WGS Statistics
Organism WGS Record. Vs Total IGHV IGLV IGKV TRAV TRBV TRGV TRDV
Vipera berus berus JTGP00000000.1 (JTGP01) 133 80 31 0 20 2 0 0
Vgene Table
Organism Vgene Locus contig Contig Pos. AA sequence
Vipera berus berus Vs41 trav JTGP01038334.1 98 VSGQTTVTQDHQFLSVKEGNSIWLNCSYQGTEYNLQWYKQYPGSHPEFMILLTISQTKAEDNFEMILDTDKKTTSLHLKNTQFKDSAVYFCGM
Vipera berus berus Vs40 trav JTGP01038329.1 1055 CSLDAQVFQTPENLEVQEGSSFTLKCNYSSQYRPYFWYHQLPGAHPSLILSIYSQESQNNKGFVPKYLDNGKESHLHRPTAQLQDSGNYFCAVG
Vipera berus berus Vs43 trav JTGP01038338.1 698 QSPGGSTGQSVDQTSGIVTITEGQSLSLRCSYEAQYSGINYPFWYIQHPSQPLEILLTKSDNKNQGFQADHYENKTKGTFNMRKPAIQLKDSAVYFCAFR
Vipera berus berus Vs42 trav JTGP01038336.1 1666 SLGRAQKIKQPGSATALERKPYHLSCNLSSVTSEMIQWYQQFSGQKPRYLGGAYPSYKDEIANPKGKLYFSQDKTSSTLVIDDLTLADAAVYFCALK
Vipera berus berus Vs45 trav JTGP01038340.1 172 GSTGQSVKQTSGILTVTEEQPVSLNCSYEGEFTANYPFWYIQHPGQPLEILLDETDNNAQGFEATHHKNGKTGTFNMQKPAIKLKDSAVYFCAFR
Vipera berus berus Vs44 trav JTGP01038339.1 67 GSTGQSVKQTTGTVTVIEGESAFLKCSYEAQISSSIYTYWYIQQPGQPLKLLLTEYKNDAQGFHATHREGKKNGTFNLEKEAIQLEDSAIYFCAFR
Vipera berus berus Vs47 trav JTGP01038343.1 802 RSTGQSVKQASGIVTIIEGQPLSLSCSYEVQSSSSTFQYTYWYIQHPGQPLKVLLTEFENHGQGFHATHNKGAKNGTYDLEKDACQLKDSAVYFCAFKE
Vipera berus berus Vs46 trav JTGP01038341.1 971 RSTGQSVKQASGIVTVTEGQYLSLSCSYEAQFSRSSDTYWYVQHPGQPLKLLLTEYENYGQGFHATHRAGEKSGTYNLEKDASQLKDSAVYFCAFRE
Vipera berus berus Vs49 trav JTGP01038345.1 2015 RSTEQTVDQTSGIVTLTEGQSLSLYCSYEAQFRGEFDTYWYIQHPGQPPKYLLDSYLENAQGFQATHIPHENKQKGTFNMGKPAIQLKDSAVYFCAFR
Vipera berus berus Vs48 trav JTGP01038344.1 2293 RSTGQSVDQTSSIVTAMEGQSVSLSCSYEAQYSAVHYPFWYIQHPGQPLEILLTKFNKNAQGFQAAHYENDKKGTFNMQKQAIQLEDSAVYFCAFTE
Vipera berus berus Vs350 ighv JTGP01144104.1 1010 VQSQGQLVESGGDVRRPGESLHLSCQASGFTFRSQHMNWVRQSPGKGLDWVSGIYVDSSGKFYSDKVKGRFTVSRDNDKSQLNLQMNSLKAEDTAIYYCMK
Vipera berus berus Vs351 ighv JTGP01144105.1 871 VQSQVQLVESGGDVRRPGGSLRLSCQASGFTFSSYVMHWVRQAPGKGLEWVASTGSYYSDKVKGRFTISRDDAKSQLYLQMNSLKAEDTAVYYCAR
Vipera berus berus Vs356 ighv JTGP01144116.1 6526 VRSEVQLVESGGDVRRPGGSLRLSCQASGFTFSSYEMDWVRQAPGKGLEWVAYIDTGSSPIYYSDKVKGRFTISRDDAKSQLYLQMNSLKAEDTAVYYCAR
Vipera berus berus Vs211 ighv JTGP01238259.1 578 IKCSVQLEQSGSFVKRPGQSLFLFCKGSGFNFGSYGMNWVRQAPGKGLEWIAGIWYDASKQVYAESVKGRFTISRDNAKSLVYLQMNSLKPEDTAVYYCAR
Vipera berus berus Vs354 ighv JTGP01144114.1 591 IQAQLVESGGDVRRPGGSLHLFCQASGFTFSNSWMYWMRRAPGKGMEWVSHINPISSSIFYSDKVKGRFTISRDNAKSQLYLQMNSLKSEDTAIYYCMA
Vipera berus berus Vs355 ighv JTGP01144116.1 8818 VRSEVQLVESGGDVRRPGGSLHLSCQASGFTFSSYAMHWVRQASGKGLEWVAAIGSTDTYYSDKVKGRFTISRDNAKSQLYLQMSSLKAEDTAVYYCAG
