WGS Statistics
Organism WGS Record. Vs Total IGHV IGLV IGKV TRAV TRBV TRGV TRDV
Equus caballus ATDM00000000.1 (ATDM01) 240 14 24 13 98 52 20 19
Equus caballus AAWR00000000.2 (AAWR02) 280 16 32 16 111 56 25 24
Vgene Table
Organism Vgene Locus contig Contig Pos. AA sequence
Equus caballus V0 trav ATDM01007774.1 4030 VNSQKVEQNLQALSIREGENVTMNCSYKTTITNLQWYRQDAGRGLALLILIRSHEKLKPGGRLQVTLDSSSKSSSLSITASRAADTATYFCAVE
Equus caballus V1 trav ATDM01007774.1 9289 GTNGDSVTQTEGPVILPEGALLTLNCTYQSSYSVFLFWYVQYQNKEPELLLKSSSENQEEDSRGFQAKLVTSDSSFHLRKASVQVSDLAVYYCALR
Equus caballus V2 trav ATDM01007774.1 37873 GTGAQSVTQPDVHITVSEGASLELRCRYSSSLPPYLFWYMQYPNQGLQLLLKYTSGNSRVSVIKGFEAELNRSDTSFHLRKSSGHWSDSAKYFCAVS
Equus caballus V3 trav ATDM01007774.1 76694 VNGQQIQQIPPSLLLQEGENFTTYCNSSSTLNRLQWYKQRPGGSPVLLMMVVTGGDVQKQERLTARFGETRKHSSLHITAAQIADVGTYFCAG
Equus caballus V5 trav ATDM01007774.1 84610 TVTDAKTIQPNSMDCAEGEDANLPCNHSTISGYDYIHWYRQNSNKSPQYIIHSLRDNVTNNIASLTIATDRRSSTLILPQVTLRDTAVYYCMLRE
Equus caballus V6 trav ATDM01007775.1 8422 GTRAQSVTQPDDHITVSEGNSLELRCNFSYSGTPYLFWYVQYPSQGLQLLLKDITRDTLVEGIKGFEAEFNKSETSFHLRKPSAHLGDSAVYFCAVS
Equus caballus V7 trav ATDM01007776.1 4351 ESTQQLEQSPQFLSIQEGANFTVYCNSSSIFTTFQWYKQEPGEGPVLLTMLTKGGQMRKLERLRAEFGKERKDSSLLITAAHPGDAGIYLCAG
Equus caballus V8 trav ATDM01012025.1 10657 PGRADWIRPRETELSGTEGKTVNLLCNYGTSSRGLADLYWYRQYPNQALEYILYRGWGYSGKGDASFATERFYSKTTANSTDLYIGNLEPADTAVYYCALR
Equus caballus V9 trav ATDM01012025.1 28713 SSTAETVTQPQPEMSVHEAETATLNCVYDTSESNYYLFWYKQPPSGEMILIIRQEAYKQQNATNNRFSVNFQKADKSFSLRISDSQLEDAAVYFCAFMR
Equus caballus V10 trav ATDM01012026.1 5282 SSMAQTVTQPQPEMSVHEAETATLNCMYDTSDSDYYLFWYKQPPSGEMILIIRQEAYKQQNATNNRFSVNFQKADKSFSLRISDSQLEDAAMYFCAFMR
Equus caballus V14 trbv ATDM01012797.1 23510 SGLGALVSQQPSRAVCKNGSSVKIDCRPVDFQAQIVCWYRQLPNQGLTLIAISNQGSDPTYEQDFPKVKFPISHPDRTISTLTIMSAHPADSSLYFCGAS
Equus caballus V15 trbv ATDM01012797.1 36066 GSGLGVLVSQHPSRAICKNGSSVEMECRTVDLEAQTVCWYHQLPNQGITLIATSIQGSDPTYEQGFPKVKFPISHPNLTLSTLTILSAHPANSGLYFCGAS
Equus caballus V16 trbv ATDM01012797.1 49182 GLGLGALVFQHPSRAICKNGTSVKIECHPQGLQLPTVFWYRQLPKQGLTLIATSNKGSKATYEEGFDEAKFPINYHNETFSTLTVTSAHPADSSLYFCSAS
Equus caballus V17 trbv ATDM01012797.1 60636 SMDTKVTQSPGHLVKGKEQKAKMDCVPIKTHSYVYWYRQKLEGEFDFLVYLGNGKITDKIEGFDQQFSAQCPQDASCSLEIKSTEPGDSALYFCASSE
Equus caballus V18 trbv ATDM01012797.1 66007 SVDANITQTPGHLVKSKGQKARMDCMPQKGHTSVYWYQQIQKKEFKFLIYLEDGQVLDQIELVKERFSPQCPKNLTCSLEIKSSEPGDLALYFCASSR
Equus caballus V19 trbv ATDM01012797.1 79282 LMDADVFQTPKHCVTGTGKKITLECFQSMNHDNMYWYRQDAGRELQLLHYSYGVNNTEKGDVPSESTVSRLRKDRFSLTLESASPSQTSLYLCASS
Equus caballus V20 trgv ATDM01014312.1 8422 TQVSSNMEGIQIVFTRQAGSSVLITCDLKQSSDYIHWYRFQEGMAPRRLLYYHLSSSKVVVESGISSQKYQAYQGTGRTCNLYIQSLEESDSALYYCASWE
Equus caballus V21 trgv ATDM01014312.1 12175 TQVSSNMEGTQMSLTRQAGSSAEITCGIQQTSDYIHWYQHQEGTAPQRLLYYQLSSSKVVAASGITSRKYHVSRGTGMTCKLSIKNLEESDSAVYYCAAWE
Equus caballus V22 trgv ATDM01014312.1 64480 GLGLTKVEQSQISISTEVKKSIDIYCKITSSDFEGEYIHWYRQKPNEALEYVITVSSTKSPARANLGGKKNKLEARKDSQTSTAILTVNFIEKEDVAIYYCAGW
Equus caballus V23 iglv ATDM01015658.1 990 SLASSELTQPLGVSVALAQTATITCQGESIESYNANWYQQKPGQAPVLLIYANSERPSGIPERFSGSSSEGSATLTISGAQAEDEANYYCQVFDFSGNE
Equus caballus V24 iglv ATDM01015658.1 29779 GCAVSSELTQPPSVSVAPGQTAMITCGGNNIGGKYSYWYQLKPGQAPVLVIYSDGKRPSEISSRFSGSNSGNMSALIIGGARTEDEADYYCAVADGSGSS
Equus caballus V25 iglv ATDM01015658.1 78583 SVTTYDLTQPHSTSVALGQTATITCSGDNLEDEYAYWYQQKTGQSPALVIYKDSEHPSGIPDRFSGSNSGNTATLTIRGAKTEDKADYYCQSWSSAN
Equus caballus V26 trbv ATDM01015777.1 18314 STDAGVTQEPRHYVTKMRQAVTLTCEPVSNHTALFWYRQTSVKGLKFLIYLRNQAPIAQTGMPKDRFSAEMPNRSLSTLKIQRTEPGDSAMYICASSL
Equus caballus V27 trbv ATDM01015777.1 23899 PVDSGVTQTPRHLIKARGQQVTLRCSPISGHNRVFWYQQPLGQGPQFLFYYYNGKENEKGDVPARFSGQQFSDYRSELNVSVLELKDSALYLCASSS
Equus caballus V28 trbv ATDM01015777.1 40102 HTDTGVSQSPRHRVTKYGEDVAFRCDPISEHTRLYWYRQTPGQNMEFLTYFQNDFASDTSGMPSDRFSAERPKGSYSTLKIQRAEQRDSAVYLCASSL
Equus caballus V29 trbv ATDM01015777.1 56558 HTVESAGVTQFPNYRVIEKKQAVTLRCDPISGHASLYWYRRAVGKEIKFLVYFLRKDKQDDSGMPNERFSAERTEGTFSTLKVQHSELEDSGVYFCAGSQ
Equus caballus V30 ighv ATDM01017633.1 63923 VLSQVQLQESGPGQTNPSQTLSLTCTVTGYSITSGYGWNWIRQPPNKGLEWMGSISYSGRTNYSPSLRSRITISRDTSKNQFLLQLSSVTTEDTAVYYCAT
Equus caballus V31 ighv ATDM01020982.1 3499 VQCEVQLVESGGGLVKPGGVSETLLCSLWIHLQQLWHELGPPGSREGVAGINSDGGGTHYADSVKGRFPISRDNAKNTLCLQMNSLRDEDTALYYCAG
Equus caballus V32 ighv ATDM01020982.1 22558 VLSQVQLKESGPGLVKPSQTLSLTCPVSRFPLTNHHVHWTHQAPGKGLEWLGDSRSGESTYYNLTLKSQLSIPSDTSKSQIYLTLNRLRGDDMAMYYCAR
Equus caballus V33 ighv ATDM01020982.1 30357 VQCEVQLVESGGGLVKPGGSLRLSCAASGFTFDDYALHWVRQAPGKGLEWVSFISWSGGSTHYADSVKGRFTISRDNAKNTLYLQMNSLRDEDTAVYYCAK
Equus caballus V34 ighv ATDM01020982.1 48955 VSSEVQLVQSGAEVKKPGASVKVSCKASGDSFTYYSMSWVRQAPGQGLEWTGYIYPEYDAMGYPQKFQGRVTMTADKSTSTVYMELSSLASEDTAVYYCAT
Equus caballus V35 trdv ATDM01025436.1 44714 FSNTQSVDQPKREEYKREGESVTLDCTIVVSYTYYIMYWYRQASSGEMTHIINLDSNKKDSRQGRYSVVFQKPNLKLTISALTLRDSAVYFCAVEQA
Equus caballus V37 iglv ATDM01025874.1 8989 SWAQSVLTQPASVSGNLGQRVTISCTGSSSNTRDNYVNWYQQLPGTAPKLIIYENSKRPSGTPDRISGSKSGNPASLTITGLQAEDEADYYCQSYDDNLNA
Equus caballus V39 trgv ATDM01032384.1 32212 GLGLTKVEQSQISITKAVKKSVNIYCKITSSDFEGEYIHWYRQKPNKALEHLIYVRFTGSPALANLGGKKNKLEARKDSQTSTSMLTIHAIENEDVAIYYCAGW
Equus caballus V40 trbv ATDM01032953.1 41620 PLDTSVSQTPEYLISQVGNKKTLKCEQNLNHDAMYWYIQDSKKLLKIMFSYNNKQPIVNETASNRFSPEAPDKAHLHLHINSLEPGDSAVYFCASSK
Equus caballus V41 trbv ATDM01037146.1 1010 HTVESAGVTQFPNHRVIEKKQAVTLRCDPISGHEALYWYRRAVGKEIKFLVYFLGEDKQDDSGMPNKQFSAERIGGTFSTLNIQHAELEDSGVYFCASSQ
Equus caballus V42 trbv ATDM01037146.1 2911 HMGAMVTQEPRYQVTRKGKTVTLGCSQNLSHEYMYWYQQKPSQPPKLLFYYYDKDFNNETDTSDNFQSSRPNISFCSLSIRSPGMGDSAVYLCASKR
Equus caballus V43 igkv ATDM01037494.1 29318 ACGDIVMTQSPDSLSVSAGQRVDMKCRASQSVSNELSWYQQKPGQAPKLLIYAASNRASVVPDRFSGGGSGTDFTLTISSLQAEDVAVYYCLQHYNNP
Equus caballus V44 iglv ATDM01044957.1 723 SVISSELTQPPSVSVTLIQTVSTICQGEILKTYYANWYHQKPGQVSVLNIYKDNVRPSGISDRFTGSKSENTATLTIGGTQTEDEADYYCQSQDSSGN
Equus caballus V45 trav ATDM01046999.1 19556 IVGDAKTIQPNAMESTEKETVHLPCNHSTIGGSEYIYWYRQIPYQGPEYVIHGLKSTETNGMASLTITTDRKSSTLILPQVTLRDTAVYYCMLRE
Equus caballus V46 trbv ATDM01047662.1 7639 LMEAKVTQAPRHLIEETGKKLTVNCSQDMNHDTMYWYRQDPGLGLKLIHYSINEILYKGDVPDGYAVSRKDTGEFPLTLESASINQTSLYLCASSE
Equus caballus V47 trbv ATDM01047662.1 19675 FMDATVTQTERYLVKRRGDKVVMHCQQNMDHNSMFWYRQDPALGLQLLHFSYRIDDEQKGDAPEGYSVSRKKKENFTLILESASTNQTSVYLCASSF
Equus caballus V48 trbv ATDM01047662.1 25879 FMDTNVTQTPRYLVKRIREKVVMECSQNMDHETMLWYRQDPALGLQLLHFSIGIDDKQEGDAPEGYSVSRKKENFTLILESASTNQTSVYLCASSF
Equus caballus V49 igkv ATDM01049442.1 16279 SSGDVVMTQTPLSLPVVPGEPASISCKSSQSLLDSDGKTYLYWYLQKPGQSPKLLIYSVSNRDSGISDRFSGSGSGTDFTLKISRVEPEDVEVYYCVQA
Equus caballus V50 trav ATDM01049811.1 6994 GTRAQSVTQPDDHIIVSEGAPLELKCSYSYTGTPTLFWYIQYPSQGLQLLLGYFSGPTLVKGIKGFEAELKKNETSFHLRKQSAHLGDSAVYFCALR
