WGS Statistics
Organism WGS Record. Vs Total IGHV IGLV IGKV TRAV TRBV TRGV TRDV
Pongo abelii ABGA00000000.1 (ABGA01) 262 72 31 42 43 61 9 4
Pongo abelii NDHI00000000.3 (NDHI03) 0 0 0 0 0 0 0 0
Vgene Table
Organism Vgene Locus contig Contig Pos. AA sequence
Pongo abelii V566 trbv ABGA01378070.1 11168 LMEADIYQTPRHRVIRTGKKITLECSQTMGHDKRYWSRSRNGITPHPLFLWVNSTEKGDLSSESTVSRIRIQHFPLTLESASPSHTSQYLCASSE
Pongo abelii V32 ighv ABGA01025787.1 2057 TYSQVQLVQSGHEVKQPGASVKVSCKDSGYSFTTYGMNWVQQAPEQGLEWMGWFNTDTGNPTYAQGFTGRFVFSMDTSVSTAYLQISSLKAEDTAMYYCAR
Pongo abelii V33 ighv ABGA01025790.1 838 VQCEVQLVESGGGLVQPGGSLRLSCAASGFTSSDYQMYWVRQASGKGPEWVGYIGSKSNSYATAYAASVKGRFTISRDDSKNTLYLQMNSLKTEDMAVYYCAR
Pongo abelii V34 ighv ABGA01025791.1 3903 VQCEVQLVESGGGLVQPGGSLRLSCAASGFTFSSYWMSWVRQAPGKGLEWVGFIKNKADGGTTDYAASVKGRFTISRDDSKNTLYLQMNSLKTEDTAIYYCAR
Pongo abelii V35 ighv ABGA01025791.1 14223 VLSQVTLKESGPALVKPTQTLTLTCTFSGFSLSTSGIGVGWIRQPLGKAMEWLAHIYWTDSKYYSSSLKSRLTISKDTSKSQVVLIMTSMDPVDTATYYCARI
Pongo abelii V36 ighv ABGA01025797.1 8417 VQCEVQLVESGGGLVQPGGSLRLSCVASGFTFSSYAMRWVHQAPGKGLEWVSAISGSGGSTWYPDSVKGRFTISRDNAKNTLYLQMNSLRAEDTAVYYCVR
Pongo abelii V37 ighv ABGA01025808.1 3706 VQCEVQLVESGGGLVQPGGSLRLSCAASGFTFSSSAMHWVRQAPGKGLEWVGRIRSKANSYATEYAASVKGRFTISRDDSKNTAYLQMNSLKTEDTALYYCTT
Pongo abelii V38 ighv ABGA01025808.1 11418 LQCEVQLVESGGGLVQPGGSLRLSCAASGFTFSDHYMDWVRQAPGKGLEWVARIRNKANSYTTEYAASVKGRFTISRDDSKNTLYLQMSSLKTEDTAVYYCAR
Pongo abelii V39 ighv ABGA01025808.1 27675 VQCEVQLVESGGGLVQPGGSLRLSCAASGFTFRDHYMNWVRQAPGKGLEWVSAISGSSSSTYYADSVKGRFTISRDNAKNTLYLQMNSLRAEDTAVYYCVR
Pongo abelii V40 ighv ABGA01025808.1 39513 VQCEVQLVESGGGLVQPGGSLRLSCAASGFTFSNYYMSWVRQAPGKGLEWEGFIKNKTNGGTTEYAASVKGRFTISRDDSKSITYLQMSSLKTEDTAVYYCTR
Pongo abelii V41 ighv ABGA01025808.1 52103 VQCELQLVESRGDLVQPGGSLRLSCAASGFTFSSYGMNWVCQAPGKGLEWVSVISRSSGTIHYADSMKGRFTISRDNAKNSLYLQMNNSLRAEDTAVYYCVK
Pongo abelii V42 ighv ABGA01025808.1 56692 VFSQVTLKESGPALVKPTQTLTLTCTFSGFSLSTSGVGVGWIRQPPGKALEWLASIDWDDDKYYSPSLKSRLTISKDTSKNQVVITMTNMDPVDTATYYCARI
Pongo abelii V43 ighv ABGA01025808.1 65730 VQSQVQLVQSGAEVKKPGSSVKISCKVSEDTFSSYAISWVQQAPGQGLEWMGGIIPVLGTADYAQKFQGRVTITADTSTSTAYMELSSLRSEDTAVYYCAT
Pongo abelii V44 ighv ABGA01025810.1 7177 VQCEVQLVESGGGLVQPGGSLRLSCAASGFTISSYDMHWVHQAPGKGLEWVSAISTGGGTYYADSVKGRFTISRDNAKNTLYLQMNNLRAEDTAVYYCAK
Pongo abelii V59 ighv ABGA01037228.1 1416 VLSQVQLQESGPGLVKPSETLSLTCAVSGGSISSGYYWGWIRQPPGKGLEWIGSIYYSGSTYYNPSLKSRVTISVDTSKNQFSLKLSSVTAEDTAVYYCAR
Pongo abelii V72 ighv ABGA01044302.1 5172 VLSQVQLQESGPGLVKPSETLSLTCAVSGGSISSYYWSWIQQPPGKGLEWIGYIYSSGSTNYNPSLKSRVTMSVDTSKNQFSLKLSSVTAADTAVYYCAR
Pongo abelii V73 ighv ABGA01044302.1 9979 AHSQVQLGQSGPQVKKPESSVKVSCKASGYTFTSSAMQWVRQAPGQGLEWIGWIIVGSGNTNYAQKFQGRVTITRDTSTSTAYMELSSLRSEDTAVYYCAA
Pongo abelii V74 ighv ABGA01044304.1 6035 VLSQVQLQESGPGLVKPSETLSLTCAVSGGSISSGYYWGWIRQPPGKGLEWIGSIYYSGSTYYNPSLKSRVTISVDTSKNQFSLKLSSVTAADTAVYYCAR
Pongo abelii V75 ighv ABGA01044305.1 3519 VLSQVQLQESGPGLVKPSETLSLTCAVSGGSISSYYWGWIRQPPGKGLEWIGYIYSSGSTNYNPSLKSRVTMSVDTSKNQFSLKLSSVTAADTAVYYCVR
Pongo abelii V76 ighv ABGA01044306.1 1054 VLSQVQLQESGPGLVKPSETLSLTCAVSGGSISSNYWSWIRQPPGKGLEWIGYIYSSGSTYYNPSLKSRVTMSIDTSKNQFSLKLSSVTAADTAVYYCAR
Pongo abelii V77 ighv ABGA01044307.1 458 VLSQVQLQESGPGLVKPSETLSLTCAVSGGSISSYYWSWIRQPPGKGLEWIGGIYSSGSTYYNPSLKSRVTISVDTSKNQFSLKLSSVTAADTAVYYCAR
Pongo abelii V78 ighv ABGA01044310.1 2825 VQCEVQLVESGGGLVQPGGSLRLSCAASGFTVSSSSMIWVRQAPGKGLEWVSYISSDGSAYYTDSVKGRFTVSRDNSKNTLYLQMNSLRAEDTAVYYCAK
Pongo abelii V79 ighv ABGA01044310.1 19039 VCAEVQLVQSGAEVKRPGESLRISCKTSGYSFTSNWISWVRQMPGKGLEWMGSIYPGDSDTRYSPSFQGHVTISADKSISTAYLQWSSLKASDTAMYYCAK
Pongo abelii V80 ighv ABGA01044313.1 11043 VQCEVQLVESGGGLVHPGGSLRLSCTASGFTFGDYAMSWVRQAPGKGLEWVGFIRSKAYGGTTEYAASVKGRFTISRDDSKSIAYLQMNSLKTEDTAVYYCAR
Pongo abelii V81 ighv ABGA01044314.1 13361 VQCEVQLVESGGGLVQPGGSLRLSCAASEFTFSSNDMSWVRQAPEKGLEWVSYISNSGRTTYYADSVKGRFTISRDNAKNSLYLQMNSLRAEDTAVYYCVR
Pongo abelii V82 ighv ABGA01044316.1 6561 VQCEDQLVVSAGGLVQPGGSLRPSCAASGFAFSSYVLHWVRRAPGKGLEWVSAIGTGGDTYYADSVMGRFTISRDNAKKSLYLQMNSLIAEDTAVYYCAR
Pongo abelii V83 ighv ABGA01044319.1 4094 VQCEVQLVESEGGLVQPGGSLRLSCAASGFTFDDYAMHWVRQAPGKGLKWVSGINWNGGSTYYADSVKGRFTISRDNSKNSLYLQMNSLRAEDTALYYCAK
Pongo abelii V95 ighv ABGA01058270.1 14490 VLSQVQLQQWGPGLVKPSETLSLTCAVCGGSISSGYYWSWIRQPPGKGLEWIGYMHHSGSTYYNPSLKSRVTMSVETSKNQFSLKLSSVTAADTAVYYCAR
Pongo abelii V96 ighv ABGA01058270.1 28196 VQCEVQLVESGGGLVQSRGSLRFSCAASGFTFSSCGMNWVRQAPGKGLEWVAIIWYDGSNKYYADSVKGRFTISRDNSKNMLYLQMNSLRVEDMAVYYCAK
Pongo abelii V97 ighv ABGA01058270.1 38770 VLSQVRLQESGPGLVKPSETLSLTCAVSVDSISSGYYWSWIRQPPGKGLEWIGYIHHSGSTYYNPSLKSRVTMSVDTSKNQFSLKLSSVTAADMAVYYCAT
Pongo abelii V98 ighv ABGA01058273.1 623 VQCDVQLVESGGGLVQPGGSLRLSCAASGFTFSDYYMSWVHQPPGKGLEWVGLIRNKANGGTTEYAASVKGRFTISRDDSKSIAYLQMNSLKTEDTAVYYCTR