Vipera berus berus Vs359 ighv JTGP01144116.1 419 VWSQDRLVAYGGGTKNVGQYHSIYCQVSGFIMEFTYSEMNWMRLVPGKGLEWVARIFSDSSGKSYLQKVKGRFTVTRHNTQRQLDLQISNLKPEDSGVYYCT
Vipera berus berus Vs215 ighv JTGP01239229.1 926 VKSSGQLVESGGDVRRPGESLHLSCQASGFTFSNYWMSWVRQSPGKGLEWVAQIGTSSSLIRYSDKVKGRFIISRDDSRSQLYLQMNNLKSEDTAVYYCAR
Vipera berus berus Vs189 ighv JTGP01207041.1 28 VHSTVQLVESGPGTVSPGGSFRLTCKVTGDSVKKVYWEWVRQAPGKGLEWVGQIDWYNDNWRIYYASSLQSRTSLSADDSRNEYYLTMSSLTAADSATYYCARR
Vipera berus berus Vs188 ighv JTGP01207036.1 690 FFLGVQSEVQLVESGGDVRKPGESLRLFCQASGFSIGGYGMSWVRQAPEKGLEWVAYIYSSYIYYSDKVKGHFTISKYDAANQLYLQMNSLKAEDTAVYYCVR
Vipera berus berus Vs187 ighv JTGP01207032.1 2170 VQSEVQLVESGGGVRRPGESLRLSCQASGFTFSSYFMGWVRQAPGKGLEWVAHLWTSHIYYSDKVKGRFTISRDDAKSQLYLQMNNLKAEDTAVYYCVR
Vipera berus berus Vs186 ighv JTGP01207030.1 152 AQSEVQLVETGGDVRRPGGSLHLSCQASGFTFSSHWMNWVRQAPGKGLEWVARMRYDAAYIYYSDKVKGRFTISRDNAKSQLYLQMNSLRAEDTAIYYCAR
Vipera berus berus Vs214 ighv JTGP01239096.1 126 IKCSVQLEQSGSYVKRTGESLSLSCKGSGFNFGSYGMHWVRQAPGKGLEWIAVIWYDGSKQVYAESVKGCFTISRDNAKSLVYLQTNSLKTEDMAVYYCTK
Vipera berus berus Vs455 ighv JTGP01226307.1 6382 VQTDVQVVESGGDVRRPGQSLTLLCQTSGFNFNVFWMNWLRQYPGKDLEWVGRITTGSPPTAYYRDKVKGRFTMSRDDSHTRVYLQMNNLKPEDSAVYYCAR
Vipera berus berus Vs352 ighv JTGP01144113.1 566 VRSQVQLVESGGDVRRPGESLRLSCQASGFTFTSYSMSWVRQAPGKGLEWVAYIYPDSSEKFYSDKVKGRFTVSRDNAKSQMYLQMNSLKAEDTAVYYCAR
Vipera berus berus Vs102 iglv JTGP01072565.1 153 IDGQSTWTQPPSSSVSLRGSIRITCTTSQSSYSIGWYQQKEGNGPHFVHCDGCSRGEGIPNRFTATRSGSTGSLAITDVEAEDEATYYCGTW
Vipera berus berus Vs101 iglv JTGP01072563.1 128 IDGQSTWTQPPSSSVSLRGTITITCITTQSSYSIGWLQQKEGNGPRFVHCDGCSRGDGIPNRFSATRSGSTGSLAITDVQYEDEGIYFCGSWNSAGNA
Vipera berus berus Vs100 iglv JTGP01072561.1 3133 IDGQSTWTQPPSSSVSLRGTITITCKTQSSYSIGWLQQKEGNGPRFVHCDGCSRGEGIPDRFTATRSGSTGSLAITDVQAEDEAIYYCGSWNSAGNA
Vipera berus berus Vs459 ighv JTGP01235254.1 538 VRSQVQLVESGGDVRRPGGSLRLSCQASGFTFSSYYMHWVRQSPGKGLEWVARIGTSSSPIRYSDNVKGRFTISRDDAKSQLHLQMNSLKSEDTAVYYCAR
Vipera berus berus Vs458 ighv JTGP01235253.1 2057 VRSQVQLVESGGDVRRPGGSLRLSCQASGFTFSSYWMEWVRQSPGKGLEWVADIGTSSSALRYSDKVKGRFIISRDDSRSQLYLQMNNLKSEDTAVYYCA
Vipera berus berus Vs208 ighv JTGP01235606.1 75 VQSQVQLVESGGDVRRPGGSLRLSCQASGFTFSDYWMSWVRQAAGKGLEWVATIRTGSSPSTHYSDKVKGRFTISRDDAKSQLYLQMNSLELEDTAVYYCTR
Vipera berus berus Vs204 ighv JTGP01235468.1 22 VQSQVQLVESGGDVRRPGGSLRLSCQASGFTFSSSYMHWVRQAAGKGLEWVSQIYPRSSSIYYSDKVKGRFTTSRDDAKSQLYLQMNSLKAEDTAVYYCAR
Vipera berus berus Vs205 ighv JTGP01235469.1 2569 VRSQVQLVESGGDVRRPGGSLRLSCQASGFTFSTYWMEWLRQAPGKGLEWVAEIRTSSSPIYYSDKVKGRFTISRDDSRSQLYLQMNNLKSEDTAVYYCA