Equus caballus V51 trav ATDM01054048.1 1145 GTGAQSVTQPDDHISVSEGAPLELRCIYSYSGTPTLFWYVQYPSQGPQLLLKYYSGNTRVKGIKDFEAEFKKNETSFHLRKSSAHWSDSAEYFCALS
Equus caballus V52 trgv ATDM01057171.1 358 TQVSSNLEGTQMSVTKQAGSSVVITCDFKQSITYVHWYRYVEGMAPQRLLYYHYHSAKFVMEPGISSQKYRTYEGTGKNRKIEIRNLEERDSGVYYCAVWE
Equus caballus V53 iglv ATDM01058680.1 17780 PMASSEVTQPSAVSVALGQTATLTCQGDYYERYIVNWYQQKPGQAPVLVIYANSERPSGIPERFSGSSSLGTSTLTISRAQAEDEADYYCQPADAHRSE
Equus caballus V54 trbv ATDM01059786.1 4955 PVNAGVTQTPRFQVLRRGENTTLRCTQDMNHNSMYWYRQDLGHGLRLIHYSVGADATANRDVPDGYRVSRSDTKNFSLMLESATPSQTSVYFCASS
Equus caballus V55 trav ATDM01059860.1 10047 GTGAQSVTQPDDHITVSEGAFLQLKCNYSYGGSLALFWYIQYPSQGLQLLLKYITGDHLVKGIKGFEAEFKKSETTFHLRKPSTYLNDSAEYFCALG
Equus caballus V56 iglv ATDM01060881.1 9296 SVVSLELTQPASVSVALGQTATITCQGGIFDKEYVTWYQQKPGGPPVTVIYKDSERPSGIPGRFSSSSSGNTATLTISRAQAEDEADYYCHSADSDK
Equus caballus V57 trav ATDM01063688.1 1079 VSGKNQVEQSPPSLTILEGENCTFQCNYTVSPFNNLRWYKWATGRGPVSLIIMSSSERRRSNGRYTATLDTTNKGSSLHITAAQLSDAAVYICVVG
Equus caballus V58 trav ATDM01063688.1 12847 MRSQQKGVEQSPGSLRVPEGANASLNCTYSDSASQYFTWYRQYSEKGPQLLIYIYSNEDKNEGRFRAQHNKAGQYVSLLIRDSQPSDSATYLCAV
Equus caballus V59 iglv ATDM01064491.1 13991 PVASSKLTQPSSVSVALGQTATITCKGGDFESFVGSWYQQKPGQAPVLVIDASNERPSGIPERFSGSSSGDTATLTISGAQAEDEADYYCLAADASDYE
Equus caballus V60 igkv ATDM01065410.1 13111 TRAEITVTQSPESMLVIPGDKVIITCKASQDIGDDVNWYQWKPGEAPKLIIKEATTLWSGVPSRFSGTVHGVDFTLTIDDVKSEDAAYYFCLQHDRIP
Equus caballus V62 trbv ATDM01066003.1 7483 PVEAGVTETPRYLIKTTGQAVTLRCSTVSKHSGVSWYQQALSQDPHLLFEFYENVQRAKGEIPNRFSAQQLRDYRSELNVSVLELMDSALYLCASSV
Equus caballus V64 trdv ATDM01066069.1 106 STVAQRVTQGRTATSMQEGATVTLDCVYETSWSAYYIFWYKHLPNGEIVFLIRQDSYSPIAKNGRYSTNLQKAAKFITLTISSLRLEDSAKYFCALY
Equus caballus V65 trav ATDM01068504.1 11135 SCISQKVTQAKPALLVQEKEVVTLHCSYDTNEPTYSLFWYKQSSSGAMKFLIRQDSYNQQSAKEGRYLLNFQKANKSINLVISAAQLEDSAVYFCALSE
Equus caballus V67 trgv ATDM01070131.1 10038 TQVSSNLQGTQMLVTKQAGSSVEITCDITQSSDYVHWYRYQEGMAPRRLLYYEFSSSKVVVDPGISSQKYNAYQGTGRTCKLYIKFLEESDSGVYYCAVWE
Equus caballus V68 trbv ATDM01070695.1 2919 QVDSGVIQTPRHLIKAKGQQMTLRCSPISTHLSVYWYQQALGQGPQFLIQYYDGEEREKGNISGRFSGQQFRDRSSELNVSILELTDSALYLCASSL
Equus caballus V69 trbv ATDM01070695.1 7892 AVNAGVIQTPKFQVLKTGQNTTLRCTQDMNHDSMYWYRQDLGHGLRLIHYSVGAGVTANRDVPDGYRVSRSNTENFPLILVSATPSQTSVYFCASS
Equus caballus V70 igkv ATDM01072823.1 1288 STGDTVLTQTPLSLSVIPGESASISCKSSQSLLHGNGNTYLHWYLQKPGQSLQRLISMVSNRASGVPDRFSGSGSGTDFTLIISKLEAEDVGVYYCMQA
Equus caballus V71 trav ATDM01074684.1 1792 QTYGESVTQMEGQVTLSEGASLTLNCTYSTTGYPTLFWYVQYPGEGPQLLLRAAKANKKEPSKSFEATYNTETTSLHLEKASVQESDSAMYYCAMS
Equus caballus V72 trdv ATDM01076213.1 3240 SSNTQSVDQPKKEEHKREGESVTLDCRITVSYAYYVMYWYRQASSGEMPHIIYLLSDSRNSRRGRYSVVFQRPNLKLTISALTLTDSAVYFCAV
Equus caballus V73 iglv ATDM01078035.1 2948 VDSQTVVTQEPSLSVSSAGMVTLTCGLSSGSVSSGYDPSWYQQTPGQARFTLIYSTNSRLSGVPNRFSGSIFGNKATLTITGAQPEDESDYYCDLGMGS
Equus caballus V74 trav ATDM01081798.1 279 GVRGVNVEQSPSALTLQEGTSSTLRCNFSTTVNNVQWFRQNPESGLINLFFTASGTEQKGRLNCTVNSKELYSTLHITSSQLEDSATYLCAV
Equus caballus V75 trav ATDM01086561.1 6003 GLRAQSVTQPDDLVTITEGNPLTVKCTYSISGSPYLFWYVQYPNQGLQFLLRYISGDNLVKGSYGFEAEFNKSQTSFHLKKPSVLGSDSAVYFCAGS
Equus caballus V76 trav ATDM01088339.1 329 GARAQTVTQPEDRISVVEGAPVQVKCSYSSSVSPYLFWYVQYPNQGPQLLLQHTSVESIKGFTANLNKGEKSFYLKKPSAQKEDSAMYYCALS
Equus caballus V77 trav ATDM01089127.1 4322 RSNGDSVTQTKGQVTLSEGASLTVNCSYETTQYPALLWYVQYPRKGPQLLLRASKANDKDRNKGFEATYNTETTSFHLEKASVQESDSAMYYCALS
Equus caballus V78 trbv ATDM01089618.1 5157 PVDSGVTQTPRHLIKARGQQVTMRCSPISGHKSVFWYQQPLGQGPQFLVQYYNEKENEKADTANRFLGKQFSNYSSELNVSFLELTDSALYLCASSV
Equus caballus V79 trav ATDM01091345.1 228 TVIDAQITQPNSVDCAEGEDVNLPCNHSTIVREEYVYWYRQNPNQSPQFIIHGLRNNVTNNMASLTIATDRKSSILILPQVTLRDTAVYYCAVRE
Equus caballus V80 trav ATDM01091820.1 171 SSIAQKVTQVQPAMLVQEKEAVTLNCRYDTSDTIYSLFWYKQSSSGAMMFLIRQDSYNQQIATEGRYSLNFQKANKSINLAISASQLQDSAVYFCALRE
Equus caballus V81 trbv ATDM01091937.1 4158 PVDSGVIQTPRHVVKAKRQQVMLKCSPISEHDTVSWYQQALGQGPKFLIQYYNGEVREKGDIPDRFSGQQFGNRSSELNLTILELTDSALYLCASSL
Equus caballus V82 trbv ATDM01092020.1 3581 AVNAGVTQTPKFHILETGQNTTLICAQDMNHDYMYWYRQDLGHGLRLIHYSRTSGVTEARDIPDGYRVSRSNTENFLLTLVSPTPSKTSVYFCASSY
Equus caballus V83 iglv ATDM01092819.1 1017 VDSQMVVTQEPSLSLSSGGMVTFTCGLSSGSVSSGYDPSWYQQTPGQVRCTLIYSTNSRLSGVPNHFPGSISGNKATLTTTGAQPEDEADYYCALVMGS
Equus caballus V84 trgv ATDM01097446.1 2503 TQVSSNMEGTQMLVTKQAGSSVVITCDITQNSDYVHWYRYQEGMAPRRLLYYHFSSSKVVVESAISSQKYHAYGGTGRRCKLLIRILEGSDSDVYYCAVWE
Equus caballus V85 iglv ATDM01099525.1 1144 SWAQSLTQPASVSGTLGQTVTISCSGSSSNIGYSSSYVSWFQQIPGTAPKTLIYYATSRASGVPDRFSGSRSGNTATLTISGVQAEDEADYYCSSADSSLRS
Equus caballus V86 ighv ATDM01102156.1 1872 VSSEVQLVQSGAEVRKPGASVKVSCKASGDSFTYYSMSWVRQAPGQGLEWMGGILPIVDDTSYAQKFQGRVTMTADKSTSTVYMELSSLTSEDTAVYYCAK
Equus caballus V87 trav ATDM01103694.1 84 DARAQSVTQPDGHVLVSEAASLELRCTYSYGATPYLFWYIQYPNQGLQLLLRYFSGDTLVEGIKGFKAELKKNESSFNLRKSSAHWSDSAEYFCAVS
Equus caballus V88 trav ATDM01114632.1 784 AQQQVKQSPQSLIIQEGEISILNCTYVDSTFDYFPWYRQYPGEGPALLIAIRSVRNEIEGGRFTVFFNKSTKQFSLTIKASQPGDSATYFCAAS
Equus caballus V89 trav ATDM01120131.1 216 DQQQVKQSPQSLIIQEGEISVLNCTYVDSTFDYFPWYRQYPGEGPVFLIAIRSVVSTEEGRFTVSFNKSAKQFSLTITASQPGDSATYFCAAS
Equus caballus V90 trbv ATDM01122188.1 1257 PVDSGVTQTPRHLVKTRGQQVTLRCSPMSGHDTISWYRQPLGQGLQFLIQYYRGEENGKGDFPGRFKGQQLDNYSSELSVSVLELVDSALYFCASSL
Equus caballus V91 trav ATDM01122364.1 49 GTGAQSVTQPDVHMTVSEGAPLKLRCNCSSSLPPCLFWYVRYPNQGLQLLLKYKSENNLVSGIKGFEAELNRSDTSFHLRKPSAHWSDSAKYFCALS
Equus caballus V92 trav ATDM01124030.1 1159 SSIAQKVTQAQPAMLVQEKEAATLNCTYDTSDFSYSLFWYKQPSSGAMMFLIRQDSHKQQNATEGRYSVNFQKTDKSVNLVILDSQLQDSAVYFCALRE
Equus caballus V93 trav ATDM01125128.1 1144 TVGQDVHQPSELTGMEGAFVQVNCTYQTSGFNGLSWYQQHDGGAPIFLSCNVLDGWERKGHFSSFLSRSDTYSYLFVKELRVEDSASYLCAVS
Equus caballus V94 iglv ATDM01128585.1 224 SWAEFVLTQPRSVSESLGQKATISCTRSSGNIGNSYVYWYQQHPGIAPKTVIYDDDKRPSGVANRFSGSIDSSSNAASLTISGLQPEDEADYYCQSYDSSD
Equus caballus V95 trdv ATDM01131727.1 410 STVAQIVTQGQTATSMQEGTTATLDCLYETSWSTYYIFWYKQLPNGEIVFLINQHSASQNAKNGRYSTNLQKAAKFITLTISALRLEDSAKYFCALY
Equus caballus V96 trav ATDM01134811.1 465 DQQQVKQSPQSLIIQEGEISILNCTYVDSTFDYFPWYRQFPGEGPAFLIAIRSVRNEIEGGRFTVFFNESTKQFSSTITASQPGDSATYFCAAS
Equus caballus V97 trav ATDM01135195.1 834 VGAQIKVEQSPGVLIIQEGSNASLMCNCSNTMTSVQWFQQNPGGPLTALFYMTSQPQEKGRLKSTISTKDRYSHLYIRDSQPGDSATYFCAV
Equus caballus V98 trav ATDM01139216.1 411 VRSQQKGVEQSPGSLCVPEGDVASLNCTYSDSTSQYFVWYRQYSGKGPELLMYIYSSGDEDKGRFTAHLNKAGQYVSLLIRDSQPSDSATYLCAV
Equus caballus V99 ighv ATDM01143024.1 158 VEAEDPLVQWGGGVVVSSQTLSLTCAAYKRKVSEYSLWWIRLLPGKGLECVGVIWAKGDTQCSPHLQSRVSISRDTTKNQVFLQLSSVMPEDSGVYYCAQ
Equus caballus V100 trdv ATDM01149815.1 371 STVAQTVTQGQTATSKQEGATVTLDCLYETNQSTYSLSWYKQLPNGEMIFLIGQDSSRQNAKSGRYSTNFWKEANFVSLTISSLQLEDSAKYFCALV
Equus caballus V102 trgv ATDM01009069.1 99355 TQESSNLEGTQISVTRQAGSSVAITCDILKRSDNYVHWYRYQEGMAPQRLLYYDFSSSKAVWDSGISSGKYHAYEAIGRTCKFLIENLEESDSGVYYCAVWE