Pongo abelii V133 trbv ABGA01091248.1 17276 LTEAGVAQSPRYKIIEKKQPVAFWCNPISGHNTLYWYRQNLGQGPELLIRYENEEAVDDSQLPKDRFSAERLKGVDSTLKIQPAELGDSAVYLCASSL
Pongo abelii V134 trbv ABGA01091248.1 22860 HTDAGFIQSPRHEVTEMEKEVSLRCKPISGHNSLFWYRQTMMWGLELLIYFNNDTPIDDSGMPKDQFSATMPNASFSTLKIQPSEPRDSAVYFCASSL
Pongo abelii V135 trbv ABGA01091248.1 26086 AGVIQSPQHEVTEMGKEVTLRCKPISGHNSLFWYRQTMMWGLEWLIYFNNKAVIDDSGMPKDRFSAKMPNESFPTLKIQPSEPRDSAVYFCASSL
Pongo abelii V136 trbv ABGA01091248.1 29360 HTDAGVIQSPRHEVTEMGKEVTLRCKPISGHEDLFWYRQTMMQGLELLIYFNNKAVMDDSGMPKDRFSAKMPNASFSTLKIQPSEPRDSAVYFCASSL
Pongo abelii V137 trbv ABGA01091248.1 32663 HTDAGVIQSPRHEVTEMGKEVTLRCKPISGHDYLFWYRQTMMQRLELLIYFNNKAVMDDSGMPKDRFSAKMPNASFSTLKIQPSEPRDSAVYFCASSL
Pongo abelii V138 trbv ABGA01091249.1 2285 LIDAGVTQTPRHKVTEMGQEVTMRCQPILGHNTVFWYRQTMMQGLELLAYFRNQAPLDDSGMPKDRFSAEMPDATLATLKIQPSEPRDSAVYLCASGL
Pongo abelii V139 trbv ABGA01091249.1 9213 HIEAGVTQFPSHSVIEKGQTVTLRCDPISGHDYLYWYRRVMGKEIKFLIYFVRESKQDESSMPKNRFLAERTGGTYSTLKVQPAELEDSGVYFCASSQ
Pongo abelii V140 trbv ABGA01091249.1 14304 HGVAMVIQNPRYQVTQFGKPVTLSCSQNLNHNVMYWYQQKSSQAPKLLFHYYDKDFNNEADTPDNFQSRRPNTSFCFLDIRSPGLGDAAMYLCATSR
Pongo abelii V141 trbv ABGA01091249.1 19288 SPGEEVTQTPKHLVKGEGQEAKLYCAPIKGHSYVFWYQQVLKKEFKFLISFQNENVFDKTGMPKERFSAKCLPNSPCSLEIQATKLEDSAVYFCASSQ
Pongo abelii V142 trbv ABGA01091249.1 23219 HLEPGVSQTPRHKVTEMGQEVILRCDPSSGHIFVHWYRQNLRQEMKFLISFQYQNIAVDSGMPKERFTAKRPNGTSSMLKIHPAEPRDSALYLCSSG
Pongo abelii V143 trbv ABGA01091251.1 2218 LSNAGVTQNPRHLVRRRGQEARLRCSPMKGHSYVYWYRQLPEEGLKFMVYLQKEKIIDESGMPKERFSAEFPKEGPSILRIQQAVRGDSAAYFCAS
Pongo abelii V144 trbv ABGA01091252.1 2505 TVDGGITQSPKYLFRKEGQNVTLSCEQNLNHDAMYWYRQDPGQGLRLIYYSGIVNDFQKGDIAEGYSVSREKKESFPLTVTSAQKNPTAFYLCASSI
Pongo abelii V145 trbv ABGA01091254.1 1908 GSGLGAVVSQHPSRVICKSGTSVKIDCRSLDFQATTMFWYRQFPKQSLMLMATSNEGSGVTYEQGVRKEKFPINHPNLTLSTLTVTSAHPEDSSFYICSAR
Pongo abelii V146 trbv ABGA01091256.1 1885 SMDTKVTQRPRLLVKANEQKAKMDCVPIKGHSYVYWYRKKPEEELKFLLYFQNEEIQKAEIINERFSAQYPKNSSCTLEIQSTETGDMALYFCASSK
Pongo abelii V147 trbv ABGA01091257.1 2771 SFHARVTQTPGHLVKGKGQKTKMDCTPEKGHTFVYWYQQNQNKEFMLLISFQNKQVLQETEMHKKRFSSQCPKNTPCSLATLSSEPGDTALYLCASSQ
Pongo abelii V148 trbv ABGA01091257.1 13507 SMDADVTQTPRNRITKTGKRIMLECSQTKGHDGMYWYRQDPGLGLRLIYYSFDVKDINKGEISDGYSVSRRTQAKFSLSLESATPNQTALYFCATSD
Pongo abelii V149 trbv ABGA01091260.1 5033 LMEADIYQTPRHLVIGTGKKITLECSQTMGHDKMYWYQQDPGMELHLIHYSYGVNSTEKGDLSSESTVSRIRMEHFPLTLESARPSHTSQYLCASSE
Pongo abelii V150 trbv ABGA01091263.1 8282 SVFSAVVSQKPSRDICQRGTSLTIQCQVDSQVTMMFWYRQQPGQSLTLIATANQGSEATYESGFVIDKFPISRPNLTFSTLTVSNMSPEDSGIYLCSVE
Pongo abelii V164 ighv ABGA01099934.1 8364 VLSQVQLQESGPGLVKPSETLSLTCAVSGGSISSGYYWGWIRQPPGKGLEWIGHINYGGSTSYNPSLKSRVTLSVDTSKNQFSLKLSSVTAADTAVYYCAR
Pongo abelii V165 ighv ABGA01099934.1 21571 AHSHVQLVQSGDEVRKPGASVKVSCKASGYTFTNHNMDWVRQAPGQGFEWMGGINTNTGGTSYAQTFQGRVIMTRDTSTNTAFMELSSLRSEDMTVYYCAR
Pongo abelii V166 ighv ABGA01099935.1 7137 AHSQVQLVQSEPEMKQPGASVKFSCKATGYTFTSYVMNWVRQAPGQGLEWVGWINTNTGNPMYAQGFTGQFVFSMDTSVSTVYLQISSLKAEDMAVYYCLR
Pongo abelii V167 ighv ABGA01099938.1 2862 VLSQVTLKESGPALVKPTETLTLTCTVSGFSLSNSKMGVSWIRQPPGKALEWLAHIFSNDEKSYSTSLKSRLTISKDTSKSQVVLTMTNMDPVDTATYYCTRR
Pongo abelii V168 ighv ABGA01099940.1 16079 AHAEVQLVQSGAEVKKPGASVKFSCKVSGYTFTELSMHWVRQAPGKGLEWMGGFDPDDGETIYAQKFQGRVTMTEDTSTDTAYMELSSLRSEDTAMYYCAT
Pongo abelii V169 ighv ABGA01099941.1 998 VQCEVQLVESGGGLVQPGGSLRLSCAASGFTFTNYYLHWFRQAPGKGLEWVAYISSGSGGSTNYPDSVKGRFTISRDNAKNTLYLQMNSLRAEDTAVYYCAR
Pongo abelii V170 ighv ABGA01099941.1 12099 VQCEVQLVESGGGLVQPGGSLRLSCAASGFTFSNYYMHWVRQAPGKGLEWVGFIRTEAKGGTTEYAASVKGRFTISRDDSKSIAYLQTNSLKTEDTAVYYCTR
Pongo abelii V171 ighv ABGA01099945.1 5586 VQCEVQLVESGGGLVQPGGSLRLSCAASGFTFSNAWLSWVRQAPGKGLEWVGRIKSKADGGTTDYAAPVKGRFTISRDDSKNTLYLQMNSLKTEDTAVYYCAT
Pongo abelii V172 ighv ABGA01099946.1 22628 VQCEVQLVESGGGLVQPGGSLRLSCAASGFTVSSYDMHWVRQAPGKGLEWVSAIDTDGDTYYADSVKGRFTISRENAKNSLYLQMNSLRAKDTAVYYCAR
Pongo abelii V173 ighv ABGA01099946.1 36318 VQCEVQLVESGGGLVQPGRSLRLSCAASGITFSNQYMSWVRQATGKGLEWVSYISGDSSYTSYADSVKGRFTISRDNAKNSLYLQMNSLRVEDTAVYYCV
Pongo abelii V174 ighv ABGA01099947.1 19778 VQCEVQLVESGGGLVQPGGSLRLSCAASGFTFSSYSMSWVRQAPGKGLEWVSAISGSGSSTYYPDSVKGRFTISRDNAKNTLYLQMNSLRAEDMAVYYCVR
Pongo abelii V175 ighv ABGA01099948.1 6264 VQCEVQLVESGGGLVQPGGSLRLSCAASGFTFSNYYMHWVRQAPGKGLEWVGFIASKAYGGTTEYAASVKGRFTISRDDSKSIVYLQMNSLKTEGTAVYYCTR
Pongo abelii V176 ighv ABGA01099955.1 3483 VCAEVQLVQSGAEVKRPGESLRISCKGSGYSFTSYWISWVRQMPGKGLELMGIIDPSDSDTRYSPSFQGHITISADKSISTAYLQWTSLKASDTAMYYCA
Pongo abelii V177 ighv ABGA01099956.1 15187 VQCEVQLVESGGGLVQPGGSLRLSCAASGFTFSSYAMYWVRQAPGKGLEWVSAINSGGGSTYYADSVKGRFTISRENAKNTLYLQMSSLRAEDTAVYYCAK
Pongo abelii V182 ighv ABGA01104800.1 1134 VLSQVQLQESGPGLVKPSETLSLTCAVSGGSISGYSWSWIRQPPGKGLEWIGSIHSSGSTYYNPSLKSRVTISADTSKNQFSLKLSSVTAADTAVYYCAR