Vipera berus berus Vs206 ighv JTGP01235605.1 1302 VQSQVQLVESGGDVRRPGGSLRLSCQASGFTFSSSWMHWVRQAPGKGLEFVATILTGSSPSTHYPDKVKGRFTISRDDAKSQLYLQMNNLELEDTAVYYCTR
Vipera berus berus Vs207 ighv JTGP01235605.1 3379 VRSQVHLVESGGGVRRPGESLRLSCQASGFTFSTSWMQWARQAPGQGVEFVATILTGSSPSIYYPDKFKGRFTISRDDARSQLYLEMRNLKPEDTAVYYCV
Vipera berus berus Vs203 ighv JTGP01235464.1 17 VQSQVQLVESGGDVRRPGGSLRLSCQASGFTFSDYHMNWVRQAPGKGLEWVSYITYNSGNIYYSDKVKGRFTISRDNAKSQLYLQMNSLKAEDTAVYYCAK
Vipera berus berus Vs34 ighv JTGP01035112.1 900 GLSQIVLTQSDPVLKKPGESHKLTCAATGFNVNSYYMGWIRQKPGQGLEWLVYYYSSSTNYYSPTIQGRFAASKDSSNFYLQMNNLKAEDTAVYYCTR
Vipera berus berus Vs35 ighv JTGP01035114.1 283 CYSEVKLVETGGGVVVPGGSLRLTCKASGFNFTNYAMDWIRQSPGKGLEWVARVSQPKGTSQWYNSKVEGRFTVSRDNSQTSAYLQMNNLKPEDSALYYCT
Vipera berus berus Vs36 ighv JTGP01035123.1 421 GFSQIVLTQSDPVLKKPGEAHKLTCAVTGFNVNSYWMGWIRQKPGQGLEWLVLYYDTRNTIFYSPTIQGRFTPSKDSSNFYLQMNNLKAEDTAVYYCAR
Vipera berus berus Vs37 trbv JTGP01037886.1 14636 FIGLCHGVTVTQKERFQTIQAGTQVDIPCEHDDSSYLLIHWYRQELNSGQTELKLIGYSIQGNSPTMENENFNIYRPNVTHASLRIPPDEAAKPAIYFCAVSQ
Vipera berus berus Vs32 ighv JTGP01035103.1 20 CHSEVQMIQSGGGIKATGGSLTIVCKTSGFGFTNYYMSWVRKQPEEGLEWLCRMPSVGTNPWYNPAIAGRFIQTRDNAKASTTLQLNDLKLEDSAVYYCTR
Vipera berus berus Vs33 ighv JTGP01035109.1 265 IQLVESGPGLVRPGSQLNLVCKVTGFSIATSSSYAWHWIRQPNGKGLEWLAAINVNSGGKWYGNSVKGRATISADQSRNEFSLQLNSVLAADSSVYFCARE
Vipera berus berus Vs39 trav JTGP01038328.1 5248 WISISQVTQTPVYLDLKEGDRVTITCKNNTAYSYYSWYRQVPRMPLSYLLSISSSKNITEKGYTAEYLDNGQRSCLHLPSSLLQDSGTYFCAVN
Vipera berus berus Vs198 iglv JTGP01227827.1 476 VTSQSVVSQPPSASVSSGNTAKLACILGSGVSIGSYRIRWYQQKPPSSPRFLLHYHTDSDKGQGSGVPSRFSGSKETSTNTGYLTISGVLAEDEAVYYCNIWYS
Vipera berus berus Vs199 ighv JTGP01229301.1 637 ASSEVQLVESGGALRRPGESLHLSCQGFGFTFSNSYMGWVRQAPGEGLKWVSYINPSSSSIWYSDKVKDRFTASRDNAKSQLYLQMNSLQTEDTAVYYCTK
Vipera berus berus Vs447 ighv JTGP01218922.1 531 VRSQVQLVESGGDVRRPGESLRLSCQASGFTFSSYSMGWVRQAPGKGLEWVAYIYHDSSRKFYSDKVKGRFTVSRDNAKSQLYLQMNSLKAEDTAVYYCTR
Vipera berus berus Vs448 ighv JTGP01218927.1 7307 VRSEVQLVESGGDVRRPGGSLHLSCQASGFTFSSYAMVWVRQAPGKGLEWVAYVCTGSSPIYYSDKVKGRFTISRDDAKSQTYLQMNSLKAEDTAVYYCAR
Vipera berus berus Vs449 ighv JTGP01218927.1 2776 VRSEAQLVESGGDVRRPGQSLRLSCQGSGYRFGDYNMDWVRQIPGKGLEWVAYINYLSNTIYYSDKVKGRFTISRDNAKSKLYLQMNSLKPEDMTVYYCTR
Vipera berus berus Vs349 ighv JTGP01144103.1 2342 VQSQVQLVESGGDVRRPGGSLHLSCQASGFTFSSYAMHWVRQAPEKGPEWVASIDTGSGAYYSDKVKGRFTISRDNAKSQLYLQMSSLKAEDTAVYYCAR
