ01053504.1 10727 VWSEIKLEQSPSEVKRPGERVKMSCIISGYSLTSYNIHWIQQRPGRALEWIGRMDTGKNSALYGSTFQSRFVITEEDSSSRQYLEIKSLTAEDSAAYFCAR
Haplochromis burtoni Vs500 trgv AFNZ01060623.1 2045 LVTMAAELIQKDLTLTATPGKTVSFSCGTSQCSGNYVHWYQKKDGDKFRVILHINIRTGEVNSDYNHAQRKDFSAVKNENSCELEINAVSLVHSAIYYCSCAQS