Pongo abelii V183 ighv ABGA01104801.1 6865 VLSQVQLQESGPGLVKPSETLSLTCAVSGGSISSYYWSWIRQPPGKGLEWIGYIHSSGSTNSNPSLKSRVTMSVDTSKNQFSLKLSSVTAADTAVYYCAR
Pongo abelii V217 trbv ABGA01129113.1 1437 HTGAGVSQSPRYKVAKRGQDVALRCDSIFGHVTFYWYQQTLGQGPEVLTYFRSDAQRDKSGLPSGRFSAERPEGSVSTMKIQHTEQGDSAVYLCASSL
Pongo abelii V238 igkv ABGA01154382.1 15550 AYGDIVMTQSPDSLAVSLGERITINCKSSQSVLYSSNNKNYLAWYQQKPGQAPKLLIYWASTRQSGVPDRFSGSGSGTDFTFTISSLQAEDVAVYYCQQSYSAP
Pongo abelii V239 igkv ABGA01154383.1 2952 TRAETTLTQSPAFVSATPGDKVTISCKASQDIDDDMNWYQQKPGEAAIFIIQEATTLISGIPPRFSGSGYGTDFTLTINNIESEDAAYYFCLQHDNFP
Pongo abelii V240 trav ABGA01154588.1 5745 TAGQSLEQPSEVTAVEGAIVQINCTYQTSGFYGLSWYQQHDGGAPTFLSYSTLDGLEERGHFSSFLSRSDSYGYLLLQELQMKDSASYFCAVR
Pongo abelii V266 trav ABGA01173923.1 650 VYLVLGTTGQNIDQPTEITAMEGAIVQINCTYQTSGFNGLFWYQQHAREAPTFLSYNVLDGLDEKGHVSSFLSRSKGYSYLLLKELQMKDSASYLCAVR
Pongo abelii V269 ighv ABGA01174988.1 27127 VQCEVQLVESGGGLVQSRGSLRLSCAASGFTFSSCGMNWVRQAPGKGLEWVAVIWYDGSNKYYADSVKGRFTISRDNSKNMLYLQMNSLRVEDTAVYYCAK
Pongo abelii V270 ighv ABGA01174988.1 37692 VLSQVQLQESGPGLVKPSETLSLTCAVSGDSLSSGYYWSWIRQPPGKGLEWIGYIHHSGSTYYNPSLKSRVTMSVDTPKNQFSLKLSSVTAADTAVYYCER
Pongo abelii V271 ighv ABGA01174994.1 8217 AQSQVQLVQSGAEVKKPGASVKVSCKASGYTFTNYYMQWVQQAPGQGLEWMREFNTRNGNTQYIQEFQGRVTITRDTSTSTAYMELSSLRSEDTAVYYCVR
Pongo abelii V272 ighv ABGA01174994.1 20954 VLSQVTLKESGPALVKPTETLMLTCTVSGLSLSTSGMGMSWIRQPPGKALEWPAHIFLNDKNSYSTSLKNRLTISKDTSKSQVVVTMTNMDPVDTATYYCAWR
Pongo abelii V273 ighv ABGA01174995.1 11364 AHAKVQLVQSGAEVKKPGASVKVSCKVSGYTLTRLSMHWVRQAPRKGLEWMGGFYPVDGETIYAQKFQGRVTMTEDTSTDTAYMEISSLRSEDTAVYYCAT
Pongo abelii V274 ighv ABGA01174999.1 1445 VQCEVQLVESGGGLVQPGGSLRLSCAASGFTFSDYYMSWVHQPPGKGLEWVGLIRNKANGGTTEYAASVKGRFTISRDDSKSIAYLQMNSLKTEDTAVYYCTR
Pongo abelii V275 ighv ABGA01174999.1 24159 VQCEVQLVESGGGLVQAGESLRLSCAASGFTFSSYRMNWVRQAPGKGLEWVSYISSDSSYIYYADSVKVRFTISGDNAKNSMYLQMNNLRAKDTPVYYCVK
Pongo abelii V285 trav ABGA01182048.1 593 VYLVLGTTGQNIDQPTEMTATEGAIVQINCTYQTSGFNGLFWYQQHAGEAPTFLSYNVLDGLDEKGHVSSFLSRSKGYGYLLLKELQMKDSASYLCAVR
Pongo abelii V297 ighv ABGA01194059.1 3551 VQCEVQLVESGGGLVQPGGSLRLSCAASGFTFSNHYMQWVRQAPGKGLEWVGLIRNKADGETTDYAASVKGRVTISRDDSKSITYLQMSSLKTEDSAVYYCAR
Pongo abelii V298 ighv ABGA01194061.1 27103 VFSQVTLKESGPALVKPTQTLTLTCTFSGFSLSTSGMGVGWIHQPPRKALEWLALIYWDDDKRYSPSLKSRLTISKDTSKNQVVLTMTNMDPVDTATYYCARR
Pongo abelii V299 ighv ABGA01194062.1 112 VFSQVTLKESGPALVKPTQTLTLTCTFSGFSLSTSGMGVGWIRQPPRKALEWLAVIYWDDDKRYSPSLKSRLTISKDTSKNQVVLTMTNMDPVDTATYYCARR
Pongo abelii V300 ighv ABGA01194064.1 10047 VLSQVQLQESGPGLVKPLETLSLTCAVSGGSISSSNWWSWVRQPPGKGLEWIGEIYQSGSTNYNPSLKSRVTISVDKSKNQFSLKLSSVTAADTAVYYCAR
Pongo abelii V307 igkv ABGA01197604.1 7604 SSGDIVMTQTPLSLPVTPGEPASISCRSSESLLDTDDEYTYLNWYLQKPGQSPQLLIYEVSSQASGVPDRFSGSGSGTDFTLKISRVEAEDVGVYYCMQALQTP
Pongo abelii V308 igkv ABGA01198108.1 6193 ARCDIQMTQSPTSLSASIGDSVTSTCQASQSISNELAWYQQKPGKVPKLLIYRVSSLQMGIPSRFSGSGSGTDFTLTITSLQPDDVATYYCQQEYSYP
Pongo abelii V333 trbv ABGA01224584.1 1801 LVDMKVTQSSRYLVKRMGEKVFLECVQDMDHERMFWYRQDPGLGLRLIYFSYDVKMKEQGDVPEGYSVSREKKGHFSLILESASTNQTSMYLCASSL
Pongo abelii V352 trav ABGA01239557.1 771 TLIDAKTTQPTSMDCTEGRAANLPCNHSTISGNEYVYWFRQIHSQGPQYLIHGLKNSETNEMASLIITEDRKSSTLILPHATLRDTAVYYCIVR
Pongo abelii V358 ighv ABGA01243343.1 9468 VLSQVQLQQWGAGLVKPSETLSLTCAVYGGSFSDYGWNWIRQPPGKGLEWIGYIVSSGRTNYNPSLKSRVTMSVDTSKNQFSLKLSSVTAADTAVYYCAR
Pongo abelii V359 ighv ABGA01243345.1 15322 VQCEVQLVESGGGLVQPGGSLRLSCAASGFTFSSYGMHWVRQAPGKGLEWVAVIWYDGSNKYYADSVKGRFTISRDNSKNTLYLQMNSLRVEDTAVYYCAK
Pongo abelii V379 ighv ABGA01270863.1 170 AAGGVGGGLVQPGGSLRLSCAASGFTFSNHYMQWVRQAPGKGLEWVGLIRNKADGETTDYAASVKGRVTISRDDSKSITYLQMSSLKTEDSAVYYCAR
Pongo abelii V388 trbv ABGA01276890.1 7517 LTEAGVAQSPRYKIIEKRQSVAFWCNPISGHATLYWYQQILGQGPKLLIQFQNDGVVDDSQLPKDRFSAERLKGVDSTLKIQPANLGDSAVYLCASSL
Pongo abelii V395 iglv ABGA01280669.1 7473 SLSQPVQTQPSSHSACSGASARLTCTLSSGFSVGDFWISWYQQKPGNPPRYLLYYHSDSDKGQGSGVPSRFSGSNDASANAGILRISGLQPKDEADYYCGT
Pongo abelii V403 igkv ABGA01285645.1 2115 TTGEIVMMQSPATLSVSPGERGTISCRASQSVSNYLAWYQQKPGQSPRLLIYRASNRATGIPARFSGSGSGTDFTLTISSVELEDFAVYYCQQYNAG
Pongo abelii V404 igkv ABGA01285648.1 32621 ARCDIQMTQSPSSVSASVGDRVTITCRASQGISSALAWYQQKPGKPAKLLIYAASSLQSGVPSRFSGSGSGTDYTLTISSLQPEDFATYYCQQYNSVP
Pongo abelii V405 igkv ABGA01285649.1 12604 ARCDIQMTQSPSSLSASVGDRVTITCRASQGISDDLAWHQQKPGKAPKLLIYAASSLQSGVPSRFSGSESGTEFTLTISSLQPEDFATYYCQQYNSYP
Pongo abelii V406 igkv ABGA01285651.1 14321 TTGEIVMTQSPATLSLSPGERATISCRASQSVSNYLAWYQQKPGQAPRLLIHSASTRATGIPARFSGSGSGTDFTLTISSLEPEDFAVYYCQQGNNLP
Pongo abelii V411 igkv ABGA01290070.1 268 TTGEVVLTQSPATLSLSPGERATLSCRASQSVSNYLAWYQQKPGQAPRLLIYDASNRATGIPARFSGSGSGTDFTLTISSLEPEDFAVYYCQQRSNLP