Vipera berus berus Vs358 ighv JTGP01144116.1 1370 VWSQDRLVAYGGGMKNVGQYHSIYCQVSGFIMEFAYSEMNWMRLVPGKGLEWVARIFSDSSGKSYSQKVKGRFAITRHNTQRQLGLQISNLKPEDSGVYYCT
Vipera berus berus Vs348 ighv JTGP01144103.1 4096 VQSQVQLVESGGDVRRPGGSLRLSCQASGFTFSDYFMSWVRQVPGKGLEWVAQIDVTSTYYSDKVKGRFTISRDNAKSQLYLQMNSLKAEDTAIYYCA
Vipera berus berus Vs52 trav JTGP01038354.1 543 TSQSDSVSQSQNNVEIREGEDAILPCDFKTLSSNPYLFWYRQYGNQRPERILTAYRYENNHFQEGKFSTTLVLGSQNSVPLNIRSVSLLDGAVYFCALN
Vipera berus berus Vs51 trav JTGP01038348.1 667 PSAEDTVEQISRPLSVSEGNPFSIQCSYEADWSVTNNPFWYIQLPGQAPRFFLSESKGHNQGFQASHLLGESKRKGTFNLKKATSQLNDSALYLCA
Vipera berus berus Vs367 iglv JTGP01145566.1 23008 VTSQPTLTQPVTQSGSPGGTVKLSCGISSNPNTIYWLQQKSGEAPRFVHCDGCSRGPGIPDRFTGTRSGNNGYLTITSLQPEDEADYYCYMWYSSGSV
Vipera berus berus Vs366 ighv JTGP01144128.1 741 VQSQIQLMESGGDVRRPGESLHLSCQASGFTFSSHSMCWVRQAAGKGLEWVSHIDTTTTYYSDKVKGRFTISRDNAKSQLYLQMSSLKAEDTALYYCAR
Vipera berus berus Vs365 ighv JTGP01144126.1 4637 VHSTVQLVESGPGTVSPGGSFRLTCKVTGDSIKNAWWEWIRQAPGKGLEWVGQIDWDGSKWRIYYASSLQSRTTLSADDSRNEYYLTMSSLTAADSAIYYCARR
Vipera berus berus Vs364 ighv JTGP01144125.1 3492 VQSQVQLVESGGDVRRPGGSLRLSCQASGFTFSSYDMGWVRQAPGKGLEWVSSIYTDSSGKFYSDKVKGRFTISRDNAKSQLYLQMNSLKAEDTAIYYCAR
Vipera berus berus Vs363 ighv JTGP01144124.1 1429 VKSQVQLVESGGDVRRPGESLRLSCQASGFTFSSYYMGWARQYPGKGLEWVADIGRSSSPTRYSDKVKGRFTISRDDAKSQLHLQMSNLKLEDTGVYYCVR
Vipera berus berus Vs362 ighv JTGP01144123.1 1945 VQSEDQFLESGGDVRRPGESLHLSCQGSGFTFSSYGMHWVRQAPGKRLEWFAWIFTDSSSIFYSDKVKGRFTVSRDNAKSQLYLQMKSLKAEDTAVYYCTRNPV
Vipera berus berus Vs361 ighv JTGP01144121.1 1571 VRSEVQLVESGGDVRRPGQSLRLSCQGSGFTFSDAYMHWVRQAPGKGLEWVAYINKASSTILYSDKVKGRFTISRDNAKSQLYLQMNSLTAEDTAVYYCAG
Vipera berus berus Vs360 ighv JTGP01144120.1 1072 VKSQVQLVESGGELRKPGESIRISCHGSGFTMRDYWMNWVRQAPGKGLEWLGRMGTSTIQYSDKVKGRFTISRDDSRSQLYLQMNNLKPEDMAVYYCAR
Vipera berus berus Vs369 iglv JTGP01145566.1 19072 SPLVNQPQSTSVPLGQNIQITCMGNNMHANRQQWFQQQPGKTPKLIIYSGATRPTGISERYSGSVTGNTAVLSIAKAQAEDEAVYFCLLWWD
Vipera berus berus Vs98 iglv JTGP01072560.1 1894 IDGQSSWTQPPSGTVSLGGMITLSCSTQSTDAIRWFQQKSGKGPRFVHCDGCSSRGEGIPNRFTATRSGSTGSLAITDVQAEDEADYYCGSW
Vipera berus berus Vs99 iglv JTGP01072561.1 1013 PSLQQLQALKDPEFVALGRTVTLSCRYDGGNLGDGNYPWWSQQISENRPRTLIYTTSTRPSGVPERFSGSRSGNVMSLTITGALAEDEATYYCCVWTGSQ
Vipera berus berus Vs93 iglv JTGP01072553.1 952 VTTISLLQPVSVLASLGSATQISCTLSGGTMATYTISWFQHQQPNPPKYLLYYKDGSNQRRKTGVSDRFAASKDASLNACYLTISGVQAADEGTYYCLASTGSE
Vipera berus berus Vs96 iglv JTGP01072556.1 2991 PSLQQLQALKDPEFVALGQTVTLSCGYDGGNLGDGNYPWWSQQISENRPRMLIYATSSRPSAVPERFSGSRSGNVMSLTITGALAEDEATYYCCVWTGSQ