Equus caballus V103 trgv ATDM01009069.1 51906 IQLSSNLEGTQMSVTRQAGSSVVITCDIKESSDYVHWYRYQNRMAPQRLLYYQFSSSNDVLDSEISSRKYHAYEGTGRTSKLLIKILEESDSGVYYCAAWE
Equus caballus V104 trgv ATDM01009069.1 36234 GLGLSDVEQSQISISTEVKKSINIHCKITSSDFEGDYIHWYRQKPKKALEHLISVSSTKSPARASLGGRKNKLEARKYSQTSTSVLTVNFIENEDVAIYYCAGW
Equus caballus V105 trav ATDM01009728.1 99583 GVQGVNVKQNPPALSLQEGTSSTLSCNFSTTVYSVQWFRQNPGGSLISLFFMTSVMRQNGRLNCTLNSKELYSTLYIMASQPEDSATYLCAVE
Equus caballus V106 trdv ATDM01009728.1 77689 SSNTQSVSQPVSVMYTQEGESVTLDCKITVSYAYYNMYWYRQLPNGEMTHIIQIYSGSRNSREGRYSVEFQKPTLTLSISALTPRDSALYFCAIVKL
Equus caballus V107 trav ATDM01009728.1 55305 SSIAQKVTQAQPAMLVQEKEAVTLKCRYDTSDGRYSLFWYKQPSSGAMIFLIRQDSYNQQNATEGRYSLNFQKANKSINLAISASQLEDSAVYFCALME
Equus caballus V108 trav ATDM01009728.1 44397 QTHGNSVNQMEGPVTLSEGAFLTMDCTYSTTGYPTLLWYVQYPGKGPQLLLRATKAGEKGRNDGFEALYNEESTSFHLEKASVQESDSAMYYCVLG
Equus caballus V109 trav ATDM01009728.1 33055 GVLGVNVEQSPSALSLQEGTSSTLRCNFSTTVDNVQWFRQNPGGSLINLFVIVSDTKKNERLNGTVNSKELYSTLLITASQLEDSATYLCAV
Equus caballus V110 trdv ATDM01009728.1 7797 SSMAQKVTQDEATLTRQEGEDVTMNCTYEIYWRSHYNLYWYKQPASGEMVFLVYQDYYKPSGKQDRFSVDFQKEKNFISLTISPLQLVDSATYFCVLGI
Equus caballus V111 trav ATDM01009728.1 321 FLNPSGTVGDAKTTQPNAMECTEEETVHLPCNHSTISGNEYIYWYRQIPHQGPEYVIHGLKKNETNEMASLTMTTDRKSSTLILPQVTLKDTAVYYCMLRE
Equus caballus V112 igkv ATDM01015017.1 57891 SSGDIVMTQTPLCLAVTLGEPVSISCRSSQSLLRSDDYTYLDWYLQKPGQSPRLLIYEVSKLVSGVSDRFSGSGSGTDFTLQISRVEAEDVGVYYCMQG
Equus caballus V113 trgv ATDM01015849.1 26388 TQVSSNLEGTQMSVTRQPGSSVVITCDIKQSSDYVHWYRYQEGMAPQRLLYYQLSSSKVVVDSAFSSWKYHASKDTGGTYKLLIKFLDESDSAVYYCAVWE
Equus caballus V114 trgv ATDM01015849.1 12102 TQVSSNLEGTQISVTREAGSSVAITCDIKQSSDYVHWYRYQEGTAPQHLLYYQFSSSKVVMGSGFSSRKYHAYAGTGKTCELLIKILEESDSAVYYCAVWE
Equus caballus V115 trbv ATDM01015929.1 71590 HMETGISQTPSHYIREMGQNISLRCEPISSHFYFYWYRQTLEKGVEFLISVSNKVPSEKADFLKDRFSAEMPDGSRFTLKIQPVQLGDSAVYLCASSL
Equus caballus V116 trbv ATDM01015929.1 61816 PVDSGVIQTPRHLIKAKGQQMTLRCSPISTHPYVYWYQQVLGQGPRFLIQYFDEKENDRGDSSDRFSGKQFSNYSSELKVSVLELVDSALYLCASSL
Equus caballus V117 trbv ATDM01015929.1 56823 AVNAGVTQTPKFHILETGQNKTLRCAQDMNRDSMYWYRQDLGHGLRLIRYSAGAGVTEKRDVPDGYRVSRSNTENFSLTLESATPSQTSVYFCASS
Equus caballus V118 trbv ATDM01015929.1 41358 HTDAGISQSPRHRVTERGQDVALKCDPISGHTYLYWYRQTLGQNLEFLTYFQDDLASDTSGMPNDRYSAKRPEGSSSTLKIQRAEQGDSALYLCASSS
Equus caballus V119 trbv ATDM01015929.1 31144 QVDAGAGITQSPHKITATGKRVTLTCHQTQKHDYMYWYRQDLGHGLKLIHYSYDILKTEEGEVPDGYNVSRSNIEDFPLTLESATPSQTSVYFCASSY
Equus caballus V120 trbv ATDM01015929.1 14084 PTDAGVIQTPRHQLTKMGQTVTLTCEPISTHDTVFWYRQTSVKGLEFLIYFRDQAPMDKTGMPNDRFSAEMPNGSFSTLKIQRTEPGDAAVYLCASSL
Equus caballus V122 trbv ATDM01015929.1 4448 GSRLDALISQHPGRGVCKNGTSVKIACFSMDFQARTMLWYHQLPKHSLTLMATSNHGSSATYQQGFTEAKFPISHPNQTFSNLMVMSVHPADSSLYFCGAS
Equus caballus V123 trav ATDM01016394.1 7067 VNSQQEERNLQALSVQEGENATMNCSYQTSIENLQWYRQDAGRGLARLILIGSNEKHKTNGRLRVTLDTSSKSSSLSITASRAADAATYFCAED
Equus caballus V124 trav ATDM01016394.1 1816 GTDGDSVTQREGPVILPEGAPLTLNCTYQSSYSFFLFWYVQYQNKEPELLLKSSSENQEEDSRGFQAKLVKSDSSFHLQKASVQVSDSAVYYCALR
Equus caballus V125 trdv ATDM01016395.1 52137 SSNTQSVFQPTNVMYTRVGESVTLDCKITVSYSYYYMYWYRQLSNGEMTYLIQLYSSRSSSREGRYSVAFQKPTLTLSISALTPGDSAVYFCAV
Equus caballus V126 trav ATDM01016395.1 40571 GVKGVNVEQSPSTLSLQEGTSSALRCNFSTTVRYVQWFLQNSGGNLISLFFVTSEMKNSGRLNATINSKELYSTLHITASQMEDSATYLCAVE
Equus caballus V127 trav ATDM01016395.1 31783 QTYGESVTQMEGQVTLSEGASLTVHCTYSAIVYPALYWYVQYPGKGPQLLLRATKANEKGSNKGFEATYNKETTSFHLEKASVQESDSAMYYCAV
Equus caballus V128 trav ATDM01016395.1 13727 VRSQQKGVEQSLGSLRVPEGANASLNCTYSDSASQTFMWYRQYSGKGPELLMYISSNKVKDEGRFTAQHSRAGQYVSLLIRDSQPSDSATYLCAV
Equus caballus V129 trav ATDM01016395.1 6506 GARAQTVTQPEDRISVIEGAPVQVKCNYSYSGSPDLFWYVQYPKQGLQLLLKHTSGESIKGFTANLNKSEKSFHLKKLSAQEEDSAMYYCALS
Equus caballus V130 trgv ATDM01020326.1 54916 TQVYSNLEGPQISVTKQARSSVVITCDIKQSSDYVHWYRYQEGTAPQRLLYYQFSSAKFVVDSGISSEKYHAFEDTGRTCKLFIKILEERDSAMYYCAAWE
Equus caballus V131 trav ATDM01028801.1 16546 LSGDEVEQSPQTLRRQEGDSLSLNCSYTVSYFRGLQWYRQDPGKGPELLFLLSSAEREKEKERLRATLSKNGSSLHITAPKPEDSATYLCAVE
Equus caballus V132 trav ATDM01028801.1 5303 VSSKQQVEQSPEALSVREGDSLALNCSYTDSAILFLQWFRQDPGKGLTSLLLIQSNRREQISGRMKVSLDKSSRHSALYIAASQPGNSATYLCAV
Equus caballus V133 trav ATDM01028801.1 2523 GTGDQSVTHPDVHITVSEGAPLEVRCNCSSFVLPDLFWYVQYPNQGLHLLLKYTSRNSVVSEIQNFEAEFKKSDTSFHLRKSSTHWSDSTKYFCAPS
Equus caballus V134 trav ATDM01028802.1 24800 GTNGDSVTQTEGPVILPEGAPLTLNCTYQSSYSFSLFWYVQYQNKEPQLLLKSSSENQGADGRGFQATLNRSDSSFHLQKASVQMSDSAVYYCALR
Equus caballus V135 trav ATDM01028802.1 12042 GTKGDSVNQTEGPVTLSEGAPVILNCTYQTTYSASFLFWYVQYLNKSPQLLLKSSTGNQRTEPQGFQANHVKSDSSFHLRKPSVQMSDSAVYYCAVR
Equus caballus V136 trbv ATDM01030551.1 34214 SMDTKVTQRPGHLVKGKEQKAKMDCFPIKTHIHVYWYRRKLEGEFEFLVYVRNGEITDKIEGFDQQFSVERSQDERYSLEIKSTEPGDSALYFCASSE
Equus caballus V137 trbv ATDM01030551.1 14545 SMDTKVTQRPGHLVKGKEQKAKMTCVPIKAHIHVYWYRRKLEGEFEFLVYLQNNDVIDKIEGFDQQFSAQCPKNASCSLEIKSTEPGDSALYFCASSE
Equus caballus V138 iglv ATDM01031019.1 42713 SVVSLELTQPASVSVALGQTATITCQGGIFDKKYVNWYQQKPGGTPVIVIYKDSERPSGIPDRFSSSSSGNTATLTISRAQAEDEAVYYCHSPDSDN
Equus caballus V139 trav ATDM01031464.1 41245 QTYGDSVTQMEGQVTLSEEASLTINCTYSATGYPTLFWYVQYPGEGPQLLLRATTPNKKETNKGFEATYNKESTSFHLEKASVLESDSAMYYCAMS
Equus caballus V140 trav ATDM01031464.1 21334 VRSQEVEQSPQSLIIQEGENVTINCSFSKTLYALHWYWQKHGEGPIFLMMLMKDGDEKSHDRIAAILNEKNQQSSLFITASQCSHSGTYFCGVE
Equus caballus V141 trav ATDM01031464.1 2137 IMSDSKTTQPNAMECAEEEPVHLPCNHSTISGNEYIYWYRQIPHQGPVYMIHGIKNNVTNGMLSLTMTADRKSSTLILPQVTLRDAAVYYCIVRK
Equus caballus V142 igkv ATDM01031551.1 25953 SSGEIVLTQSPAFLSGTPWEKATITCRANQGISNYLHWYQQKPNQPPKPIIKYVSESISGVPARFSGSRSGTDFTLTISRPEAEDAATYYCQHSYYHL
Equus caballus V143 igkv ATDM01031551.1 7799 ARCEIQMTQSPASLSASLGDRVTITCQATQGINTWLAWYQQKPGKALKFLISKATILHTGVSSRFSGSGTWTDFTLTISSLEPEDAATYYCQQYKSSP
Equus caballus V144 iglv ATDM01032246.1 26015 ADSQAVVIQEPSFSVSLGGTVILTCGLRTGSVSTSNYPRWYQQTPGKAPRTLTYSTNNRPSGIPERFSGSISGNKAALTITGAQPEDEADYYCDLYVDRGV
Equus caballus V145 trav ATDM01033766.1 18353 VSSMLNVEQSPQLLHVQEGESTNFTCKFPSSSFYALHWYRWEPAKSPKILLIITVNGDEREEGRASATLNTNEGYSYFYIKGAQPEDSATYLCAS
Equus caballus V146 trav ATDM01033766.1 2962 TVIDAQNTQPNSVDCAEGEDVNLPCNHSTIVREEYVYWYRQNPNQSPQFIIHGLRNNVTNNMASLTIATDRKSSILILPQVTLRDTAVYYCAVRE
Equus caballus V147 trav ATDM01034252.1 25819 GTNGDSVTQTEGPVILSEGAPVILNCTYQTSYSMPFLFWYVQYLNNAPQLILKSSTENQRTENQDFHATLIKSDSSFHLQKPSVQMSDSAVYYCALR
Equus caballus V148 trav ATDM01034252.1 13086 GLSAEDQVEQSPQTLRLQEGDSLSLGCSYRVSSFRGLQWYRQDPGKGPELLFLLYSVGEPKQKERLKATLSKMGSSLHITDSKPEDSATYLCAVE
Equus caballus V149 trdv ATDM01034922.1 2119 SSNTQSVNQPINVVYTQEGESVTFDCKITVSFSVYVVYWYQQLSSGEMTHLIHLRSDNKNTAEGRYSMVFQKSDVKFTISNLMHRDSGVYFCAVAEC
Equus caballus V150 trbv ATDM01035501.1 14529 PLDTAVSQTPKYLISQVGNKKTLNCEQTLGHNAMYWYKQDSKKLLKIMFIYYNKERDLNETVPSRFSPEAPDKAHLNLHVSSLEPGDSAVYFCASSQ