Pongo abelii V412 trgv ABGA01290201.1 6853 SQISSNLEGRTKSVTGPTGSSAEITCDLPGASTLYIHWYLYQEGKAPQRLLYYEPYYFRVVLESGITPGKYDTGSTRSSWNLRLQNLIENDSGVYYCATWD
Pongo abelii V413 trgv ABGA01290201.1 11176 SQKSSNLEGRTKSVTRPTGSSAEITCDLPGESTVYIHWYLHQEGKAPQRLLYYDSYNSRVVLESGISPGKYDTYGSTRKNLRLILRNLIENDSGVYYCAIWD
Pongo abelii V414 trgv ABGA01290201.1 15532 SQKSSNLEGGTKSVTRPTRSSAEITCDLTVTNAFYIHWYLHQEGKAPQRLLYYDVSNSRDVLESGLGPGKYYTHTPRWWSWILILRNLIENDSGVYYCATWY
Pongo abelii V415 trgv ABGA01290202.1 2221 SQKSSNLEGGTKSVTRPTRSSAEITCDLTVTNAFYIHWYLHQEGKAPQRLLYYDVSTARDVLESGLSPGKYYTHTPRRWSWILRLQNLIENDSGVYYCATWD
Pongo abelii V416 trgv ABGA01290204.1 7452 SQKSSNLEGRTKSVTRPTGSLAVITCDLPVEDAAYIHWYLHQEGKAPQRLLYYDVSTSKVVLESGISPGKYQTYASTRRSFRFILENLIEHDSGVYYCATWD
Pongo abelii V417 trgv ABGA01290208.1 4016 HLEQPQISSTKTLSKTARLECVVSGVTISATSVYWYRERPGEVVQFLVSISHDGTVRKESGVPSGKFEVDRVPETSTSTLTIHNVEKQDIATYYCALWE
Pongo abelii V418 trgv ABGA01290211.1 7312 EQFQLSISTEVKKSIDIPCKKSSTKFETDVIHWYWQKPNQALEHLIYIASTKSATRGSMGKMGNKVEARKNSQTLTSILTIKSIEKEDMAVYYCAAWG
Pongo abelii V430 iglv ABGA01297342.1 5549 SLSQPVPTEPSSHSASSGASARLTCTLSSGFSVGDFWISWYQQKPGNPPRYLLYYHSDSDKGQGSGVPSRFSGSNDASANAGILRISGLQPEDEADYYCGT
Pongo abelii V435 trbv ABGA01301078.1 8870 HTGAGVSQSPRYKVTKRGQDVALRCDPISGHDYLYWYQQALGQGPEFLTYFQNDVQLDKSGMPSDRFSAEGLEGSISTLKIQRTEQGDSAVYLCASSL
Pongo abelii V436 trbv ABGA01301081.1 705 SVETGVTQSPTYLIKTRGQQVTLRCSPISGHKSVSWYQQALGQGPQFIFQYYREEENGRGNFPRRFSGHQFLNHSSELNVNALELEDSALYLCASSL
Pongo abelii V437 trbv ABGA01301082.1 3707 SVETGVTQSPTYLIKTRGQQVTLRCSPISGHKSVSWYQQALGQGPQFIFQYYREEENGRGNFPHRFSGHQFLNHTSELNVNALELDDSALYLCASSL
Pongo abelii V438 trbv ABGA01301083.1 1585 PVNAGVTQTPKFRILKTGQSMTLQCAQDMNHNYMYWYRRDPGMGLKLIYYLVAAGTTDKGEVPDGYSVSRSTTEDFPLTLESAAPSQTSVYFCASSY
Pongo abelii V439 trbv ABGA01301086.1 3671 PVDAGVTQSPTHLIKTRGQQVTLRCSPISGHKSVSWYQQALGQGPQFIFEYYEKEERGRGNFPDRFSARQFPNYSSELNVNALLLGDSALYLCASSL
Pongo abelii V440 trbv ABGA01301086.1 10962 PMNAGVTQTPKFQVLKTGQSMTLQCAQDMNHDYMSWYRQDPGIGLRLIHYSVAAGITEKGETPSGYNVSRSNTEDFPLRLESAAPSQTSVYFCASSY
Pongo abelii V441 trbv ABGA01301086.1 15592 HTGAGVSQSPRYKVTKRGQDVALRCDPISGHVSLFWYQQALGQGPELLTYFQNEVQLHKSGLPSDRFFAERPEGSICTLKIQRTQQEDSAMYLCASSL
Pongo abelii V457 ighv ABGA01313761.1 1092 VLSQVQLQESGPGLVKPSETLSLTCAVSGGSISGYYWSWIRQPPGKGLEWIGYIYSSGSTNYNPSLKSRVTVSVDTSKNQFSLKLSSVTAADTAVYYCAR
Pongo abelii V458 ighv ABGA01313763.1 467 AHSQVQLGQSGPQVKKPESSVKVSCKASGYTFTSSAMQWVRQAPGQGLEWIGWIIVGSGNTNYAQKFQGRVTITRDTSTSTAYMELSSLRSEDTAVYYCAA
Pongo abelii V459 ighv ABGA01313764.1 1355 VLSQVQLQESGPGLVKPSETLSLTCAVSGGSISSSYYWGWIRQPTGKGLEWIGHIYSSGSTYYNPSLKSRVTISVDTSKNQFSLKLSSVTAEDTAVYYCAR
Pongo abelii V465 igkv ABGA01318850.1 778 SRCDIQMTQSPSSVSASVGDRVTITCQASQGVSNALAWYQQKPGKTPKLLIYDATTLQSGVPSRFSGSGSGTDYTLTISSLQPEDFATYYCQQYNSYP
Pongo abelii V467 trdv ABGA01321050.1 10392 RGMLCDKVTQSSPDQTVASGSEVVLLCTYDTVYSNPDLFWYRIRPDYSFQFVFYGDNSGSQAADFTQGRFSVKHIPTQKAFHLVISPLRTEDSATYYCAF
Pongo abelii V468 igkv ABGA01321409.1 1887 ARGDIQMTQSPSSVSASVGDRVTITCRASQSISSWLAWYQQKPGKAPKLLIYKASNLQSGVPSRFSGSGSGTDFTLTISSLQPEDFATYYCQQYSSTP
Pongo abelii V469 igkv ABGA01321410.1 12105 TTGEIVMTQSPATLSVSPGERGTISCRASQSVSNYLAWYQQKPGQSPRLLIYRASNRATGIPARFSGSGSGTDFTLTISSVEPEDFAVYYCQQYNTG
Pongo abelii V487 trav ABGA01329724.1 401 MMTGTIETTGNISAEKGGSIILQCHLSSTTAQVTQVNWEQQDQLLAICNADLGWHISPSFKDRVAPGPGLGLTLQSLTMNDTGEYFCIYHTYPDGT
Pongo abelii V495 iglv ABGA01335280.1 1205 DSQTVVTQEPSFSVSPGGTVTLTCGLSSGSVSTSYYPSWYQQTPGQALRMLIYSTNTRTSGVPDCFSGSILGNKAALTITGAQADDESDYYCVLYMGSGI
Pongo abelii V503 igkv ABGA01342015.1 1577 TRCDIQMTQSPSSLSASVGDRVTITCRASQSISNYLAWYQQKPGKVPKLLIYAASTLQSGVPSRFSGSGSGTDFTLTISSLQPEDVATYYCQKHNSAP
Pongo abelii V530 igkv ABGA01356721.1 4238 SRCDIQMTQSPSSLSASVGDRVTITCRASQSISSWLAWYQQKPGKAPKLLIYAASSLQSGVPSRFSGSGSGTDFTLTISSLQPEDFATYYCQQHNSYP
Pongo abelii V531 igkv ABGA01356722.1 4087 SRCDIQMTQPPSSMSAYVGDRVTVNCQASQGISSWLAWYQQKPGKAPKLLIYKASSLQSGVPSRFSGSGSGTDYTLTISSLRPEDFATYYCQQANGVP
Pongo abelii V532 igkv ABGA01356724.1 795 ARGDIQMTQSPSSVSASVGDRVTITCRASQGISNYLNWYQQKPGKAPKLLIYAASSLQSGVPSRFSGSGSGTDFTLTISSLQPEDFATYYCQHFNSYP
Pongo abelii V533 igkv ABGA01356726.1 7544 TTGEIVLTQSPATLSLSPGERATVSCRASQSVSNYLAWYQQKPGQSPRLLIYDASNRATGIPARFSGSGSGTDFTLTISSLEPEDFAVYYCQQYNNQT
Pongo abelii V534 igkv ABGA01356729.1 275 ARCDIQMTQSPSSVSASVGDRVTITCRASQGISSYLAWYQQKPGKAPKLLIYAASSLQSGVPSRFSGSGSGTEFTLTISSLQPEDFATYYCMQHNSYP
Pongo abelii V543 ighv ABGA01362157.1 1861 VCAEVQLVQSGAEVKRPGESLRISCKGSGYSFTSYWISWVRQMPGKGLELMGMIDPSDSDTRYSQSFQGHITISADKSISTAYLQWTSLKASDTAMYYCA
Pongo abelii V573 ighv ABGA01384193.1 10969 VQCEVQLVESGGGLVQPGGSLRLSCAASGFTFSSYGMNWVRQAPGKGLEWVSYISGDSSYINYADSVKGRFTISRDNAKNSLYLRMNSLRAEDTAVYYCVK
Pongo abelii V579 trav ABGA01386443.1 3080 GTRAQRVTQPEKLLSVFKGAPVELKCNYSYSGSPELFWYVQYPRQRLQLLVRHISRESIKGFTADLNKGETSFHLKKPFAQEEDSAMYYCALS