Vipera berus berus Vs97 iglv JTGP01072556.1 7798 IDGQSTWTQPPSRSVFLGETITISCTTTQSSWAIGWYQQKEGNGPRFVHCDGCNSRGEGIPNRFTATRSGSTGSLAITDVEAEDEATYYCGSWNAAVTQ
Vipera berus berus Vs94 iglv JTGP01072554.1 60 SFFAGAFSQAQVTQNGPVSVGIAGTTVLTCALQGVEFISPTNPSWYQHKEGKSPRLLIYRSRERASGTPQRFSADTYGNTAKLTISSVEVGDEGDYYCAV
Vipera berus berus Vs95 iglv JTGP01072556.1 159 ALAQFTMTQPPSVSASRGETVSISCTREGGSISSYYVSWYQQKPDTKPLLVIYKDTNRPSGIPERFSASLDSSSNSATMSISSVQPEDEADYYCLSYDSSSQ
Vipera berus berus Vs347 ighv JTGP01144103.1 6032 VQSQGQLVESGGDVRRPGESLHLACQGSGYNFGGYSMNWVRQAPGKGLEWVAGIYHDSSGKFYSDKVKGRFTISRDNAKSQLYLQMSSLKAEDTAVYYCT
Vipera berus berus Vs212 ighv JTGP01238261.1 1132 VHSQVQLVESGGDVRRPGESLSLSCKGSGFTFGSYGMDWVRQAPGKGLEWIAGIWYDASKEVYAESVKGRFTISRDNAKSQFYVQMNSLKPEDTAIYYCAR
Vipera berus berus Vs371 iglv JTGP01145566.1 9374 SSSQPTVIQESSMSPSRGETVKLSCSLSSGQVTSYDQSWYQQKEGGPPRFLYRYYSSASAGSGDLSRFSASKESNQNKWYLTIRDVQGEDEANYYCAVW
Vipera berus berus Vs372 iglv JTGP01145567.1 2771 VTSQPTLTQPASQSGSPGGTVKLSCAISSNPNTILWLQQKSGEAPRFVHCDGCSSRGPGIPDRFTGTRSGNNGYLTITSLQPEDEADYYCLMWYSSGGV
Vipera berus berus Vs373 iglv JTGP01145567.1 625 INSQPTLTQPASQSGSPGGTVKLSCAISSNPHAIVWFQQRSGEAPRFVHFDGYIYRGPGFTNRFTGTRSGNNGYLTITNLQPEDEADYYCSMWYNNV
Vipera berus berus Vs374 iglv JTGP01145568.1 5158 VNSQPAWIQPTSTSVSLGQTAKISCTVSGTVNTIAWYQQRSGQVPRYVHRSGGSRGDGIPDRFTASVSGSIGYLTITGIQAKDEADYYCAMWHSSASS
Vipera berus berus Vs375 iglv JTGP01145569.1 9224 ASAQFVLTQPASVAAALEGKVQISCTRSSGAMSGYYVSWYQQKSIEPPKLLIYQHMYRPADIPDRFSGATDSSRATLTITGVQPEDEAKYYCQSYDSNWM
Vipera berus berus Vs376 iglv JTGP01145571.1 1372 TFSQFVLNQPASVSGSLGERVQITCSQSSGTIGTGYSSWYQQKSGSAPKLLIYADSGRASGIPARFSGSVEGSRTSAMLSISNLEAEDEADYFCAAYTGSGS
Vipera berus berus Vs377 iglv JTGP01145572.1 3486 ASIQQLQSLKDPDFVAPGGTITMSCRYEGGTLTDINYPRWIQQKSERVRRLLIYSTSRRPTGVPARFSGSRSGNIMSLTIMEALVEDEATYYCLVWIGDG
Vipera berus berus Vs378 iglv JTGP01145572.1 1242 TFSQFVLNQPASVSGSLGERVQITCRQSSGTIGTSYSSWYQQKSGSAPKVIIYFDSSRASGIPARFSGSVESSRTSAVLTISNLEAEDEAIYFCAAYTGSSS
Vipera berus berus Vs379 iglv JTGP01145573.1 13705 LSVQQLKNLKDPELVAPGETAVLSCSYSAGTITDNNYPLWIQQKQEEVPRLLIYATSTRASGTPARFSGSKSANTMSLIITESQVEDDASYYCVVWSGSG
Vipera berus berus Vs462 trbv JTGP01242657.1 3259 EQVLLTQKPAWISGQLGDQIQMNCQQNNTDHNWMYWYRQTAAKRQLELIGYIVKGAPQATYEDGFEKQRFEIQQKHSKHCSLQINKMSSEDSAVYFCASS
Vipera berus berus Vs311 ighv JTGP01109959.1 2832 VFPNVQLSQSLFKTQGPGQSVKLICAVSGVEVDGWFWGWNRKCPGKSLEWLGGIKSTNNGGEAYYNSRFNNHIVITRDTSKNEFYLELRSLAPADIGVYFCA
Vipera berus berus Vs154 ighv JTGP01147869.1 1410 VSATVTLSQPPEAFALPGRSITLTCKVSGYNISHHHLNWVRQSNGKELVFITAFRTGFTTYTANEFKGRVTPSTQGSTAQLRIDALKVDDTAIYYCA