Equus caballus V151 igkv ATDM01035894.1 31728 SSADVVLTQTPLSLSVVPGEPASISCKSSQSLKYSDGKTYLYWFLQKPGQSPNLLIYLVSTRYSGVSDRFSGSGSETDFTLKISRVEPEDVGVYYCFQALYAS
Equus caballus V152 igkv ATDM01035894.1 7760 SSGDVVMTQTPLSLSVVPGEPASISCKSSQSLKHSDGKTYLYWFLQKPGLSPKRLIYLVSTRVSGVSDRFSGSGSETDFTLKISRGEPEDVGVYYCVQALYAS
Equus caballus V153 ighv ATDM01036172.1 22748 VQCEVQLVESGGGLVKPGGSLRLSCAASGFTFSSYAMSWVRQAPGKGLQWVAGINSDGGSTHYADSVKGRFTISRDNAKNTVCLQMNSLRDEDTAVYYCAK
Equus caballus V154 trdv ATDM01036302.1 13182 VSVDIILEPVTKTLIVLAGETATFRCNITGGDLKNYRMSWYKKNEDNSLTLVYGPRNNSNDDLRKSFKGEINILKNQYILDIQKATTKDVGTYYCGSD
Equus caballus V155 trdv ATDM01036505.1 33653 SSMAQKVTQTHTIMTRKEGESVTMDCKYELGWSNYYYALYWYKQLPSGELVFLIYQDSSKPSAKQGHFSVNFQSSKNFISLTISPLKLADSATYFCALWD
Equus caballus V156 trav ATDM01036505.1 24171 IIGDAKTTQPNAMDCTEEETVHLPCNHSTISGNEYIYWYRQIPHQGPEYVIYGLKSNVTNGMASLTITTDRKSSILILPQVTLRDTAVYYCIVRE
Equus caballus V157 trav ATDM01036505.1 6221 VSSQEVQQSPQSLNIREGEDFIINCNASKTLYAFHWYRQKHGEGLISLMVLQKSGEEIHYEKMTAKLDEKKQQSSLHITASQPSHSGIYLCGAE
Equus caballus V158 trav ATDM01036505.1 1371 VSGQQLNQSPQSVSVQEGEDVSMNCNSSSTLSTFLWYKQDVGEGLVLLIALYKIGEWTRNGKLAAQIARTRKDSFLNISVSEPKDAGTYFCAG
Equus caballus V159 ighv ATDM01036740.1 37440 VSSEGQLEQSGPELKKPGSSVKISCKASGYTFSSYAVHWVRQANGKGIEWMGSIYAEYDDTSYAPKFQGRVTMTADKSTSTVYMELSSLTSEDTAVYYCAT
Equus caballus V160 trbv ATDM01038449.1 12074 FMDATVTQTERYLVKRRGDKVVMDCQQNMDHNSMFWYRQDPALGLQLLYFSDSVGDKQEGDDPEGYSVSRKKKENFTLILEPASTNQTSVYLCASSL
Equus caballus V161 trbv ATDM01038449.1 5632 SVFGALLSQKPSRAICQRGTTMKIQCEVDTELTLMFWYSQLPGQSLTLIATANQGSEATYESGFTKDKFPISRPTLRFSTLTVNNTSPEDSSFYFCSAG
Equus caballus V162 iglv ATDM01039716.1 33828 SWGQSALIQPSSVSLALGQSVTISCAGSSSDIGYYNSISWYQQHPGTTPKLLIYYTNKKHSGIPDRFSGSKSGNTASLTISGLQAEDEAEYYCCSYAGSGN
Equus caballus V163 iglv ATDM01039716.1 16635 SVSSSELTQSTAVSFSLGQTATITCQGETLRSHYASWYQKNPGQAPVLVIYGNNNRPSGIPARFSSSYSEDTGTLTISGVQIEDEADYYCQSLGSDY
Equus caballus V164 trav ATDM01040088.1 33232 GSNEEMVTQTDGLVTFPKGPLLTLNCTYQTSDSVFLLWCVQYYNKAPKLLLNYSFLSSTENQWTERQGFQANHVKSDGSFYLQKPSVQMSDSTVYYCDLR
Equus caballus V165 trav ATDM01040088.1 26984 DARAQSVTQPDGHVLVSEGSSLDLRCSYSYGATPYLFWYVQYPRQGLQLLLKHLSGQDTRVPGIKGFEAEFRKSNSSFNLRKSSAHWSDSAEYFCALS
Equus caballus V166 trav ATDM01040088.1 9807 QIYGDSVTQMEGQMTLSEGASLKMNCTYSTTTYVALFWYVQYPREGPQLLLRATTANEKGRNKGFEATYNTETTSFHLEKASVLESDSAMYYCAMS
Equus caballus V167 trgv ATDM01040132.1 29901 TSEDILITQLITSITKKKGNTAFLECKVKRDDLKKNAHIHWYRQKPGQPLRRILYISSNENVVHERGVSEDRYEARRRQGDPSASLRIHHVEEADAGLYYCACW
Equus caballus V168 trav ATDM01040352.1 16421 GARAQTVTQPEDRISVVEGAPVQVKCNYSYSWSSTLFWYVQYPKQGLQLLLKHTSGESIKGFTANLNNDEGSFHLKKLSAQEEDSAMYYCALS
Equus caballus V169 trav ATDM01040352.1 11245 VNSQQGEQNLQTLSIQEGENVTMNCSYKTTITNLRWYRQDAGRGLAQLILIRSNEREKPGGRLQVTLDTSSKSSSLSITASRAADSAAYFCAVE
Equus caballus V170 trav ATDM01040352.1 5806 LLLFHRRDQWRLGDPDRRPCYSPRQGTSDPNCTYQSSYSFFLFWYVQYQNKEPELLLKSSSENQDVNSRGFQANHVKSDSSFHLQKPSVQVSDSAVYYCALR
Equus caballus V171 trav ATDM01040747.1 24356 GTRAQSVTQPDSHITVSEGAGLELRCNYSSSVSQFLFWYVQYPNQGPQLLLKYFSGPILVKGIKGFEAELKKSETTFHLRKPSAHWSDSAEYFCALM
Equus caballus V172 trav ATDM01040747.1 21798 GARAQTVTQPEDRISVIEGAPVQVKCNYSYSGSPYLFWYVQYPKRGLQLLLKHTSGESIKGFTANLNNDEGSFHLKKPSAQEEDSAMYYCALS
Equus caballus V173 trav ATDM01040747.1 8915 GTNGDSVTQTEGPIVLLEGTRLTLNCTYQSIYSVSLFWYVQYQNKEPELLLKSSSENQEVDNRGFHTKLVTSDSSFHLQKPSVQMSDSAVYYCALR
Equus caballus V174 trav ATDM01040747.1 3344 VRGAQVEQSPPVLSLQEGASSMLRCNFSISVSNLQWFRQNPGGRLISLFYVPSGTQQNGRLNTTTVAKERHSSLNISSSQTTDSGIYFCAVEPQCSP
Equus caballus V175 trgv ATDM01040879.1 18691 TWISSNVEGTQMSITKQAGSSVVFTCDIKQRITYVHWYRHKEGIAPQRIVYYHHQDSRLVSDPGIRLERYRVYESTERNRKIEIRKLEQSDSGVYYCAIWE
Equus caballus V176 trgv ATDM01041445.1 20542 TQGSSNMEGIQMVFIRQAGSSVLITCDLKQSSDYIHWYQYQEGMAPRRLLYYQFSSSKVVVEPGIRSQKYQAYEGTGRTCKLYIQILEESDSAVYYCAAWE
Equus caballus V178 trav ATDM01042515.1 24944 RRELHHVLQFFKHFKQLIQEGENFTMYCNSSSTLASFQWYKQRPGGSPVFLILVSGREVQKQERLAAQFGETRKDSFLHITAAQTADVGTYFCAG
Equus caballus V179 trav ATDM01042515.1 18608 TVIDAKTTQPNSMDCTEGEDANLPCNHSSIGIADYIHWYRQNPSQSPQYIINGLQGNVTNNMASLTIATDRKSSTLILPRVTLRETAVYYCMLRE
Equus caballus V180 iglv ATDM01047532.1 6447 SWAQSALTQPASVSGTLGQSVTITCAGSTGSYKYISWYQQHPGTAPKLLIYNGNNRASGIPDRFSGSTSGNTMSLTISGLQAEDEADYYCHAYVGSYN
Equus caballus V181 trav ATDM01048431.1 24732 VRSQQKGVEQSPGSLRVPEGDVASLNCTYSDRTSQNFMWYRQYSGKGPEFLVYAYSNNDKNEGKFIAQHSRAGQYISLLIRDSQPSDSATYLCAV
Equus caballus V182 trav ATDM01048431.1 13647 GARAQTVTQPEDRISVIEGAPVQVKCNYSYSLSPVLFWYVQYPNQGPQLFLTHTSRKSIKGFTANLNKGEKSFHLKKLSAQKEDSAMYYCALS
Equus caballus V183 trbv ATDM01049251.1 24325 VLDAAVTQTPGQLIKGKEQKVKMYCVPKKGHPFIFWYQQNLAKEFKFLISFQNENILEETEMPKERFSAECPPNSPCSLEIPPTELQDSAVYLCASGE
Equus caballus V184 trbv ATDM01049251.1 11275 TMDSRITQSPKSLFREEGRDVTLECEQNLDYSAEYWYRQDLGQGLRLIYYSHIVNAVQKGDVSEGHRASQEKKAFFPLTVTSTQKNQTALYLCASSRDAVKN
Equus caballus V185 trbv ATDM01049251.1 5330 GLGLGALVSQHPSKAICMNGTSVKIECRAMDFQAQTMFWYRQLPKQGLTLMVASSDNSSITYEQGFTRAKFPINHLNRTFSTLTVMSVHPADSGLYFCSAS
Equus caballus V186 trav ATDM01051634.1 15130 TLSLAKTTQPIFSDSYEGQEVNITCNHTNIATNEYILWYRQFPNQGPQFVIQGFNTKVENEVASLFIPDDRKSSTLSLPQATLRDTAVYYCIVS
Equus caballus V187 trav ATDM01051634.1 2350 GTGAQSVTQPDVHVTVSEGAPLELRCNYSSSVSLYLFWYVRYPNQGLQLLLKYTSGNSLVPGIKGFKAEFRKNETSFHLKKPSAHWSDSAEYFCAVS
Equus caballus V188 trav ATDM01051732.1 14598 KSDQQQVKQSPQSLIIQEGEISTLNCTYVDSTFDYFPWYRQYPGEGPAFLIAIHSIVSTKEDGRCTVSFNKSTKQFSLTITASQPGDSSTYFCAAS
Equus caballus V189 trbv ATDM01053045.1 19033 PVNAGVTQNPKFQVLGTGQNMTLRCAQDMNHSYMYWYRQDLRHGLRLIHYSRAANVTEKGDIPEGYRVSRPNTENFLFTVESATPSQTSVYFCASSY
Equus caballus V190 trbv ATDM01053045.1 9583 SMDAAVTQKPRYYITQTGHKMILECSQNMNHLSMFWYRQDPGQGPRPIHYSRGVNSTAKGDITEGYSVSRNKKEDFHLTLESASTKQTSLYLCASSK
Equus caballus V191 ighv ATDM01055528.1 14809 VLSQVKLQESGPGLVKPSQTLSLTCSVSGVSITSSGDWWSWIRQPPGKGLEWMGYISYSGSAYYTTSLKSRLSISRDTSKDQFSLQLSSVTAEDTAVYYCAR
Equus caballus V192 iglv ATDM01056195.1 18361 SWAQSALTQPASVSGTLGQSVTISCAGSSSNIGSYNYVSWYQQHPGTAPKLLIYSASSRASGIPDRFSGSKSGNTASLTISGLQAEDEADYYCSSYINADP
Equus caballus V193 trdv ATDM01060908.1 10627 SSICQKVTQSQPAMSVQEMEAVTLNCTYDTSSGTYSLFWYRQPSSGAMIFLIRQDSYQQNATEGRYSLNFQKAKKSINLVISAAQLEDSAVYFCALIE
Equus caballus V194 trbv ATDM01061289.1 15767 HTSAGVTQFPSHRVVEKKQSVTLRCDPVPGHQALFWYQRAVGKEITFLIYFLRENKQDESGMSNKRFSAERTNGTFSTLKIQPAELEDSGVYFCASSQ
Equus caballus V195 trbv ATDM01061289.1 8987 ALDAEVTQTPGHLVEGKEQKVKMYCVPKKGHSYVFWYQQNLAKKFKFLISFQYENIFGETEMPKERFSAECPPNSPCSLEIPPTELQDSAVYLCANSE
Equus caballus V196 trbv ATDM01061289.1 2091 PIDSGVTQEPRHQVTKMGQDVTLRCEPISSHTDLFWYRQTSVQGLEFLIYFSNQAVIDQTGMPKDRFSAEMPNRSFSTLKIQHTEPRDSAVYLCASSL
Equus caballus V197 trgv ATDM01061303.1 2337 GLGLTKVEQSQISISAEVKKSIDIHCKITSSNFEGEYIHWYRRKTYEALEHLIYVSSTKSPAQANLGGKKNKIEARKDSQTSTAILTVNFIENEDVAIYYCAGWY
Equus caballus V198 igkv ATDM01061867.1 8409 SSGDIVMTQTPLSLPVVPGELASNSCRFSQSLLHSNGNTYLHWFLQKPGQSPRRLTYRVSNRNSGVPDRFIGSGSGTDFTLKISKVEAEDGGVYYCSQG