Pongo abelii V580 trav ABGA01386446.1 521 VNSQQGEEDPQALSIQEGENATMNCSYKTSINNLQWYRQNSGRGLVHLILIRSNEREKHSGRLRVTLDTSKKSSSLLITASRAADTASYFCATD
Pongo abelii V581 trav ABGA01386446.1 6161 RTNGDPVTQTEGPVTLPERAALTLNCTYQSSYSAFLFWYVQYLNKEPELLLRSSENQETDSRGFQASHVKSDSSFHLEKPSVQLSDSAVYYCVLR
Pongo abelii V582 trav ABGA01386446.1 9540 SSMAQKVTQAQAAISVVEKEEVTLDCVYETRDATYYLFWYKQPSSGELVFLIRQNSFNEQNEVNGRYSWNFQKSTSSFNLTITASQVMDSAVYFCALSE
Pongo abelii V583 trav ABGA01386449.1 5637 LSGEDQEKSPEALRLQEGESSSLNCSYTVSGLRGLFWYRQDPGKGPELLFFLYSAGEEKEKERLKATLTKKESFLHITAPKPEDSATYLCAVQ
Pongo abelii V584 trav ABGA01386453.1 7860 VSSKQEVTQIPGALSVPEGENLVLNCSFTDSAIYNLRWFRQDPGKGLTSLLFIQSSQREQTSGRLNASLDKSSGRSTLSIAASQPGDSATYLCAV
Pongo abelii V585 trav ABGA01387831.1 4906 PGIAQKITQTLPAMFVQEKEAVTLDCTYDTSDQSYGLFWYKQPSSGEMILLIYQGSYDKQNATEGRYSLNFQKARKSANLVISASQLGDSAMYFCAMKE
Pongo abelii V586 trav ABGA01387833.1 6327 RTHGDSVTQMEGPVTLSEEAFLTINCTYTATGYPSLFWYVQYPGEGLQLLLKATKADDKGSNKGFEATYHKETTSFHLEKDSVRESDSGVYFCALS
Pongo abelii V587 trav ABGA01387833.1 37696 VWCQQKEVEQNPGPLSVPEGAIASLNCTYSNSAFQYFMWYRQYSRKGPELLIYIYSSGNKQDGRFTAQVDTSGKYMSLFIRDSQPSDSATYLCAMS
Pongo abelii V592 igkv ABGA01394058.1 5141 SSGDIVMTQTPLSLPVTPGEPASISCRSSQSLLHSDGNTYLYWYLQKPGQSPQLLIYRVSNRFSGVPDRFSGSGSGTDFTLKISRVEAEDVGVYYCAQAL
Pongo abelii V593 igkv ABGA01394059.1 7738 SSGDIVMTQSPLSLPVTPGEPASISCRSSQSLLHSNRYNYLNWYLQKPGQSPQLLIYLGSNRASRVPDRFSGSGSGTDFTLKISRVEAEDVGVYYCTQTLQTP
Pongo abelii V594 igkv ABGA01394062.1 9766 SSAEIVMTQTPLSLSITPGEPASISCRSSQSLLHSDGNTYLHWYLQKPGQPPQLLIYEVSNRFSGVPDRFSGSGSGTDFTLKISRVEAEDVGVYYCMQD
Pongo abelii V595 igkv ABGA01394064.1 17829 SRGEIVLTQSPAFRSETLKEKVTITCRASQSIGSRLHWYQQKPDQSPKLLIKYASQSISGVPSRFSGSGSGTDFTLTINSLEAEDAATYYCQQGSSL
Pongo abelii V596 igkv ABGA01394066.1 10064 TTGEIVLTQSPATLSLSPGERATLSCRASQSVSNYLAWYQQKPGQVPRLLIYRASNRTTGIPDRFSGSGSGTDFTLTISRLDPEDFAVYYCQQYGS
Pongo abelii V597 igkv ABGA01394066.1 40659 SRGDIVMTQSPAFLSVTPVEKVTITCQASEGISNYLNWYQQKPDQAPKLLIKYASQSISGVPSRFSGSGSGTDFTFTISSLEAEDAATYYCQQGN
Pongo abelii V598 igkv ABGA01394068.1 3666 SRCDIQMTQSPSSVSASVGDRVTITCRASQGISNYLAWYQQKPGKAPKLLIYYASSLQSGVPSRFSGSGSGTDYTLTISSLQPEDFATYYCQQYNSYP
Pongo abelii V599 igkv ABGA01394071.1 1745 SRCDIQMTQSPSSLSASVGDRVTITCQASQGISNALAWYQQKPGKTTKLLIYRASSLQSGVPSSFSGSGSGTDFTLTISSLQPEDFATYYCQQYYSDP
Pongo abelii V600 igkv ABGA01394075.1 3784 TTGEIVMTQSPATLSLSPRERATISCRASQSVSSNLAWYQQKPGQAPRLLIYGASNRATGIPARFSGSGSGTDFTLTISSLEPEDFAVYYCQQYNNWP
Pongo abelii V662 trav ABGA01036889.1 4989 VSTQQLEQSPRFLSIQEGENFTVYCNSSSVFSSLQWYREDPGEGPVLLVTVVKGGEVKKLKRLTFQFGDARKDSSLHITAAQPGDTGLYLCAG
Pongo abelii V679 trbv ABGA01047585.1 4521 CFHAKVTQTPGYLVKGKGKKTKMYCTPEKGHTFVCWYQQNQNKEFMFLISFQNEQVLQETEMHKKRFSSRCPKNPPCSLAILSLEPGDTALYLCASSP
Pongo abelii V684 trbv ABGA01052527.1 1596 CFHAKVTQTPGYLVKGKGRKTKMYCTPAKGHTFVCWYQQNQNKEFMFLISFQNEQVLQETEMHKKRFSSQCPKNPPCSLAILSLEPGDTALYLCASSP
Pongo abelii V698 trav ABGA01061552.1 3922 VNGQQVMQIPQCQHVQEGEDFTTYCNSSIALSNIQWYKQRPGGHPVFLIQLVKSGEVKKQKRLTFQFGEAKKNSSLHITATQTTDVGTYFCA
Pongo abelii V699 trdv ABGA01061554.1 2140 SSVAQQVTQAQSSVSMPVGKAVTLNCLYETSWWWSYYIFWYKQPPSKEMIFLIRQGSGEQNAKNGRYSVTFKEAAKSIALTISALQLEDSAKYFCAVWE
Pongo abelii V700 trav ABGA01061560.1 4602 VRGIQVEQSPPGLILQEGANSTLRCNFSATVNNLQWFHQNPWGQLINLFYIPSGTKQNGRLSATTVTTERYSLLYISFSQTTDSGVYFCAVEPQCSP
Pongo abelii V723 trav ABGA01083932.1 1012 VSRGESVRPHLSTLGVQEGDNSVINCAYSDSASDYFIWYKQESGKGPQFIIDIRSNMDKRQGQRVTVLLNKTVKHLSLQIAATQPGDSAVYFCAEN
Pongo abelii V724 trav ABGA01083934.1 2346 GTRAQSVTQLDSHVSVSEGALVLLRCNYSSSVSPYLFWYVQYPNQGLQLLLKYTSGTTLVKGINGFEAEFKKSETSFHLTKPSAHVSDTAQYFCAVS
Pongo abelii V725 trav ABGA01083937.1 16952 VNGENVEQHPSTLSVQEGDSSVIKCTYSDSASNYFPWYKQEVGKGPQFIIDIRSNMGEKKDQRITVILNKTAKHFSLHITETQPGDSAVYFCAAS
Pongo abelii V726 trav ABGA01083938.1 12584 TARAQSVTQPDIHITVSEGTSLELRCNYSYGATPSLFWYVQFPGQGLQLLLKYFSGETLVQGIKSFEAEFKRSQSSFNLRKSSVHWSDAAEYFCAAGGA
Pongo abelii V727 trav ABGA01083939.1 36387 GINGDSVVQTEGQVLLSEGDSLIVNCSYETTQYPSLFWYVQYPGEGPQLLLKAMKANDKGRNKGFEATYRKETTSFHLEKDSVQESDSAVYFCALS
Pongo abelii V728 trav ABGA01083939.1 22778 GSGKNQVEQSPQSLIILEGKNCTLQCNYTVSPFSNLRWYKQDTGRGPVSLTIMTFSENTKSNGRYTATLDADTKQSSLHITASQLSDSASYICVVS
Pongo abelii V729 trav ABGA01083939.1 6794 VWSQQKEVEQDPGPFNVPEGATVAFNCTYSNSASQSFFWYRQDCRKEPKLLMSVYSSGNENGRFTAQLNRASQYISLLIRDSQLSDSATYLCAV
Pongo abelii V730 trav ABGA01083939.1 1323 GTRAQSVTQLDSHVPVSEGTRVLLRCNYSSSYSPSLFWYVQHPNQGLQLLLKYLSGPTLVKGINGFEAEFKKSETSFHLTKSSAHVSDAAEYFCAMS
Pongo abelii V735 trbv ABGA01091278.1 7800 VRSQTIHQWPATLVQPVGSPLSLECTVEGRSNPELYWYRQAAGGGLQLLFYSVGVDQVSSEVPQNLSASRPQDRQFILSSKKLLLSDSGFYLCAWS
Pongo abelii V762 trav ABGA01113127.1 512 DARAQSVSQNNHHVILSEAASLELGCNYSYGGTVYLFWYVQYPGQHLQLLLKYFSGDPLVKGIKGFEAEFMKSKFSFNLRKPSVQWSDTAEYFCAVY
Pongo abelii V763 trav ABGA01113129.1 13070 VKSQKIEQNSEALNIQEGKTATLTCNYTNYSPTYLQWYRQDPGRGPVFLLLIRENEKEKRKERLKVSFDTTLKQSLFHITASQPADSATYFCAL