Vipera berus berus Vs155 ighv JTGP01147888.1 1830 VELQKILTQPTSEIKLPGETLTLTCNGISSFLSSWIQWTYKIGDEGITWIGESNPDGSRSSVRQSLRDRFAISRDNSRDIASLEIRQLKVGDSGLYYCS
Vipera berus berus Vs454 ighv JTGP01226307.1 12335 VQSQVQLVESGGDVRRPGGSLRLSCQASGFTFSSFWMHWVRQAPGNGLEWVATIRYDSQEIYYLDKVKGRFTISRDNAKSQLYLQMSSLKAEDTAVYYCAR
Vipera berus berus Vs389 ighv JTGP01145918.1 3820 CHSQVQLVVTGGGIAAPGGSLRLTCKASGYTFTSYNIQWFQQAAEKELEWVAGLDISGSSKWYNSKVTGRFTISKDNSQSSVYLQMNSLKTEDSALYYCARE
Vipera berus berus Vs388 ighv JTGP01145916.1 1712 CHSAVQLLENGGGAVAPGGSLHLTCKASGFNFAGYSMAWFRKAHEKGLEWVASIHSNGANQWYNSKVNGRCTIYRDNFQSFLYLGMNSLKAEDSALYYCVT
Vipera berus berus Vs385 iglv JTGP01145574.1 4122 PSLQQLQTLKDSEFVAPGGTVTLSCRYDGGNLGDSHEPSWSKQIAGQQPQGLIYHTTSRLSGVPERFSGSRSGNVMSLTITGALVEDEATYYCSIWTNSQ
Vipera berus berus Vs384 iglv JTGP01145573.1 2295 SFSQVLTQPESVAGSPGGTIRITCTKSSGTIGTGYSSWYQQKPGSPPKLLIYADSSRASGIPARFSGSVENSRTSAVLSISSLEAEDEADYYCLVYLGGGQ
Vipera berus berus Vs387 ighv JTGP01145913.1 4281 VQLIKLEESGGAVRIPGESLRLSCQASGFTFSSYWMSWLRQAPGKGLEWVARISTGSSNTYYPNNVKGRFIISRDDSNSLLYLQMNNLKPEDTAVYYCVR
Vipera berus berus Vs386 iglv JTGP01145576.1 1729 IDGQSTWTQPPSSSVSLRGTITITCTTQSTNSIGWYQQKEGNGPRFVHCDGCSRGEGIPNRFTATRSGSTGSLAITNVEAEDEADYYCGSWNSAGNA
Vipera berus berus Vs381 iglv JTGP01145573.1 10227 ASIQQLQSLKNSDFVAPGGTITMSCRYGGGIITDNNFPVWVQQKSEQIPRLLIHSTSARNTGVPARFSGSRSENTMSLTITGALVEYEATYYCAVWIGSG
Vipera berus berus Vs380 iglv JTGP01145573.1 12015 LSLQQLQSLKDPESVPLGGTVTISCRYSTGIITDNNYPWWVQQHPGKPPRLLVYQTSVKPSGVPARFSGSKSGNVMSLTITGALAEDEANYYCSLNPGGS
Vipera berus berus Vs382 iglv JTGP01145573.1 7460 LSLQQLQSLKDPESVPLGRTVTLSCRYSTGIITDNNYPWWVQQHPGKPPRLLVYQTNVKPSGVPARFAGSKSGNMMSLTITGALAEDEAIYYCS
Vipera berus berus Vs323 ighv JTGP01126179.1 2265 VQMEVQLVESGGGVRRPGESLRLSCQASGFTFSSYQMVWVRQAPGKGLEWLAWIDNPGDGNTQYYANSVKGRFTISRHDASSMLYLQMNSLKPEDTAVYYCARD
Vipera berus berus Vs322 ighv JTGP01126175.1 1604 VQMVVQLVESGGGVRRPGESLRLSCQASGFTFRSYEMNWVRQVPGKGLEWVAWIDDNGYGSSQYYANSVKGRFTISWHNASRMVYLQMNNLKPEDSAAYYCARG
Vipera berus berus Vs321 ighv JTGP01126156.1 706 VLSNIQFIESGPAVVRPGDVLNLVCKVTGVFISVPNEWHWMRKPRGKGLEWVSAINVNSGGKWYAASVKNQATISADETRNEFYLQINSVTAADSSLYFCTRL
Vipera berus berus Vs327 ighv JTGP01126186.1 1450 VQSEVQLVESGGEVRRPGESLRLSCQASGFNFGGSNMNWVRQAPRKGLEWVAWIQSDGGATYYLDKVKGRFTISRDNAKSQLYLQMNSLKAEDTAVYYCTR
Vipera berus berus Vs326 ighv JTGP01126183.1 803 VQMEVQLVESGGDVRRPGETLRLSCQASGFTFSSYEMAWVRQAPGKGLEWVAWIEDDGDGSSQYYANSVRGRFTISWHDASSMLYLQMNNLKPEDTAVYYCAR
Vipera berus berus Vs325 ighv JTGP01126180.1 517 VQSEVQLVESGGDVRRPGQSLRLSCQGSGYNFGGYSMDWVRQAPGKGLEWVAYINSASSTVYYVDKVKGRFTISRDNAKSQLYLQMNSLKAEDTAVYYCT