Equus caballus V199 trav ATDM01062315.1 1946 GVRALKVEQSPSALSLQEGTSSTLRCNFSATVNRVQWFRQNPGSGLINLLFLTSVTKQNGRLNSTINPKELYSNLHITDSRLEDSATYLCAV
Equus caballus V200 trbv ATDM01062423.1 8554 HTDAGVSQSPRHRVTERGQDVAFKCDPISGHTHLYWYRQTRGQGLEFLMYFRDDFASDTSGMLKDWFSAERPEGSSSTLKIQHAEQGDSAVYLCQQL
Equus caballus V201 trbv ATDM01062423.1 2157 PADAGVIQFPKHLIKGMGGNAVLKCYPSSGHSSVCWFQQALGQGPQFLIKYYEKEQGEKRNIPDRFSAQQFSDYSSELDVSSLELEDSALYLCASSS
Equus caballus V202 trav ATDM01065756.1 8980 AQQQVKQSPQSLIFQEGEISVLNCTYENSAFDYFPWYRQYPGEGPAFLIAIRSGSRVNTSEGRFTVSFNKSAKQFSLTITASQPGDSATYFCAAS
Equus caballus V203 trdv ATDM01065756.1 1268 SSVAQRVTQGQTATSMQEGASVTLDCRYETSQSTYSIFWYKQLPNGEIVFLIRQSSSSQDAKNGRYSTNLQKAAKFISFTISTLQLEDSAKYLCALQE
Equus caballus V204 iglv ATDM01068401.1 12551 SWAQSALTQPASVSGALGQSVTITCAGSSSDIGGYNAVSWLQQHPGTAPKVLIYSVNTRASGIPDRFSGSKSGNTASLTISGLQVEDEADYYCYSLVSG
Equus caballus V205 trbv ATDM01071264.1 1174 AVDSGVTQTPRHLIKTKGQQVTLRCSPISGHPRVSWYQQALGQGPQFLFQYYMGRENGKGDIPDRFKGQQFSNYCSELTDSALYLCASSAAQPCR
Equus caballus V206 trdv ATDM01073467.1 7720 SSMAQKVTQAQIIITRQEGEAVTMDCKYEISWTSYDLYWYKLPPSGEMVFLIYQDYYKPSAKQGRFSVNFQNTQKSISLTISSLQSADSAMYFCALWI
Equus caballus V207 iglv ATDM01075039.1 5249 SRAQSVTQPASVSGTLGQTVTISCSGSSSNVGSGYVSWYQQIPGTAPKLLIYYATSRASGVPDRFSGTRSGNTATLTISGLQAEDEADYYCGASGSSWSS
Equus caballus V208 trdv ATDM01075056.1 3026 SSIAQKVTQDQSSMLVQEKEAVTLNCRYDTSSSSYSLFWYKQSSSGVMMLLIRQDSYNQQNATEGRYSLNFQKANKSIQLVISTSQLADSAVYFCALIE
Equus caballus V209 igkv ATDM01077344.1 8110 ACGDIVLTHSPGSLAASLGQRVEMKCKASQSASSYLAWYQQKPGQAPKLLIYSASSRASGVPDRFSGSGSGTDFTLTISSLQAEDVAVYYCFQSYNAP
Equus caballus V210 trav ATDM01078448.1 2786 TLSLAKTTQPIFIDSYEGQEVNITCNHTNIATNEYILWYRQFPNQGPQFVIQAFKETVKNEVAILFIPDDRKSSTLSLPLATLRDTAVYYCIVN
Equus caballus V211 trgv ATDM01079266.1 8955 TQVSSNLEGTQKPIIRQAGSSVQFTCDIKQSVTYVHWYRYQEGIALQRLVYYHYQYSRLMTDPGISSGKYHTFGGTDKNRNIEVRSLEERDSGVYYCAVWE
Equus caballus V212 trav ATDM01079590.1 4140 DARAQSVTQPDGHVLVSEAASLELRCNYSYGAAVYLFWYVQYPRQGLQLLLKHFSGQDTRVPGIKGFEAEFRKSNSSFNLRKSSAHWSDSAEYFCAVS
Equus caballus V213 trav ATDM01080025.1 6818 GTRAQSVTQPDVHTTVSEGAPLELTCNCLSSLLLYLFWYVRYPNQGLQLLLKYRSENNLVLGIKRFEAEFKKSDTSFHLRKPSTHWSDSAKYFCALS
Equus caballus V214 igkv ATDM01080482.1 1732 CRGQIILTQSPETLAASQGSFISITCRSSIEVGTSMAWYQQKPNEAPRLLIFGASARAEGTPSRFRGSGSGSVFSLTIHGLEAKDFGVYYCQ
Equus caballus V215 iglv ATDM01080574.1 1320 SWAQSVTQPASVSGTLGQTVTISCTGSSSNIGSGHVSWYQQIPGTAPKRLIYSSTNRASGVPDRFSGSRSGNTATLTISGLQAEDEADYYCGTLYSSWSN
Equus caballus V216 trav ATDM01081217.1 8378 QAHGDSVTQMEGQVILSEGASLNMTCTYSATGYPTLFWYIRYPGEGPQLLLSAKKDNEMGRNKGFEATYNKEAASFHLVKASVLESDSARYYCALS
Equus caballus V217 trav ATDM01082543.1 3031 GTRAQSVTQPDVHITVSEGAPLELKCRYSSSLPSSLFWYVQYPNQGLQLLLKYTSGNSLVSGIKSFEAEFKKSDTSFHLRKPSAHWSDSAEYFCVLV
Equus caballus V218 trdv ATDM01086150.1 464 SSNTQSVYQAANVMSAQVGESVTLDCKITVSYTYYNMYWYRQLSSGEMTHIIRLYSANRNSREGRYSVVFQKPTLTLTISALTPGDSAVYFCAV
Equus caballus V219 trav ATDM01086636.1 3367 VRGAQVEQSPPALSLQEGASSTLRCNFSISVKNVQWFRQHPGGRLIDLFYIPSGEKQSGRLNAMTVMKERRSSLYISSSQTTNSAIYFCAVKPQC
Equus caballus V220 trav ATDM01086692.1 2847 GTNGDSVTQTEDPITLAEGAPLTLNCTYQSSYSVSLFWYVQYQNKEPELLLKSSSENQGADSRGFQANHVNSDSSFHLQKPSVQMSDSAMYYCALR
Equus caballus V221 iglv ATDM01087474.1 2643 SWAQSLTQPASVSGTLGQTVTITCTGSSSNIVAYVGWYQQIPGTAPKTLIYANNKRASGVPDRFSGSKSGSTATLTITGLQAEDEADYYCGTSSSSGSS
Equus caballus V222 trav ATDM01088165.1 1386 GTGAQSVTQPDVHITVSEGAPLELRCNYSSSVSLYLFWYVQYPNQGLQLLLKYTSGNSLVPGIKGFKAEFRKNETSFHLKKPSAHWSDSAEYFCAVS
Equus caballus V223 trav ATDM01090946.1 5480 VNGQQIQQIPPSLLLQEGENFTMYCNSSSTFNSLQWYKQRPGGSPAFLMILVKGGQLERRERLTARFGETRKHSSLHITAAQTADVGTYFCAE
Equus caballus V224 trbv ATDM01092022.1 3662 PMDAGITQKPRYHITQTGGKTILECSQNMSHFAMFWYRQDPGQGPRLIHYSSGVNSTAKGDITEGYSVSRKKIEDFPLTLESASTKQTSLYLCASSE
Equus caballus V225 trav ATDM01092685.1 1202 VNSQQGQQNLQALSVQEGENATMNCTYKSSIDNLQWYRQDAGRGFSRLILIRSNEKHKPSGRLLVTLDTSSKSSSLSIMASRAADTATYFCAED
Equus caballus V226 ighv ATDM01093585.1 3980 VLSQVQLKKSGPGQVKPSQTLSLTCTVTGGSITSRYYGWSWIRQTPGKGLEYIGSITYSGSTYYSPSFKSRASISRDTSKNQFSLQLSSVTTEDTAVYYCAS
Equus caballus V227 trav ATDM01094162.1 4905 QSHGDSVTQMEGQMILSEGASLNMTCTCSARGYPALFWYLQYPGEGPQLLLSAKKDNEMARNKGFEATYNKEATSFHLVKASVLESDSAMYYCALR
Equus caballus V228 trgv ATDM01097032.1 3347 NQAAVSLEQPPSVTARLGSSAILPCVASTTVSYIHWYRHQEGKAPERLLLLAMFQSDVQWDSVVKADKVTAMEAKDGTSCTLSILKLEKSNEDVYYCAAWD
Equus caballus V229 trav ATDM01097158.1 3873 DQQQVKQSPQSLIIQEGEISTLNCTYVDSTFDYFPWYRQYPGEGPALLIAIHSARNKTEGGRFTVFFNKSAKQFSLTIKASQPGDSATYFCAAS
Equus caballus V230 trav ATDM01097475.1 3533 GVRGVKVEQSPSALSLQEGASSTLRCNFSITVNSVQWFRQNPEGGLINLFFTASVLKQSGKLNSTMNSKELYSTLHITASQVEDSATYLCAVE
Equus caballus V231 trbv ATDM01101823.1 2365 HMGAMVTQNPRYQITRKGNPVNLSCSQNLNHDTMYWYQQKPSQAPKLLFYYYDKEFNNETDTSNNFQSSRPNTSFCSLSIRSPGVGDSAVYLCASRD
Equus caballus V232 ighv ATDM01102049.1 451 VSSEVQLIQSGPELKKPGSSVKISCKASGYTFTEYAMHWVRQANGKGIEWMGSISPHDDDTSYAPKFQGRVTITVDKSTSTVYMELSSLTSEDTAMYYCAK
Equus caballus V233 ighv ATDM01104994.1 3399 VLSQVQLQESGPGQVKPSQTLSLTCTVTGGSITSSYSSWSWLRQPPGKGLEYMGYIYYDGRTYYNPSFKSRTSISRDTSRNQFSLQLSSVTAEDAAVYYCAR
Equus caballus V234 trdv ATDM01108513.1 757 STVAQTVTQGHTATSKQEGATVTLDCWYQTSWSTYYIFWYKQLPNGEMIFLIRQGSSSQNAKNGRYSINLEEAAKFITLTISSLQLEDSAKYFCALV
Equus caballus V235 trgv ATDM01109748.1 818 TQISPNLEGTQMSVTRQAGSSVEITCDIKQSSDYIHWYRFQKRMAPRHLLYYQFSSSKFVESGTSSQKYHAYEGPGRTCKLYIRFLEENDSGVYYCAVWE
Equus caballus V236 trav ATDM01113953.1 505 DARAQSVTQPDGHVLVSEGARLELKCTYSYDRAPALFWYVQYPSQGLQLLLKYFSGDTLVKGIKEFEAEFRKNESSFNLRKSAAHWSDSAVYFCVLS
Equus caballus V237 trdv ATDM01115324.1 341 SSNTQSVSQPTNVMYTRVGESVTLDCKITVSYSSYYMYWYRQLSSGEMTHIIQLHSLNRNSRDGRYSVVFQKPTLKLTISAVIPGDSAVYFCAV
Equus caballus V238 ighv ATDM01116288.1 488 VLSQVQLKESGPGLVKPSQTLSLTCTVSGLSLSSNAVGWVRQAPGKGLEYVGGIASSGSANYNPALKSRASITKDTSKSQVYLTLNSLTGEDTAVYYCA
Equus caballus V239 trav ATDM01116979.1 1919 VGAQIKVEQSPGVLIIQEGSNASLMCNCSNTMTSVQWFQQNPGGPLTALFYMTSQPQEKGRLKSTISTKDRYSHLYIRDSQPGDSATYFCAV
Equus caballus V240 iglv ATDM01121696.1 1860 SVASSMLTQPLTLSVAFGSTVTITCQGELLDSYYAEWYQQKPDQAPVLVIYYGSKRPSGISTRFSGSYSSKMATLTLSGALAEDEADYYCQVWDSSGNQ
Equus caballus V241 igkv ATDM01122660.1 638 STGDIVLTQSPASLTVSPGQSATISCTASQSVLSPPSYDLNWYQQKPGQGPKLLISSASKLKSGVPARFSGSGSGTDFTLTINPVEEADAANYYCQQGKESP
Equus caballus V242 trav ATDM01125469.1 1309 VSQGENVDQHPPSLSGQEEKSCVINCTYSDSYSTYFSWYKQEPGKGPQLIIDILSNVDKKENPRLTVLLNKTAKYLSLHIAATQPGDSAVYFCAV
Equus caballus V243 trav ATDM01125538.1 727 VSSKQQVEQSPEALSVQEGDSLALNCSYTDSTIYSLQWFKQVPGKGLASLLIQSKQGEETSGRMKASLDKSSKHSALYIAASQPGDSATYLCAV
Equus caballus V244 trav ATDM01125898.1 302 GTGAQSVTQPDDHITVSEGAPLELKCNFSYSTSLYFFWYVQYPSQGLQLLLKYITGDNRMVKGIKGFEAEFKKSETTFHLRKPLTYLNDSAEYFCALG
Equus caballus V245 trbv ATDM01133932.1 340 HMGAMVTQNPRYQITRKGNPVNLSCSQNLSHELMYWYQQKPSQAPKLLFYYYDKEFNNETDTSDNFLPSRPNTSFCSLSIRSPGVGDSAVYLCASR