Pongo abelii V764 trav ABGA01113130.1 14699 MSRGEDVEQTLFLSVQEGDSSVINCTYTDSSSTYLYWYKQEPGAGLQLLTYIFSNMDLKQDQRLTVLLNKKDKHLSLRIADTQTGDSAIYFCAEH
Pongo abelii V765 trav ABGA01113132.1 12670 TLSLAKTTQPISMDSYEGQEVNITCSHNNIATSDYIMWYQQFPSQGPRFLIQGYKTNVINEVASLFIPADRKSSTLSLPRVSLSDTAVYYCLVG
Pongo abelii V766 trav ABGA01113133.1 6917 GLRAQSVAQPEDEVTVAEGNPLTVKCTYSVSGNPYLFWYIQYPNEGLQFLLKYITGDNLVKGSYGFEAEFNKSQTSFHLKKPSALVSDSALYFCAVR
Pongo abelii V785 trgv ABGA01132346.1 1848 SQKSSNLEGGTKSVTRPTRSSAEITCDLTVTNALYIHWYLHQEGKAPQRLLYYDVSTARDVLESGLSPGKYYTHTPRRWSWILRLQNLIENDSGVYYCATWD
Pongo abelii V815 igkv ABGA01154384.1 6304 CNGDIVLTQSPASLAMSPGQRATITCRASESVSVLGMTNLIHWYQQKPGQPPKLLIYRASNKDTGVPARFSGSGSGTDFTLTINPVEADDAANYYCMQSKNFP
Pongo abelii V816 igkv ABGA01154386.1 8822 ARCDIQMTQSPSSLSASVGDRVTITCRASQGISSWLAWYQQKPGKAPKPLIYKVSSLESGIPSRFSGSESGTEFTLTISSLQPEDFATYYCQQYNSVP
Pongo abelii V821 igkv ABGA01161530.1 1495 IRCDIQMTQSPSSLSASVGDRVTITCRASQGISNYLNWYQQKPGKAPKLLIYRASNLQTGVPSGFSGSGSGTDFTLTISSLQPEDIATYYCQQYDNLP
Pongo abelii V826 igkv ABGA01164369.1 3235 IRCDIQMTQSPSSLSASVGDRVTITCRASQGISNYLNWYQQKPGKAPKLLIYRASNLQTGVPPRFSGSRSGTDFTLTISSLQPKDIATYYCQQYDNLP
Pongo abelii V843 igkv ABGA01180641.1 4664 ARCDIQMTQSPSSVSASVGDRVTITCRASQSISSWLAWYQKKPGKAPKLLIYKASSLQSGVPSRFSGSGSGTEFTLTISSLQPEDFATYYCTQHNSYS
Pongo abelii V844 igkv ABGA01180644.1 30454 ARGDIQMTQSPSSLSASVGDRVTITCRASQSISSYLAWYQQKPGKAPKPLIYAASNLQSGVPSRFSGSGSGTEFTLTISSLQPEDFATYYCQQYKSDP
Pongo abelii V845 igkv ABGA01180644.1 14331 ARGDIQMTQSPSSVSASVGDRVTISCRASQSISSWLAWYQKKPGKAPKLLIYKASSLQSGVPSRFSGSGSGTEFTLTISSLQPEDFATYYCTQHNSYP
Pongo abelii V870 igkv ABGA01199503.1 8776 SSGDVVMTQSPLSLPVTLGQPASISCRSSQSLVHSDGNTYLNWFQQRPGQPPRRLIYKVSNRDSGVPDRFSGSGAGTDFTLKISRVEAEDVGVYYCMQG
Pongo abelii V875 ighv ABGA01203420.1 2423 VQCEVQLVESGGGLVQPGGSLRLSCAASGFTVSSNEMSWIRQAPGKGLEWVSTISRGGSTYYTDSVKGRFTISRDNSKNTLYLQMNSLRVEDTAVYYCAR
Pongo abelii V876 ighv ABGA01203422.1 561 VLSQVQLQESGPGLVKPSETLSLTCAVSGGSISSNYWSWIRQPPGKGLEWIGHIHYGGSNYLNPSLKSRVTISVDTSKNQFSLKLSSVTAADTAVYYCAR
Pongo abelii V905 trbv ABGA01223433.1 3665 PVNAGVTQTPKFHVLKTGQSMTLQCAQDMNHDYMSWYRQDPGMGLRLIHYSAGAGITDKGEVPNGYNVSRLNTEDFQLRLESAAPSQTSVYFCASSY
Pongo abelii V911 trbv ABGA01225869.1 6341 PLEAQVTQNPRYLITVTGKKLKVTCSQNMNHEYMSWYRQDPGLGLRQIYYSMNVEVVDKGDVPEGYNVSRKEKRNFPLILESPSPNQTSLYFCASSL
Pongo abelii V912 trbv ABGA01225869.1 987 LVDVKVTQSSRYLVKRMGEKVFLECVQDMDHERMFWYRQDPGLGLRLIYFSYDVKMKEQGDVPEGYSVSREKKGHFSLILESASTNQTSMYLCASSL
Pongo abelii V938 iglv ABGA01245923.1 14314 SLSQPVQTQPSSHSACSGASARLTCTLSSGFSVGDFWISWYQQKPGNPPRYLLYYHSDSDKGQASGVPSRISGSDDASANAGILHISGLQPEDEADYYCGT
Pongo abelii V944 iglv ABGA01252201.1 7062 CPDSASLSVWISWTVTISCTGTSSDVGSYNVVAWYQQHPGTVLKLMIYRVSYRPSGVPDRFSGSKSVNMASMTISGLQAEDEADYYCCSYTSS
Pongo abelii V945 iglv ABGA01252206.1 5279 SWDQSALIQPPSMSGSPGQSVTISCTGTSSDVGGYNYVSWYQQHPGTAPKLMIYAVSNQPSGVPNRFSGSKSGNTASLTISGLQAEDEADYYCSSYAGSNN
Pongo abelii V946 iglv ABGA01252209.1 11010 SWAQSALIQPPSVSGSPGQSVTISCTGTSSNYVSWYQQHPGKAPKLMIYEVSKRPSGVPDRFSGSKSGNTASLTISGLQAEDEADYYCSSYASSNN
Pongo abelii V947 iglv ABGA01252210.1 1993 SVASYELTQPLSVSVAPGQTARITCGGNNIGSKAVQWYQQKPGQAPLLVIYSDSNRPSGIPEQFSGSNLGNTATLTISGAQAGDEADYYCQVRDS
Pongo abelii V948 iglv ABGA01252215.1 2629 SEASYELTQPPSVSVSPGQTARITCSGDALPKKYAYWFQQKSGQAPVLVIYKDSKRPSGIPERFSGSSSGTMATLTISGAQVEDEADYYCYSTDSSGNH
Pongo abelii V949 iglv ABGA01252216.1 9963 SWAQSALTQPRSVSGSPGQSVTISCTGTSSDIGGYNAVSWHQQHPGKAPKLMIYDVSNRPSGVPNRFSGSKSGNMASLTISGLQAEDEADYYCSSYAGS
Pongo abelii V950 iglv ABGA01252218.1 8138 SVTSYELTQPHSVSVATAQTARITCGGNNIGSKAVHWYQQKPGQAPVLVIYDDSNQPSGIPERFSGSNSGNTATLTISGAQAGDEADYYCQVWDSSKH
Pongo abelii V951 iglv ABGA01252219.1 81107 SATSYELTQPPSVSVAPRQTARITCGGNNIGSKSVHWYQQKPGQAPVLVIYGDSNRPSGISERFSGSNSGNTATLTISRVEAGDEAVYYCQVWDSSSDY
Pongo abelii V952 iglv ABGA01252219.1 73212 SATSYELTQPPSVSVAPRQTARITCGGNNIGSKSVHWYQQKPGQAPVLVIYGDSDRPSGISERFSGSNSGNTATLTISRVEAGDEAVYYCQVWDSSSDY
Pongo abelii V953 iglv ABGA01252219.1 65244 SVVSSELTQDPAVSVTLGQTVKITCQGDSLRSYYASWYQQKPGQAPVLVIYGNNNRPSGIPDRFSGASSGNTASLTITGAQAEDEADYYCNSWDGSGNH
Pongo abelii V954 iglv ABGA01252219.1 49037 SWAQSALTQPPSVSGSPGQSITISCTGTSSDVGGYNYVSWYQQHPGTAPKLMIYDVSKRPSGVPDRFSGSKSGNTASLTISGLQTEDEADYYCSSYRSG
Pongo abelii V955 iglv ABGA01252219.1 45808 SVAYCELTQPPLVSVSPGQTARITCSGDVLRDNYADWYQQKPGQAPVLVIYQDGEGPHGIAEPFSGSTSGNTTTLTISRVLTKGGADYYCFSGD
Pongo abelii V956 iglv ABGA01252219.1 36591 SWAQSALTQPASVSGSPGQSITISCTGTSSDVGGYNYVSWYQQHPGKAPKLMIYDVSKRPSGVPDRFSGSKSGNTASLTISGLQAEDEADYYCSSYRSG
Pongo abelii V957 iglv ABGA01252219.1 12437 SWAQSALTQPPSVSGSPGQSITISCTGTSSDIGGYNAVSWYQQHPGKAPKLMIYEVSKRPSGVPDRFSGSKSGNTASLTISGLQAEDEADYYCSSYRSG
Pongo abelii V958 iglv ABGA01252220.1 5948 SVDSYELTQPPSVSVSPGQTARITCSGDVLGENYADWYQQKPGQAPVLVIYKDSERPPGIPERFSGSTSGNTTTLTISSVLTEDKADYYCLSGDEDN