Vipera berus berus Vs324 ighv JTGP01126179.1 321 ASSEVQLVESGGALRRPGESLHLSCQGFGFTFSNSYMGWVRQGPGEGLKWVSYINPSSSSIWYSDKVKDRFTTSSDNAKSQLYLQMNSLQTEDTAVYYCTK
Vipera berus berus Vs329 ighv JTGP01126192.1 920 VQMEVQLVESGGGVRRPGESLRLSCQASGFTFSSYEMVWFRQAPGKGLEWVAWIDNPGDGSSHSYANSVKGRFTISRRDASSMLYLQMNSLKPEDTAVYYCAGE
Vipera berus berus Vs328 ighv JTGP01126190.1 398 VQTEVQLVESGGGVRRPGESLRLSCQASGFTFSSYEMNWVRQAPGKGLEWVAWIDNPGDGNTQYYANSVRGRFTISRHDASSMLYLQMNSLKPEDTAVYYCARQ
Vipera berus berus Vs353 ighv JTGP01144114.1 3988 VRSEVQLVESGGDVRRLGGSLRLICQASGFTFSSHGMHWVTLSPGKGLEWVAYISTASSSIYYSDKVKGCFTISRDDAKNQLYLQMKRLKAEDTAVYYCAR
Vipera berus berus Vs396 ighv JTGP01148147.1 2342 TSSQITLTESGGGLKKPGGTLQLTCAVSGFAITSYGVLWIRQAPGKALEWNGVIWGGGSTDYNSALQNRITITRDTSKNQVFLQLTGLKTEDSGTYYCA
Vipera berus berus Vs397 ighv JTGP01148149.1 5717 ALSQITLTQSSPVIKNQGESLQIKCSITGFDIYNHYMQWSMKQPGNPLKWLVHYRIPKYSVYSPTIQGRFTASKDSSNFYLQMNDLKVEDTAVYYCTSTI
Vipera berus berus Vs394 ighv JTGP01148128.1 6098 TSSQITLTESGGGLKKPGGTLQLTCTVSGFAITSYGVSWIRQPPRKGLEWNGIIWGGGSTNYNSALQNRITITRDTSKNQVFLQLTGLKTEDTGIYYCA
Vipera berus berus Vs395 ighv JTGP01148128.1 1607 VHSTIQLVESGPGRVSPGGSFKLTCKVTGETIDNVYLAWIRQAPGKGLEWVGDIAWVNDEWSTDYASSLQSRTTLTADENKNECYLTMSSLTAADSATYYCAGE
Vipera berus berus Vs393 ighv JTGP01148127.1 596 ALSEVQLVETGGDVRRPGGSLRLSCQASGFTFSNYYMGWVRQAPGKGLEWVASIYSSSIYYSDKVKGRFTISRDDAKSQLFLQMNSLKVEDTAVYYCARD
Vipera berus berus Vs390 ighv JTGP01145918.1 1374 CHSQVQLVETGGGIVALGGSLRLSCKASGFSFTSYHMHWFRQAAEKELEFVAGLDISGSSKWYNSKVTGRFTISRDNSQSSVYLQMNNLKAEDSALYYCARE
Vipera berus berus Vs391 ighv JTGP01145924.1 1232 CNSQVQLVETGGGTVTPGGSLSLSCKASGFTFTCCEMHWVRQAPEKGLEWVAGLSSSGSSKWYNSKVSGRFTISRDNSKSSVYLQLNNVKTEDSALYYCA
Vipera berus berus Vs132 ighv JTGP01112648.1 3447 CFSDVQLVSSGPETVRPGQTLNLLCKVTGVSITSSTYAWNWVRQPPGKGLEWIARIYPHDGRKWFSSSLQSRTTITSDNSKNEYSLQLTSMSTSDTAMYYCARD
Vipera berus berus Vs133 ighv JTGP01112649.1 615 SLSDVQLVSSGPETVRPGQNLNLLCKVTGYSITNSNYAWSWVRQPPGKGLEWIARIYPNNGNRWFSSSLQSRITIASDNSKNQFSLQLNSLSAADSAIYYCARE
Vipera berus berus Vs131 ighv JTGP01112647.1 2334 SLSEVQLVSSGPETIRPGQTLNLLCKVTGVSITSSSYLWNWVRQPPGKGLEWIARIYPHDGRKWFSASLQSRTTITSDNSKNEYSLQLTSMSTSDTAMYYCARD
Vipera berus berus Vs330 ighv JTGP01126193.1 3034 VQSEVQLVESGGDVRRPGESLHLSCQCSGYNFGGYDMNWVRQAPWKGLEWVSYISYNSGSIHYSDKAKGRFTISRDNAKSQLYLQMNSLKAEDTAVYYCMR
Vipera berus berus Vs331 ighv JTGP01126193.1 837 VQSEVLLVESGGDVRRPGGSLRLSCQASGFNFGSSNMNWVRQATGKGLEWVAYISYNSGSIHYSDKVKGRFTISRDNAKSQLYLQMNSLKAEDTAVYYCAR