Equus caballus V246 trbv ATDM01134309.1 527 SMDTKVTQRPGHLVKGKEQKAKMDCVPIKTHSYVYWYRRKLEGEFEFLVYLQNGKITDKIEGFDQQFSAQCPQDASCSLEIKSTEPGDSALYFCASSE
Equus caballus V247 trav ATDM01135122.1 1039 TVGQDVHHPSELTAMEGAFVQVNCTYQTSGFNGLSWYQQHDGGAPIFLSYNVLDGWERKGHFSSFLSRSDTYSYLFLKELRVEDSASYLCAVS
Equus caballus V248 trdv ATDM01138211.1 497 KDVICNEVTQSPPELTVASGNKVTLFCTYKTAYSNPDLYWYRIRPDYSFQFILYRDNARSHDADFTQGRFSVQHGKTQKTFHLVISSVRTEDSAVYYCAIL
Equus caballus V249 iglv ATDM01141656.1 803 PVVSSAVTQPSEVSVALGQRATLTCQGSNFEFFSPSWYQQKPGQAPVLLININNERHSGIPERFSGSSSGDTSTLTISGAQAEDEADYYCLAVDALSSE
Equus caballus V250 trav ATDM01143793.1 584 GLSGEDQVEQSPQTLRPQEGDSISLNCSYTVSNFRGLLWYRQDPGKGPELLFLLSSVGKPEHKERIRATLFEKGSSLHITDSKPEDSATYLCAVE
Equus caballus V251 trbv ATDM01143849.1 871 LTEGGVTQSPRHMITGKGQAVALWCDPISGHRALYWYQQTLGQGLGLLISFEDEAVADDSQLPKHRFSAERSKGGDSPLQIKPAELGDSAMYFCASSL
Equus caballus V80 trbv AAWR02036055.1 88213 PLDTSVSQTPEYLISQVGNKKTLKCEQNLNHDAMYWYIQDSKKLLKIMFSYNNKQPIVNETASNRFSPEAPDKAHLHLHINSLEPGDSAVYFCASSK
Equus caballus V81 trbv AAWR02036055.1 95911 HMETGISQTPSHYIREMGQNISLRCEPISSHFYFYWYRQTLEKGVEFLISVYNKVPSEKADFLKDRFSAEMPDGSRFTLKIQPVQLGDSAVYLCASSL
Equus caballus V82 trbv AAWR02036055.1 105687 PVDSGVIQTPRHLIKAKGQQMTLRCSPISTHPYVYWYQQVLGQGPRFLIQYFDEKENDRGDSSDRFSGKQFSNYSSELKVSVLELVDSALYLCASSL
Equus caballus V83 trbv AAWR02036055.1 110729 AVNAGVTQTPKFHILETGQNTTLRCAQDMNHDSMYWYRQDLGHGLRLIRYSAGAGVTEKRDVPDGYRVSRSNTENFSLTLESATPSQTSVYFCASS
Equus caballus V84 trbv AAWR02036055.1 126226 HTDAGISQSPRHRVTERGQDAALKCDPISGHTYLYWYRQTLGQNLEFLTYFQDDLASDTSGMPNDRYSAKRPEGSSSTLKIQHAEQGDSALYLCASSS
Equus caballus V85 trbv AAWR02036055.1 135811 QVDAGAGITQSPHKITATGKRVTLTCHQTQKHDYMYWYRQDLGHGLKLIHYSYDILKTEEGEVPDGYNVSRSNIEDFPLTLESATPSQTSVYFCASSY
Equus caballus V86 trbv AAWR02036056.1 13249 PTDAGVIQTPRHQLTKMGQTVTLTCEPISTHDTVFWYRQTSVKGLEFLIYFRDQAPMDKTGMPNDRFSAEMPNGSFSTLKIQRTEPGDAAVYLCASSL
Equus caballus V88 trbv AAWR02036056.1 22909 GSRLDALISQHPGRGVCKNGTSVKITCFSMDFQARTMLWYHQLPKHSLTLMATSNHGSSATYQQGFTEAKFPISHPNQTFSNLMVMSVHPADSSLYFCGAS
Equus caballus V89 trbv AAWR02036056.1 29516 PLDTAVSQTPKYLISRVGNEKTLKCEQNLSHNAMYWYVQDSKKLLKIMFSYNNKQPIVNETASNRFSPHAPDNAHLNLHINSLEPSDSAVYFCASSQ
Equus caballus V90 trbv AAWR02036056.1 49295 AVDSGVTQTPRHLIKTKGQQVTLRCSPISGHPRVSWYQQALGQGPQFLFQYYMGRENGKGDIPDRFKGQQFSNYCSELTDSALYLCASSAAQPCR
Equus caballus V91 trbv AAWR02036056.1 58288 PVNAGVTQNPKFQVLGTGQNMTLRCAQDMNHSYMYWYRQDLRHGLRLIHYSRAANVTEKGDIPEGYRVSRPNTENFLFTVESATPSQTSVYFCASSY
Equus caballus V92 trbv AAWR02036056.1 67748 SMDAAVTQKPRYYITQTGHKMILECSQNMNHLSMFWYRQDPGQGPRPIHYSRGVNSTAKGDITEGYSVSRNKKEDFHLTLESASTKQTSLYLCASSKT
Equus caballus V93 trbv AAWR02036056.1 91398 QVDAGAGITQSPHKITGTGKMVTLTCHQTQNHDYMYWYRQDLGHGLRLIHYSNGIGSTDKGEVHDGYSVSRSSTENFPLTLESATPSQTSVYFCASSY
Equus caballus V94 trbv AAWR02036056.1 115726 PVDSGVTQTPRHLVKTRGQQVTLRCSPMSGHDTVSWYRQPLGQGLQFLIQYYRGEENGKGDFPGRFKGQQLDNYSSELNVSVLELVDSALYFCASSL
Equus caballus V95 trbv AAWR02036056.1 120938 PVNAGVTQTPRFQVLRRGENTTLRCTQDMNHNSMYWYRQDLGHGLRLIHYSVGADATANRDVPDGYRVSRSDTKNFSLMLESATPSQTSVYFCASS
Equus caballus V96 trbv AAWR02036056.1 133617 PMDAGITQKPRYHITQTGDKMILECSQTMSHLAMFWYRQDPGQGPRLIHYSADVNSTAKGDITEGYSVSRNKKEVFLLTLESATTKQTSLYLCASSK
Equus caballus V97 trbv AAWR02036056.1 143514 PMDAGITQKPRYHITQTGGKTILECSQNMSHFAMFWYRQDPGQGPRLIHYSSGVNSTAKGDITEGYSVSRKKIEDFPLTLESASTKQTSLYLCASSE
Equus caballus V98 trbv AAWR02036056.1 179352 HTVESAGVTQFPNHRVIEKKQAVTLRCDPISGHEALYWYRRAVGKEIKFLVYFLGEDKQDDSGMPNKQFSAERIGGTFSTLNIQHAELEDSGVYFCASSQ
Equus caballus V99 trbv AAWR02036056.1 181252 HMGAMVTQEPRYQVTRKGKTVTLGCSQNLSHEYMYWYQQKPSQPPKLLFYYYDKDFNNETDTSDNFQSSRPNTSFCSLSIRSPGMGDSAVYLCASKR
Equus caballus V100 trbv AAWR02036056.1 219139 PVDSGVIQTPRHVVKAKRQQVMLKCSPISEHDTVSWYQQALGQGPKFLIQYYNGEVREKGDIPDRFSGQQFGNRSSELNLTILELTDSALYLCASSL
Equus caballus V101 trbv AAWR02036056.1 223858 PVNAGVTQTPRFQILGTGQNTTLRCAQDMNHNSMYWYRQDLGHGLRLIRYSAGAGVTEEDGPDGYRVSRSDTKNFSLTLVSATPSQTSVYFCASSY
Equus caballus V102 trbv AAWR02036056.1 242200 STDAGVTQEPRHYVTKMRQAVTLTCEPVSNHTALFWYRQTSVKGLKFLIYLRNQAPIAQTGMPKDRFSAEMPNRSLSTLKIQHTEPGDSAMYICASSL
Equus caballus V103 trbv AAWR02036056.1 247785 PVDSGVTQTPRHLIKARGQQVTLRCSPISGHNRVFWYQQPLGQGPQFLFYYYNGKENEKGDVPARFSGQQFSDYRSELNVSVLELKDSALYLCASSS
Equus caballus V104 trbv AAWR02036057.1 4341 HTDTGVSQSPRHRVTKYGEDVAFRCDPISEHTRLYWYRQTPGQNMEFLTYFQNDFASDTSGMPSDRFSAERPKGSYSTLKIQRAEQRDSAVYLCASSL
Equus caballus V105 trbv AAWR02036057.1 20791 HTVESAGVTQFPNYRVIEKKQAVTLRCDPISGHASLYWYRRAVGKEIKFLVYFLRKDKQDDSGMPNERFSAERTEGTFSTLKVQHSELEDSGVYFCAGSQ
Equus caballus V106 trbv AAWR02036057.1 67178 PLDTAVSQTPKYLISQVGNKKTLNCEQTLGHNAMYWYKQDSKKLLKIMFIYYNKERDLNETVPSRFSPEAPDKAHLNLHVSSLEPGDSAVYFCASSQ
Equus caballus V107 trbv AAWR02036057.1 87229 PVDSGVTQTPRHLIKARGQQVTMRCSPISGHKSVFWYQQPLGQGPQFLVQYYNEKENEKADTANRFLGKQFSNYSSELNVSFLELTDSALYLCASSV
Equus caballus V108 trbv AAWR02036057.1 95916 AVNAGVTQTPKFHILETGQNTTLICAQDMNHDYMYWYRQDLGHGLRLIHYSRTSGVTEARDIPDGYRVSRSNTENFLLTLVSPTPSKTSVYFCASSY
Equus caballus V109 trbv AAWR02036058.1 10636 PVEAGVTETPRYLIKTTGQAVTLRCSTVSKHSGVSWYQQALSQDPHLLFEFYENVQRAKGEIPNRFSAQQLRDYRSELNVSVLELMDSALYLCASSV
Equus caballus V111 trbv AAWR02036059.1 12946 HTSAGVTQFPSHRVVEKKQSVTLRCDPVPGHQALFWYQRAVGKEITFLIYFLRENKQDESGMSNKRFSAERTNGTFSTLKIQPAELEDSGVYFCASSQ
Equus caballus V112 trbv AAWR02036059.1 19595 ALDAEVTQTPGHLVEGKEQKVKMYCVPKKGHSYVFWYQQNLAKKFKFLISFQYENIFGETEMPKERFSAECPPNSPCSLEIPPTELQDSAVYLCANSE
Equus caballus V113 trbv AAWR02036059.1 26367 PIDSGVTQEPRHQVTKMGQDVTLRCEPISSHTDLFWYRQTSVQGLEFLIYFSNQAVIDQTGMPKDRFSAEMPNRSFSTLKIQHTEPRDSAVYLCASSL
Equus caballus V114 trbv AAWR02036059.1 42439 PVDSGVTQTPKHLIKAKGQQMTLRCSPISTHLSVYWYQQALGQGPQFLIQYYDGEEREKGNISGRFSGQQFRDRSSELNVSILELTDSALYLCASSL
Equus caballus V115 trbv AAWR02036059.1 47412 AVNAGVIQTPKFQVLKTGQNTTLRCTQDMNHDSMYWYRQDLGHGLRLIHYSVGAGVTANRDVPDGYRVSRSNTENFPLILVSATPSQTSVYFCASS
Equus caballus V116 trbv AAWR02036059.1 68752 HTDAGVSQSPRHRVTERGQDVAFKCDPISGHTHLYWYRQTRGQGLEFLMYFQDDFASDTSGMLKDWFSAERPEGSSSTLKIQHAEQGDSAVYLCQQL
Equus caballus V117 trbv AAWR02036059.1 75003 PADAGVIQFPKHLIKGMGGNAVLKCYPSSGHSSVCWFQQALGQGPQFLIKYYEKEQGEKRNIPDRFSAQQFSDYSSELDVSSLELEESALYLCASSS
Equus caballus V118 trbv AAWR02036060.1 4118 LTEGGVTQSPRHMITGKGQAVALWCDPISGHRALYWYQQTLGQGLGLLISFEDEAVADDSQLPKHRFSAERSKGGDSPLQIKPAELGDSAVYFCASSL
Equus caballus V119 trbv AAWR02036060.1 12272 HMGAMVTQNPRYQITRKGNPVNLSCSQNLSHELMYWYQQKPSQAPKLLFYYYDKEFNNETDTSNNFQSSRPNTSFCSLSIRSPGVGDSAVYLCASR
Equus caballus V120 trbv AAWR02036060.1 16770 VLDAAVTQTPGQLIKGKEQKVKMYCVPKKGHPFIFWYQQNLAKEFKFLISFQNENILEETEMPKERFSAECPPNSPCSLEIHPTELQDSAVYLCASGE
Equus caballus V121 trbv AAWR02036060.1 29821 TMDGGITQSPKSLFREEGRDVTLECEQNLDYSAEYWYRQDLGQGLRLIYYSHIVNAVQKGDVSEGHRASQEKKAFFPLTVTSTQKNQTALYLCASSRDAVKN
Equus caballus V122 trbv AAWR02036060.1 35681 GLGLGALVSQHPSKAICMNGTSVKIECRAMDFQAQTMFWYRQLPKQGLTLMVASSDNSSITYEQGFTRAKFPINHLNRTFSTLTVMSVHPADSGLYFCSAS