Pongo abelii V959 iglv ABGA01252221.1 21882 SEASYELTQPSSVSVSLGQTARITCSGDVLAKKYAQWFQQKPGQAPVLVIYKDSERPSGIPERFSSSSSGTTVTLTISGAQVEDEADYYCYSGDDNN
Pongo abelii V960 iglv ABGA01252221.1 2968 FEASYELTQPHSVSVSPGQMARITCSGEELPENYAYWYQQKPGQSPVLVIYKDSERPSGIPERFSGSSSGTTVTLTISGVQAEDEADYYCQSADSSGTY
Pongo abelii V961 iglv ABGA01252241.1 12150 SLSQSMLTQPASLSASPGASASLTCTLRSDINVGTYRIYWYQQKPGSPPRYLLRYKSDSDKHQGSGVPSRFSGSKDASANAGLLLISGLQSEDEAGYYCMI
Pongo abelii V962 iglv ABGA01252241.1 7317 SWAQSVLTQPPSASGTPGQRVTISCSGSSSNIGSNYVYWYQQFPGMAPKHLIYDNNQQPSGVPDRFSGSKSGTSASLAISGLRSKDEADYYCAAWDNSLSG
Pongo abelii V963 iglv ABGA01252243.1 51354 SLSQPVLTQSSSASASLGSSVKLTCTLSSGHSSYAIAWHQQQPGKAPRYLMRLEGSGSYNKGSGIPDRFSGSSSGADRYLTISNLQSEDEADYYCQTWDS
Pongo abelii V964 iglv ABGA01252243.1 18669 SWAQSVLTRPPSVSAAPGQKVTISCSGSSSNIGNYAVSWYQQLPGTAPKLLIYENNKRPSGISDRFSGSKSGTSATLGITGLQTGDEADYYCSAWDSSLSA
Pongo abelii V965 iglv ABGA01252243.1 13068 SWAQSVLTQPPSASGTPGQRVTISCSGSSSNIGSNYVYWYQQFPGMAPKLLIYDNNQRPSGVPDRFSGSKSGTSASLAISGLRSEDEADYYCAALDNSLSG
Pongo abelii V966 iglv ABGA01252243.1 3359 SSSQAVVTQEPSLTVSPGGTVTFTCGSSTGAVTSDHYPYWLQQKPGQAPRTLIYDTSKKHPWTPDWFSGSLLGDKAALTLSGAQPEDEAEYYCL
Pongo abelii V967 iglv ABGA01252248.1 19550 SVVQAGLTQPPSVSKGLRQTATLTCTGNSNNVGNQGAAWLQQHQGHPPKLLSYRNNNRPSGISERFSASRSGNTASLTITGLQPEDEADYYCSAWDSSLSA
Pongo abelii V968 iglv ABGA01252248.1 9781 SWAEVVFTQPHSVSGSPGQTVTISCTRSSGSIDNRYVYWYQQRPGSAPTTVIYDDNQRPSGVPDRFSGSIDSSSNSASLTISGLKSEDEADYYCQSAND
Pongo abelii V969 iglv ABGA01252248.1 4280 SWAQSALTQEASVSGTVGQKVTLSCTGNSNNVGSYAVGWYQQISHCAPKTVMLGNSRPSGIPDRFSGSKSGTTASLTISGLQPEDEANYYCSIWDYSLS
Pongo abelii V970 iglv ABGA01252249.1 15931 SWANFMLTQPHSVSGSVGQKVIISCTRSSGSIGSYYVQWYQQHSGSAPTTVINKDNQRPSGVPDRFSGSIDSSSNSASLTISGLKTEDEADYYCQSYDSS
Pongo abelii V982 igkv ABGA01257764.1 8211 SSGDVVMTQTPLSLPVTPGEPASISCRSSQSLLHSDGNTYLDWYLQKPGQSPQLLIYRVSNRASGVPDRFSGSGSGTDFTLKISRVEAEDVGVYYCMQATKTP
Pongo abelii V983 igkv ABGA01257764.1 1449 TSGDIAMTQTPLSLPVTPGEPASVSCRSSQSLLHSDGNTYLDWYLQKPGQPPQLLIYMLSYRASGVSDRFSGSGSGTDFTLKISRVEAEDVGVYYCMQALQAP
Pongo abelii V984 igkv ABGA01257772.1 5443 ARCAIQMTQSPSSLSASVGDRVTITCRASQGISNELSWYQQKPGQAPTLLIYAASSLQSGVPSRFSGSGSGTDFTLTISSLQPEDVATYYCLQDYTTP
Pongo abelii V985 igkv ABGA01257777.1 379 SSGDIVMTQTPLSLPVTLGQPASMSCRSSQSLLDSDGYTYLDWYLQKPGQSPQLLIYEVSNRASGVPDRFSGSGSGTDFTLKISRVEAEDVGVYYCMQALQVP
Pongo abelii V989 trbv ABGA01259417.1 6840 HADTGVSQDPRHKITKRGQNVTFRCDPISEHNRLYWYRQTLGQGPEFLTYFQNEAQQEKSGLFSDQFSAERPKGSFSTLKIQRTEQGDSAMYLCASSL
Pongo abelii V1014 ighv ABGA01275597.1 12927 LVQPGGSVKLSCAASGFTFSSYGMDWVCQAPGKGLEWVVHIWNDGSQKYYADSVKGQFTISRDNSKSMLYLQMDSLKAEDTAMYYCTRQSERK
Pongo abelii V1016 igkv ABGA01276916.1 2930 ARCDIQMTQSPSSVSASVGDRVTITCRASQSISSWLAWYQQKPGKAPKLLIYKASNLQSGVPSRFSGSGSGTDFTLTISSLQPEDFATYYCIQHSSTP
Pongo abelii V1020 trbv ABGA01277799.1 852 HRDAGITQSPRYKVTETGRQVTLTCHQTWSHSYMFWYRQDLGHGLRLIYYSTATGITDKGEVPDGYIVSRSKTENFLLTLESATRSQTSVYFCASSE
Pongo abelii V1021 trbv ABGA01277800.1 24861 HRDAGITQSPRHKITETGRQVTLTCHQTWSHSYMFWYRQDLGHGLRLIHYSLGVPDTNKGEVSDGYTVSRSKTEDFPLTLESAASSQTSVYFCASSE
Pongo abelii V1022 trbv ABGA01277802.1 4973 PVQAGVTQSPTHLIKMRGQQVTLRCSPFSGHTSVSWYQQSLGQGPQFIFEYANELRRSKGNFPDRFSGRQFRDYHSEMNVSALELGDSALYLCASRL
Pongo abelii V1023 trbv ABGA01277802.1 2232 PVDSGVTQTPKHLITATGQRVTLRCSPRSGDLSVYWYQQSLDQGLQFLIQYYNGEEREKGNILERFSAQQFPDLHSELNLSSLELGDSALYFCASSV
Pongo abelii V1024 trbv ABGA01277803.1 299 PVQAGVTQSPTHLIKMRGQQVTLRCSPFSGHTSVSWYQQSLGQGPQFIFEYANELRRSKGNFPDRFSGRQFRDYHSEMNVSALELGDSALYLCASKV
Pongo abelii V1025 trbv ABGA01277806.1 330 PVIAGITQAPRSQILAAGRSVTLRCTQDMRHNAMYWYRQDLGLGLRLIHYSNTAGTIGKGEVPDGYSVSRANTDDFPLTLVSAIPSQTSVYFCASSD
Pongo abelii V1026 trbv ABGA01277808.1 5163 HTGAGVSQSPSNKVTEKGKDVELRCDPISGHTALYWYRQSLGQGLEFLIYFQGNSAPDESGLPSDRFYAERSGGSISTLKIQHTQQEDSAMYLCASSL
Pongo abelii V1027 trbv ABGA01277809.1 13252 PLDTAVSQTPKYLVTQMGKKESLKCEQNLGHDAMYWYKQDSKKFLKIMFIYNNKEPILNETVPNRFSPNSPDKAHLQLHISSLELGDSAVYFCASSQ
Pongo abelii V1028 trbv ABGA01277809.1 9810 PMEMGVTQTPRHLVMGMTNKKSLKCEQDLGHNAMYWYKQSAEKPLELMFAYNLKEPTENNSVPSRFLPECPNSSHLFLHLHALQPEDSALYLCTSSQ
Pongo abelii V1029 trbv ABGA01277809.1 1671 PVNAGVTQIPKFRVLKTGQSMTLQCAQDMNHDYMYWYRQDPGMGLRLIHYSAGEGTTTKGEVPDGYNVSRLKKQNFLLGLESAAPSQTSVYFCASSY
Pongo abelii V1030 trbv ABGA01277810.1 10320 PVNAGVTQTPKFQVLKTGQSMILQCAQDMNHDYMYWYRQDPGMGLRLIHYSLDVGTTDKGEVPDGYNVSRLNIQNFLLRLESAAPSQTSVYFCASSE
Pongo abelii V1031 trbv ABGA01277810.1 7690 PVNAGVTQTPKFRVLKTGQSITLQCAQDMNHNSMYWYRQDPGMGLRLIHYSVGAHSTEKGEVPDGYNVSRLNTQNFLLRLKSAAPSQTSVYFCASSE
Pongo abelii V1032 trbv ABGA01277811.1 953 PMETGVTQTPRHLVMGMTNKKSLKCEQDLGHNAMYWYKQSAEKPPELMFVYNLKEPTENNSVPSRFSPECPNSSHLFLHLHALQPEDSALYLCASSQ
Pongo abelii V1033 trbv ABGA01277815.1 536 PVNAGVTQTPKFQVLKTGQSMTLQCAQDMNYDNMYWYRQDPGMGLKLIHYSVGEGTTDKGEVPDGYNVSRLNRQNFLLRLESAAPSQTSVYFCASGY