Vipera berus berus Vs357 ighv JTGP01144116.1 3713 VRSQVQLVESGGDVRRPGGSLRLTCQGSGFTFSGAYMHWVRQAPGKGLEWVAYISTGSSPIYYSDKVKGRFTISRDDAKSQMYLQMNSLKAEDTAIYYCAGD
Vipera berus berus Vs56 trav JTGP01038359.1 260 TSQSDSVSQKQDNMEVVEGEDATLPCDFKTLSSTPYLYWYRQYKHQRPERILTAHKYGNNPFQEGKFSTTLVLGNQNSVPLNIGSVSLLDGAVYFCALN
Vipera berus berus Vs54 trav JTGP01038357.1 1446 TLLCQAEKPIQEPVLEASNGRKAELSCSHPNIQSNEHILWYRQFPSQPPDFIARGYKEPSESNVGERIFLVVDHNRKNSTLSFTKVTFEDQALYFCALG
Vipera berus berus Vs55 trav JTGP01038357.1 3773 TSQSDSVSQTQKNMEIQEGEDGILPCNFTTLDSNPYLFWYRQYGNQRPERILTAYKARSRNNHFREGKFSTTLVFGNQNSVSLNIGSVSLLDGAVYFCALN
Vipera berus berus Vs222 ighv JTGP01260016.1 1190 VQMEVQLVESGGGVRRPGESLRLSCQASGFTFSSYEMVWVRQAPGKGLEWVAWIDDNGDGSSQYYANSVRGRFTISRHDASSMLYLQMNSLKPEDTAVYYCARD
Vipera berus berus Vs53 trav JTGP01038355.1 1504 THFCQAEKPVQEPLLEALNGRKINLLCSHPNIKTSEYIYWYRQFSNQPPHLIASGFQGTLETNEGERVSLIIPKERKNSTLSFTKVTSEDQALYLCGVG
Vipera berus berus Vs50 trav JTGP01038346.1 497 GSTGQSVKQTSGIVTVTEGESVFLNCSYETTFSDTFFTFWYVQSPGGSLRFLLASYWNNSQGFQAVHIPHESQQKGTFNLQRHGSQLKDSAAYFCSFSGFKALR
Vipera berus berus Vs221 ighv JTGP01258456.1 508 VQSQVQLVESGGDVRRPGGSLRLSCQASGFTFSSINMHWVRQAPGKGLEWVAFINTASGTYYSDKVKGRFTISRDNAKSQLYLQMNSLKAEDTAVYYCMR
Vipera berus berus Vs345 ighv JTGP01144102.1 3527 VQSQVQLVESGGDVRRPGGSLCLSCQASGFPFSSYGMHWVRQSPGKGLEWVASINTDSGASYSDKVKGRFIISRDNAKSQMYLQMNHLRSGDTTVYHCSG
Vipera berus berus Vs58 trav JTGP01038361.1 1670 KSTGQTVTQTEGRLIITEGQPVFLNCTYDQSVDYQPSPFWYIQYLGQPPKLFKSIFSIPNLDTSLPQNFRAMHNKAGKTFNMKKSISQLHDSATYFCALK
Vipera berus berus Vs346 ighv JTGP01144102.1 721 VQSQEQLVESGGDVRKPGESLDLSCQASGFTFRSYHMDWVRQAPGKGLEWVARIYTDSSGKFYSDKVKGRFTISRDNAKSQLYLQMHSLKAEDTAVYYCAR
Vipera berus berus Vs464 ighv JTGP01245790.1 1095 VHSTVQLVESGPGTVSPGGSFRLTCKVTGYSIKNALWEWVRQAPGKGLEWVGQIDWDGSKWRIYYASSLQSRTTLSADDSHNEYYLTMSSLTAADSAIYYCARR
Vipera berus berus Vs200 ighv JTGP01229304.1 774 GGVQLEIPGGGVRRPGESLRLSCQASGFTFSSYEMNWVRQAPGKGLEWVAWIDDNGDGSSQYYANSVKDRYTISRHDASSMVYLQMNNLKPEDRASYYCARG
Vipera berus berus Vs368 iglv JTGP01145566.1 20949 VTSQPTLTQPASQSGSPGGTMKLSCGISSNPNTIFWLQQKSGEAPRFVHCDGCSRGPGIPDRFTGTRSGNNGYLTITSLQPEDEADYYCYMWYGSGGV
Vipera berus berus Vs370 iglv JTGP01145566.1 17553 SFAQYVLTQPSSMSVSLGQNGRITCSGNGIVSKSVHWYQQKPGNPPVLIIYDDNSRPTGISDRFSGTNSGNPATLSISRAQAQDEAVYYCQVWDSGQ
Vipera berus berus Vs383 iglv JTGP01145573.1 4583 ASFQQLQSLKNSESVAVGGTLTMSCRYSGGIISDNNYLRWLQQKPGEVLRLLVATSNSRPTGVPTRFTGTTSGNTMSLTIAGTLGEDEATYYCAVWTGSG
Vipera berus berus Vs57 trav JTGP01038359.1 741 ILLCHAEKPDQEPLLEALNGRKTNLSCSHPNIQINEYIFWYRQFPNQPPHFIATGYKAISKSNEVEHISLVVADDRKTSTLSFTKVTLQDQALYLCCIR