Equus caballus V123 trbv AAWR02036060.1 52988 SMDTKVTQRPGHLVKGKEQKAKMDCFPIKTHIHVYWYRRKLEGEFEFLVYVRNGEITDKIEGFDQQFSVERSQDERYSLEIKSTEPGDSALYFCASSE
Equus caballus V124 trbv AAWR02036060.1 72644 SMDTKVTQRPGHLVKGKEQKAKMTCVPIKAHIHVYWYRRKLEGEFEFLVYLQNNDVIDKIEGFDQQFSAQCPKNASCSLEIKSTEPGDSALYFCASSE
Equus caballus V126 trbv AAWR02036060.1 102444 SMDTKVTQRPGHLVKGKEQKAKMDCVPIKTHSYVYWYRRKLEGEFEFLVYLQNGKITDKIEGFDQQFSAQCPQDASCSLEIKSTEPGDSALYFCASSE
Equus caballus V127 trbv AAWR02036061.1 11989 SGLGALVSQQPSRAVCKNGSSVKIDCRPVDFQAQIVCWYRQLPNQGLTLIAISNQGSDPTYEQDFPKVKFPISHPDRTISTLTIMSAHPADSSLYFCGAS
Equus caballus V128 trbv AAWR02036062.1 11003 GSGLGVLVSQHPSRAICKNGSSVEMECRTVDLQAQTVCWYQQLPNQGITLIATSNQGSDPTYEQGFPEVKFPISHPNLTFSTLTILSAHPANSSLYFCGAS
Equus caballus V129 trbv AAWR02036062.1 24046 GLGLGALVFQHPSRAICKNGTSVKIECHPQGLQLPTVFWYRQLPKQGLTLIATSNKGSKATYEEGFDEAKFPINYHNETFSTLTVTSAHPADSSLYFCSAS
Equus caballus V130 trbv AAWR02036062.1 35522 SMDTKVTQSPGHLVKGKEQKAKMDCVPVKTHSYVYWYRQKLEGEFDFLVYLGNGKITDKIEGFDQQFSAQCPQDASCSLEIKSTEPGDSALYFCASSE
Equus caballus V131 trbv AAWR02036062.1 40892 SVDANITQTPGHLVKSKGQKARMDCMPQKGHTSVYWYQQIQKKEFKFLIYLEDGQVLDQIELVKERFSPQCPKNLTCSLEIKSSEPGDLALYFCASSR
Equus caballus V132 trbv AAWR02036062.1 54165 LMDADVFQTPKHCVTGTGKKITLECFQSMNHDNMYWYRQDAGRELQLLHYSYGVNNTEKGDVPSESTVSRLRKDRFSLTLESASPSQTSLYLCASS
Equus caballus V133 trbv AAWR02036064.1 1612 PMDAKVIQTPRHLITETGKKLTVNCSQDMNHDAMYWYRQDPGLGLKLIHYSTNVEVLYNGDVPDGYTVSRKDKGNFSLTLESASINQTSLYLCASSE
Equus caballus V134 trbv AAWR02036065.1 10675 LMEAKVTQAPRHLIEETGKKLTVNCSQDMNHDTMYWYRQDPGLGLKLIHYSINEILYKGDVPDGYAVSRKDTGEFPLTLESASINQTSLYLCASSE
Equus caballus V135 trbv AAWR02036065.1 22708 FMDATVTQTERYLVKRRGDKVVMHCQQNMDHNSMFWYRQDPALGLQLLHFSYRIDDEQKGDAPEGYSVSRKKKENFTLILESASTNQTSVYLCASSF
Equus caballus V136 trbv AAWR02036065.1 28910 FMDTNVTQTPRYLVKRIREKVVMECSQNMDHETMLWYRQDPALGLQLLHFSIGIDDKQEGDAPEGYSVSRKKENFTLILESASTNQTSVYLCASSL
Equus caballus V137 trbv AAWR02036065.1 35923 FMDATVTQTERYLVKRRGDKVVMDCQQNMDHNSMFWYRQDPALGLQLLYFSDSVGDKQEGDDPEGYSVSRKKKENFTLILEPASTNQTSVYLCASSF
Equus caballus V138 trbv AAWR02036065.1 42363 SVFGALLSQKPSRAICQRGTTMKIQCEVDTEVNLMFWYSQLPGQSLTLIATANQGSEATYESGFTKDKFPISRPTLRFSTLTVNNTSPEDSSFYFCSAG
Equus caballus V168 iglv AAWR02038292.1 92698 SWAQSGLTQEASVSGSVGQKVTLSCAGNSNNVGIFDVGWYQISHSAPKTVMLRSSRPSGIPARFSGSKSGNTAYLTISGLQPEDEADYYCSAWDDSISN
Equus caballus V169 iglv AAWR02038292.1 103169 VDSQMVVTQEPSLSLSSGGMVTLTCGLSSGSVSSGYDPSWYQQTPGQVRCTLIYSTNSRLSGVPNHFPGSISGNKATLTTTGAQPEDEADYYCALVMGS
Equus caballus V170 iglv AAWR02038297.1 22943 SWAQSLTQPASVSGTLGQTVTISCSGSSSNIGYSYSAVGWYQQIPGTAPKTLIYGNNKRASGVPDRFSGSKSGNTATLTISGLQAEDEADYYCGSYYSSDSS
Equus caballus V171 iglv AAWR02038302.1 28064 SWAQSLTQPASVSGTLGQTVTISCSGSSSNIGYSYSAVGWYQQIPGTAPKTLIYGNNKRASGVPDRFSGSKSGNTATLTISGLQAEDEADYYCGSYYSSDSS
Equus caballus V172 iglv AAWR02038302.1 68246 SWAQSVTQPASVSGTLGQTVTITCTGSSSNIVAYVGWYQQIPGTAPKTLIYANNKRASGVPDRFSGSKSGSTATLTITGLQAEDEADYYCGTSSSSGSS
Equus caballus V173 iglv AAWR02038303.1 3383 SRAQSVTQPASVSGTLGQTVTISCSGSSSNIGSGHVSWYQQIPGTAPKRLIYSSASRASRVPDRFSGSRSGNTATLTISGLQGEDEADYYCGTLYSSWSS
Equus caballus V174 iglv AAWR02038305.1 4306 SWAQSLTQPASVSGTLGQTVTISCSGSSSSIGSYMGWYQQIPGTAPKTLIYATNKRASGVPDRFSGSKSGNTATLTISGLQAEDEADYYCGSYYSSDSS
Equus caballus V175 iglv AAWR02038305.1 41708 ADSQAVVIQDPSFSVSLGGTVILTCGLRTGSVSTSNYPRWYQQTPGKAPRTLTYSTNNRPSGIPERFSGSISGNKAALTITGAQPEDEADYYCDLYVDRGV
Equus caballus V244 ighv AAWR02042582.1 100620 VLSQVQLQESGPGQTNPSQTLSLTCTVTGYSITSGYGWNWIRQPPNKGLEWMGSISYSGRTNYSPSLRSRITISRDTSKNQFLLQLSSVTTEDTAVYYCAT
Equus caballus V245 ighv AAWR02042582.1 110009 CLCFSGVQSEVQPVKPGGGSLRLSCAASGFTFSSYAMSWVRRAPGKGLQWVAGINSDGGGTHYADSMKGRFTISRDNAKNTVYLQMNSLRDEDTAVYYCAT
Equus caballus V247 ighv AAWR02042584.1 19913 ALSQISLQESGPGLLKPTQTLTLTCSFSGFSLTTSDIGVGWMRQPPGKALEWLTYVWWTDEKHYNPSLKSRLTISKDTSKNQVMLTMTSLDPPDTATYYCVKR
Equus caballus V248 ighv AAWR02042584.1 34963 VLSQVQLQESGPGLVQPSQTLSLTCTVTGGSITSSYSSWSWLRQPPGKGLEYMGYIYYDGRTYYNPSFKSRTSISRDTSRNQFSLQLSSVTTEDAAVYYCAR
Equus caballus V250 ighv AAWR02042584.1 54596 VSSEGQLEQSGPELKKPGSSVKISCKASGYTFSSYAVHWVRQANGKGIEWMGSIYAEYDDTSYAPKFQGRVTMTADKSTSTVYMELSSLTSEDMAVYYCAT
Equus caballus V251 ighv AAWR02042584.1 89902 VSSEVQLVQSGAEVRKPGASVKVSCKASGDSFTYYSMSWVRQAPGQGLDWMGGILPIVDDTSYTQKFQGRVTMTADKSTSTVYMELSSLTSEDTAVYYCAK
Equus caballus V252 ighv AAWR02042584.1 116483 VLSQVQLKESGPGLVKPSQTLSLTCTVSGLSLSSYAVGWVRQAPGKGLEYVGAIYGSASANYNPALKSRASITKDTSKSQVYLTLNSLTGEDTAVYYCA
Equus caballus V253 ighv AAWR02042584.1 133087 VLSQVQLKESGPGLVKPSQTLSLTCTVSGLSLSSNAVGWVRQAPGKGLEWVGVIYGSESTYYNPALKSRASITKDTSKSQVYLTLNSLTGEDTAVYYCAG
Equus caballus V254 ighv AAWR02042584.1 158903 VLSQVKLQESGPGLVKPSQTLSLTCSVSGVSITSSGDWWSWIRQPPGKGLEWMGYISYSGSAYYTTSLKSRLSISRDTSKDQFSLQLSSVTTEDTAVYYCAS
Equus caballus V255 ighv AAWR02042584.1 201693 VLSQVQLKESGPGLVKPSQTLSLTCPVSRFPLTNHHVHWTHQAPGKGLEWLGDSRSGESTYYNLTLKSQLSIPSDTSKSQIYLTLNRLRGDDMAMYYCAR
Equus caballus V256 ighv AAWR02042584.1 209401 VQCEVQLVESGGGLVKPGGSLRLSCAASGFTFDDYALHWVRQAPGKGLEWVSFISWSGGSTHYADSVKGRFTISRDNAKNTLYLQMNSLRDEDTAVYYCAK
Equus caballus V257 ighv AAWR02042584.1 227833 VSSEVQLVQSGAEVKKPGASVKVSCKASGDSFTYYSMSWVRQAPGQGLEWTGYIYPEYDAMGYPQKFQGRVTMTADKSTSTVYMELSSLASEDTAVYYCAT
Equus caballus V275 trav AAWR02043527.1 1343 VGAQVKVEQSPGVLIIQEGSNASLMCNCSNTMTSVQWFQQNPGGPLTALFYMTSKPQEKGRLKSTISTKDRYSHLYIRDSQPGDSATYFCAV
Equus caballus V276 trdv AAWR02043529.1 12095 SSNTQSVSQPTNVMSAQVGKSVILDCKITVSYTYYNMYWYRQLSSGEMTHLIRLYSANRNSRQGRYSVVFQKPTLKLTISALTPGDSAVYFCAV
Equus caballus V277 trav AAWR02043530.1 5715 GVQGVKVEQSPSALNLHEGTSSTLRCNFSTTVYSVQWFRQNPGNGRISPFFMTSGMKQNRRLSSTMNSKEVCSTLHFTDSQVEDSATYLCAVE
Equus caballus V278 trav AAWR02043530.1 15554 SSIAQKVTQVQPAMLVQEKEVVTLNCRYDTSDTTYSLFWYKQSSSGAMMFLIRQDSYNQQNAAEGRYSLNFQKANKSINLVISAAQLEDSAVYFCALSE
Equus caballus V283 iglv AAWR02044311.1 473 SWAQSALTQPASVSGTLGQSVTISCAGSSSNIGSYNYVSWYQQHPGTAPKLLIYSVSSRASGIPDRFSGSKSGNTASLTISGLQAEDEADYFCS
Equus caballus V284 ighv AAWR02044594.1 1877 VLSQVQLKESGPGQVKPSQTLSLTCTVTGGSITSRYYGWSWIRQTPGKGLEYIGSITYSGSTYYSPSFKSRASISRDTSKNQFSLQLSSVTTEDTAVYYCAS
Equus caballus V285 ighv AAWR02044595.1 571 VLSQVQLKESGPGLVKPSQTLSLTCTVSGFSLSSYAVGWVRQAPGKGLEYVGAIYGSASANYNPALKSRASITKDTSKSQVYLTLNSLTGEDTAVYYCAK
Equus caballus V286 ighv AAWR02044886.1 11953 VLSQVQLKKSGPGQVKPSQTLSLTCTVTGGSITSRYYGWSWIRQTPGKGLEYIGSIAYSGSTYYSPSFKSRASISRDTSKNQFSLQLSSVTTEDTAVYYCAS
Equus caballus V287 trav AAWR02045448.1 1987 VGAQIKVEQSPGVLIIQEGSNASLMCNCSNTMTSVQWFQQNPGGPLTALFYMTSKPQEKGRLKSTISTKDRYSHLYIRDSQPGDSATYFCAV
Equus caballus V330 trav AAWR02001650.1 15559 TVGQDVHQPSELTGMEGAFVQVNCTYQTSGFNGLSWYQQHDGGAPIFLSYNVLDGWERKGHFSSFLSRSDTYSYLFVKELRVEDSASYLCAVS
Equus caballus V331 trav AAWR02001650.1 93448 GLRAQSVTQPDDLVTITEGNPLTVKCTYSISGSPYLFWYVQYPNQGLQFLLRYISGDNLVKGSYGFEAEFNKSQTSFHLKKPSVLGSDSAVYFCAGS
Equus caballus V332 trav AAWR02001650.1 102469 TLSLAKTTQPIFSDSYEGQEVNITCNHTDIATNEYILWYRQFPNQGPQFVIQGFNTKVENEVASLFIPDDRKSSTLSLPQATLRDTAVYYCIVS