Pongo abelii V1034 trbv ABGA01277825.1 9393 PVEAGVTQTPRCLIKTRGRQVTLSCSPISGHRSVSWYQQTPGQGLQFLFEYFSGTQREKGNFPDRFSGHQFSNSRSEMNVSALELGDSALYLCASSL
Pongo abelii V1035 trbv ABGA01277826.1 1953 PVEAGVTQTPRCLIKTRGRQVTLSCSPISGHRSVSWYQQTPGQGPQFLFEYFSGTQREKGNFPDRFSGHQFSNSRSEMNVSALELGDSALYLCASSL
Pongo abelii V1036 trbv ABGA01277827.1 6070 PIDTEVTQTPKHLVMGMTNKKSLKCEQHMGHRTMYWYKQKAKKPPELMFAYSYEKLSINESVPSRFSPECPKSSLLNLHLHALQPEDSALYLCASSQ
Pongo abelii V1037 trbv ABGA01277830.1 10198 LTEPEVTQTPSHQVTQMGQEVILQCVPISNHLYFYWYRQILGQKIEFLVYFFNDKISEKSEIFDDRFSAERPDGSNFTLKIQSTKLEDSAMYFCASSE
Pongo abelii V1038 trbv ABGA01277830.1 4388 LTEPEVTQTPSHQVTQMGQEVILQCVPIPNHLRFYWYRQILGQKVEFLVSFYSDKISEKSEIFDDRFSVRRPDGSHFTLKIQSTKLEDSAMYFCASSE
Pongo abelii V1039 trbv ABGA01277831.1 34737 LTEPEVTQTPSHQVTQMGQEVILQCVPISNHLYFYWYRQILGQKVEFLVSFYSDKISEKSEIFDDRFSVRRPDRSHFTLKIQSTKLEDSAMYFCASSE
Pongo abelii V1040 trbv ABGA01277831.1 27099 SLDTAVSQTPKYLVTQMGNNKSLKCEQNLDHNAMYWYKQDSKKFLKIMFSYNNKELIINETVPNRFSPDSPDKAHLNLHIKSLELGDSAVYFCASS
Pongo abelii V1041 trbv ABGA01277831.1 23626 PIDTGITQTPKHLVMGMANKKSLKCEQHMGHKAMYWYKQKVKKPPELMFVYNYEELSINESVPSRFSPECPKSSLLNLHLHALQPEDSALYLCASSQ
Pongo abelii V1042 trbv ABGA01277831.1 15334 HTEPEVTQTPSHQVTQMGQEVVLQCVPIPNHLNFYWYRQILGQKVEFLVYFYNDNISEKSEIFDDRFSVERPNGSHFTLKIQSTKLEDSAMYFCASSE
Pongo abelii V1043 trbv ABGA01277831.1 7659 SLDTAVSQTPKYLVIQMGNDKSLECEQNLGHDTMYWYKQDSKKFLKIMFSYNNKELIVNETVPNRFSPESPDKAHLNLHIKSLELGDSAVYYCASS
Pongo abelii V1083 trav ABGA01313965.1 805 DARAQSVSQNNHHVILSEAASLELGCNYSYGGTVNLFWYVQYPGQHLQLLLKYFSGDPLVKGIKGFEAEFMKSKFSFNLRKPSVQWSDTAEYFCAVY
Pongo abelii V1085 igkv ABGA01315458.1 1281 TTGEIVMTQSPATLSLSPGERATLSCRASQSVSNYLAWYQQKPGQAPRLLIYGASNRATGIPARFSGSGSGTDFTLTISSLEPEDFAVYYCQQGNNLP
Pongo abelii V1099 trdv ABGA01321053.1 4132 VMSAIELVPEHQTVTVSMGVPATLRCSMKGGAISNYYINWYRKTQGNTMTFIYREKGIYGPGFKDNFQGDIDTAKDLAVLKILAPSERDEGSYYCACD
Pongo abelii V1100 trdv ABGA01321055.1 3602 VSLDIILEPDTKALTVLIGEAATLHCSVTGGDLKNYQMSWYKKNEDNSLILVSKLSNNSNDNLGNNFKVKTDTLKSQFMLDIQKATTQDVGTYYCASD
Pongo abelii V1101 trav ABGA01321066.1 21111 VSAAKNEVEQSPQDLTAQEGELITINCSYSVGTNALHWLQQHPGGGIVSLFMLSSGKKKNGRLIATINIQEKHSSLHITASQPRDSAIYICAV
Pongo abelii V1102 trav ABGA01321067.1 5252 GTSSNSVKQTGQITVSEGASVTMNCTYTSAGYPTLFWYVQYPSKPLQLLQRETMENSKNFGGRNIKDKNSPIVKYSVQVSDSAVYYCLLGDTVLK
Pongo abelii V1103 trav ABGA01321068.1 4201 LSGELKVGQNPLFLSTQEGKNYTIYCNYSTTSDRLYWYRQDPGKSLESLFVLLSNGAVKQEGRLMASLDTKARLSTLHITAAVHDLSATYFCAV
Pongo abelii V1104 trav ABGA01321070.1 14917 FSMAQTVTQSQPEMSVQEAETVTLSCTYDTSESDYYLFWYKQPPSRQMILVIRQEAYKQQNATENRFSVNFQKAAKSFSLKISDSQLGDAAMYFCAYR
Pongo abelii V1105 trav ABGA01321072.1 3010 SSMAQTVTQSQPEMSVQEAETVTLSCTYDTSESNYYLFWYKQPPSRQMILVIRQEAYKQQNATENRFSVNFQKAVKSFSLKISDSQLGDTAMYFCAFM
Pongo abelii V1106 trav ABGA01321081.1 7490 VSGQQLNQSPQSMSIQEGEDVSMNCTSSSLFNTLLWYKQDPGEGPVLLIALYKAGELTPNGRLTAQFGITRKDSFLNISASIPSDVGTYFCAG
Pongo abelii V1107 trav ABGA01321081.1 2728 VSSEDKVVQSPLSLVVHEGDTVTLSCNYEVANFRSLLWYKQEKKAPTFLFMLTSSGIEKKSGKLSSILDKKELFSILNITATQTRDSAIYLCAVE
Pongo abelii V1108 trav ABGA01321082.1 17476 ITGDAKTTQPNSMESNEEQPVHLPCNHSTISGTDYIHWYRQLPSQGPEYVIHGLTSNVNNRMASLTIAEDRKSSTLILHRATLRDAAVYYCILR
Pongo abelii V1109 trav ABGA01321088.1 2224 VRSQQPVQSPQAVILREGENAVINCNSSKALYSVHWYRQKHGEAPVFLMILLKGGEQKSHDKISATFNEKKQQSSLYLMVSQLNSGTYFCGAE
Pongo abelii V1110 trav ABGA01321090.1 3615 TIIDAKTTQPTSMDCAEGRAANLPCNHSTISGNEYVYWFRQIHSQGPQYIIHGLKNNETNEMASLIITEDRKSSTLILPHATLRDTAVYYCIVRV
Pongo abelii V1111 igkv ABGA01322683.1 7515 SSGDIVMTQTPLSLPVTLGQPASMSCRSSQSLLDSYGNTYLDWYLQKPGQSPQLLIYEVSNRASGVPDRFSGSGSGTDFTLKISRVEAEDVGVYYCMQA
Pongo abelii V1128 trav ABGA01333148.1 1392 VSTQQLEQSPRFLSIQEGENFTVYCNSSSVFSSLQWYREDPGEGPVLLVTVVKGGEVKKLKRLTFQFGDARKDSSLHITVAQPGDTGLYLCAG
Pongo abelii V1149 trbv ABGA01349559.1 3365 LMEADIYQTPRHCVIRTGKKITLECSQTMGHDKMYWSRSRNGITPHPLFLWVNSTEKGDLSFESTVSRIRIERFPLTLESASPSHTSQYLCASSE
Pongo abelii V1157 ighv ABGA01354649.1 1540 AHSQVQLVQSEPEMKQPGASVKFSCKATGYTFTSYVMNWVRQAPGQGLEWVGWINTNTGNPMYAQGFTGQFVFSMDTSVSTVYLQISSLKAEDMAVYYCLR
Pongo abelii V1163 trav ABGA01358461.1 1301 VSSKQEVTQIPGALSVPEGENLVLNCSFTDRAIYNLQWFRQDPGKGLTSLLFIQSSQREQTSGRLNASLDKSSGRSTLSIAASQPGDSATYLCAV
Pongo abelii V1169 ighv ABGA01360476.1 866 AHSQVQLVQSGAEVKKPGTSVKISCKASGYTFTSYYMHWVRQAPGQGLEWIGRINPNSGNTNYAQKFQGRVAMTRDTSISTAYMELRSLRSEDTATYYCGE
Pongo abelii V1170 ighv ABGA01360478.1 3394 AHSQVQLVQSGAEVKKPGASVKFSCKASGYTFTDYFMHWMLQAPGQRLEWMGWISAGNGNTKYSQKFQGRVTITRDTSASTAYMELSSLRSEDTAVYYCVR
Pongo abelii V1171 ighv ABGA01360480.1 5693 VLSQVQLQESGPGLVKPLETLSLTCAVSGGSISSSNWWSWVRQPPGKGLEWIGEIYQSGSTNYNPSLKSRVTISVDKSKNQFSLKLSSVTAADTAVYYCAR
Pongo abelii V1202 trgv ABGA01389571.1 1353 TRGDNLITQLVTSITKKKGNTAFLECQIKSSTFKKNVCIHWYHQKPDRPLKRILYISSNENVVHEQGVSEERYEARKWQSDLSSSLRIHRVAEEDAGIYYCTCW