Equus caballus V333 trav AAWR02001650.1 115494 GTGAQSVTQPDVHVTVSEGAPLELRCNYSSSVSLYLFWYVRYPNQGLQLLLKYTSGNSLVPGIKGFKAEFRKNETSFHLKKPSAHWSDSAEYFCAVS
Equus caballus V334 trav AAWR02001650.1 126160 GSNEEMVTQTDGLVTFPKGPLLTLNCTYQTSDSVFLLWCVQYYNKAPKLLLNYSFLSSTENQWTERQGFQANHVKSDGSFYLQKPSVQMSDSTVYYCDLR
Equus caballus V335 trav AAWR02001650.1 132408 DARAQSVTQPDGHVLVSEGSSLDLRCSYSYGATPYLFWYVQYPRQGLQLLLKHLSGQDTRVPGIKGFEAEFRKSNSSFNLRKSSAHWSDSAEYFCALS
Equus caballus V336 trav AAWR02001650.1 149481 QIYGDSVTQMEGQMTLSEGASLKMNCTYSTTTYVALFWYVQYPREGPQLLLRATTANEKGRNKGFEATYNTETTSFHLEKASVLESDSAMYYCAMS
Equus caballus V337 trav AAWR02001650.1 168229 VSQGENVDQHPPSLSVQEEKSCVINCTYSDSYSTYFSWYKQEPGKGPQLIIDILSNVDKKENPRLTVLLNKTAKYLSLHIAATQPGDSAVYFCAV
Equus caballus V338 trdv AAWR02001650.1 175219 SSICQKVTQSQPAMSVQEMEAVTLNCTYDTSSGTYSLFWYKQPSSGAMIFLIRQDSYQQNATEGRYSLNFQKAKKSINLVISAAQLEDSAVYFCALIE
Equus caballus V339 trav AAWR02001651.1 7897 QTHGESVTQMEGQVTLSEGASLTVNCTYSATGYPILYWYVQYPGEGPQLLLRAAKANEKGKNKGFEATYKTETTSFHLEKASVQESDSAMYYCAVS
Equus caballus V340 trav AAWR02001651.1 18992 GVRGVKVEQSPSALSLQEGASSTLRCNFSITVNSVQWFRQNPEGGLINLFFTASVLKQSGKLNSTMNSKELYSTLHITASQVEDSATYLCAVE
Equus caballus V341 trdv AAWR02001651.1 27817 SSSAQKVTQDQSSMLVQEKEAVTLNCRYDTSSSSYSLFWYKQSSSGVMMLLIRQDSYNQQNATEGRYSLNFQKANKSIQLVISTSQLADSAVYFCALIE
Equus caballus V342 trav AAWR02001651.1 33504 QTYGESVTQMEGQVTLSEGASLTLNCTYSTTGYPTLFWYVQYPGEGPQLLLRATKANKKEPSKSFEATYNTETTSLHLEKASVQESDSAMYYCAMS
Equus caballus V343 trav AAWR02001651.1 50530 GTRAQSVTQPDVHITVSEGAPLELKCRYSSSLPSSLFWYVQYPNQGLQLLLKYTSGNSLVSGIKSFEAEFKKSDTSFHLRKPSAHWSDSAEYFCVLV
Equus caballus V344 trav AAWR02001651.1 57884 GARAQTVTQPEDRISVVEGAPVQVKCSYSSSVSPYLFWYVQYPNQGPQLLLKHTSVESIKGFTANLNKGEKSFYLKKPSAQKEDSAMYYCALS
Equus caballus V345 trav AAWR02001651.1 84176 GTKGDSVNQTEGPVTLSEGAPVILNCTYQTTYSASFLFWYVQYLNKSPQLLLKSSTGNQRTEPQGFQANHVKSDSSFHLRKPSVQMSDSAVYYCAVR
Equus caballus V346 trav AAWR02001651.1 96520 LSGDEVEQSPQTLRRQEGDSLSLNCSYTVSYFRGLQWYRQDPGKGPELLFLLSSAEREKEKERLRATLSKNGSSLHITAPKPEDSATYLCAVE
Equus caballus V347 trav AAWR02001651.1 107720 VSSKQQVEQSPEALSVREGDSLALNCSYTDSAILFLQWFRQDPGKGLTSLLLIQSNRREQISGRMKVSLDKSSRHSALYIAASQPGNSATYLCAV
Equus caballus V348 trav AAWR02001651.1 110500 GTGDQSVTHPDVHITVSEGAPLEVRCNCSSFVLPDLFWYVQYPNQGLHLLLKYTSRNSVVSEIQNFEAEFKKSDTSFHLRKSSTHWSDSTKYFCAPS
Equus caballus V349 trav AAWR02001651.1 116158 VRGAQVEQSPPALSLQEGASSTLRCNFSISVKNVQWFRQHPGGRLIDLFYIPSGEKQSGRLNAMTVMKERRSSLYISSSQTTNSAIYFCAVKPQC
Equus caballus V350 trav AAWR02001651.1 128916 KSDQQQVKQSPQSLIIQEGEISILNCTYENSAFDYFPWYRQYPGEGPAFLIAIHSIVSTKEDGRCTVSFNKSTKQFSLTITASQPGDSSTYFCAAS
Equus caballus V351 trav AAWR02001651.1 171801 GLRAQSVTQPKDQITVAEGNPLTVKCTYSFSGSPYLFWYVQYPNQGLQFLLKYITGDSLVKGSYGFEAEFNKSQTSFHLKKPSVLGSDSAVYFCAGS
Equus caballus V352 trav AAWR02001651.1 179735 TLSLAKTTQPIFIDSYEGQEVNITCNHTNIATNEYILWYRQFPNQGPQFVIQAFKETVKNEVAILFIPDDRKSSTLSLPLATLRDTAVYYCIVN
Equus caballus V353 trav AAWR02001651.1 187450 GTGAQSVTQPDVHITVSEGAPLELRCNYSSSVSLYLFWYVQYPNQGLQLLLKYTSGNSLVPGIKGFKAEFRKNETSFHLKKPSAHWSDSAEYFCAVS
Equus caballus V354 trav AAWR02001651.1 203293 DARAQSVTQPDGHVLVSEGARLELKCTYSYDRAPALFWYVQYPSQGLQLLLKYFSGDTLVKGIKEFEAEFRKNESSFNLRKSAAHWSDSAVYFCVLS
Equus caballus V355 trav AAWR02001651.1 218780 DARAQSVTQPDGHVLVSEAASLELRCTYSYGATPYLFWYIQYPNQGLQLLLRYFSGDTLVEGIKGFKAELKKNESSFNLRKSSAHWSDSAEYFCAVS
Equus caballus V356 trav AAWR02001651.1 230070 QTYGDSVTQMEGQVTLSEEASLTINCTYSATGYPTLFWYVQYPGEGPQLLLRATTPNKKETNKGFEATYNKESTSFHLEKASVLESDSAMYYCAMS
Equus caballus V357 trav AAWR02001651.1 249480 VRSQEVEQSPQSLIIQEGENVTINCSFSKTLYALHWYWQKHGEGPIFLMMLMKDGDEKSHDRIAAILNEKNQQSSLFITASQCSHSGTYFCGVE
Equus caballus V358 trav AAWR02001651.1 268680 IMSDSKTTQPNAMECAEEEPVHLPCNHSTISGNEYIYWYRQIPHQGPVYMIHGIKNNVTNGMLSLTMTADRKSSTLILPQVTLRDAAVYYCIVRK
Equus caballus V359 trav AAWR02001651.1 290535 IVGDAKTIQPNAMESTEKETVHLPCNHSTIGGSEYIYWYRQIPYQGPEYVIHGLKSTETNGMASLTITTDRKSSTLILPQVTLRDTAVYYCMLRE
Equus caballus V360 trav AAWR02001654.1 7877 GLSGEDQVEQSPQTLRRQEGDSLSLNCSYTVSYFRGLQWYRQDPGKGLEFLFLLSSVGKPEHKERIRATLFEKGSSLHITDSKPEDSATYLCAVE
Equus caballus V361 trav AAWR02001654.1 19041 VSSKQQVEQSPEALSVREGDSLALNCSYTDSAIYSLQWFRQDPGKGLASLLLIQSNQREQISGRMKASLDESSRHSALYIAASQPGDSATYLCAV
Equus caballus V362 trav AAWR02001654.1 22284 GTGAQSVTQPDVHMTVSEGAPLKLRCNYSTSLPPCLFWYVRYPNQGLQLLLKYRSENNLVSGIKGFEAELNRSDTSFHLRKSSAHWSDLAKYFCALS
Equus caballus V363 trav AAWR02001654.1 41329 AQQQVKQSPQSLIVQEGEISVLNCTYENSAFSYFPWYRQYPGEGPAFLIAIRSGSGVNTSEGRFTVSFNKSAKQFSLTITASQPEDSATYFCAAS
Equus caballus V364 trdv AAWR02001654.1 46534 STVAQTVTQSQTATSKQEGATVTLDCLYETNQSTYSLSWYKQLPNGEMIFLIGQDSSRQNAKSGRYSTNFWKEANFVSLTISSLQLEDSAKYFCALV
Equus caballus V365 trav AAWR02001654.1 53849 DQQQVKQSPQSLIIQEGEISTLNCTYVDSTFDYFPWYRQYPGEGPALLIAIHSVRNEIESGRFTVFFNKSTKQFSLTIKASQPGDSATYFCAAS
Equus caballus V366 trdv AAWR02001654.1 60689 STVAQIVTQGQTATSMQEGTTATLDCLYETSWSTYYIFWYKQLPNGEIVFLINQHSASQNAKNGRYSTNLQKAAKFITLTISALRLEDSAKYFCALY
Equus caballus V367 trav AAWR02001654.1 74257 VNGQQIQQIPPSLLLQEGENFTMYCNSSSTFTSLQWYKQRPGGSPAFLMILVKGGQLERRERLTARFGETRKHSSLHITAAQTADVGTYFCAE
Equus caballus V368 trav AAWR02001654.1 94730 VGAQMKVEQSPGVLILQEGSNASLMCNCSNTITSVQWFQQNPGGPLISLFYMTSKPQEKGRLKSTISTKDRYSHLYIRDSQPGDSATYLCAV
Equus caballus V369 trav AAWR02001654.1 103389 VEAQMKVEQSPGVLILQEGSNASLMCNCSNTMRSVQWFQQNPGGPLISLFYMTSKPQEKGRLKSTISTKDRYSHLYIRDSQPGDSATYFCAV
Equus caballus V370 trav AAWR02001654.1 121136 VSGQKKNMVQSPSILNVWERELAATICGYTDGALNYFSWYEKKAAKDSTLLKQIYSEVDRKQDKRFTEKVQQVSLRTAAAQPGDSALYFCAG
Equus caballus V371 trdv AAWR02001654.1 143289 SSNTQSVYQAANVMSAQVGESVTLDCKITVSYTYYNMYWYRQLSSGEMTHIIRLYSANRNSREERYSVVFQKPTLTLTISALTPGDSAVYFCAV
Equus caballus V372 trav AAWR02001654.1 159644 GVQGVKVEQSPSALNLHEGTSSTLRCNFSTTVYSVQWFRQNPGNGRISPFFMTSGMKQNRRLSSTMNSKEVCSTLHFTDSQVEDSATYLCAVE
Equus caballus V373 trav AAWR02001654.1 169469 SSIAQKVTQVQPAMLVQEKEAVTLNCRYDTSDTIYSLFWYKQSSSGAMMFLIRQDSYNQQIATEGRYSLNFQKANKSINLAISASQLQDSAVYFCALRE
Equus caballus V374 trav AAWR02001654.1 175302 QAHGDSVTQMEGQVILSEGASLNMTCTYSATGYPTLFWYIRYPGEGPQLLLSAKKDNEMGRNKGFEATYNKEAASFHLVKASVLESDSARYYCALS
Equus caballus V375 trav AAWR02001654.1 184126 VRSQQKGVEQSPGSLSVPGGDVASLNCTYSDSASQTFMWYRQYSGKGPELLMYTYSSGDEDKGRFTAHLNKAGQYVSLLIRDSQPSDSATYLCAV
Equus caballus V376 trav AAWR02001654.1 194542 VNSQQGQQNLQALSVQEGENATMNCTYKSSIDNLQWYRQDAGRGFSRLILIRSNEKRKPSGRLLVTLDTSSKSSSLSIMASRAADTATYFCAED
Equus caballus V377 trav AAWR02001654.1 214027 GLSGEDQVEQSPQTLRPQEGDSISLNCSYTVSNFRGLLWYRQDPGKGPELLFLLSSVGKPEHKERIRATLFEKGSSLHITDSKPEDSATYLCAVE
Equus caballus V378 trav AAWR02001654.1 225213 VSSKQQVEQSPEALSVQEGDSLALNCSYTDSTIYSLQWFKQVPGKGLASLLIQSKQGEETSGRMKASLDKSSKHSALYIAASQPGDSATYLCAV
Equus caballus V379 trav AAWR02001654.1 228407 GTRAQSVTQPDVHTTVSEGAPLELTCNCLSSLLLYLFWYVRYPNQGLQLLLKYRSENNLVLGIKRFEAEFKKSDTSFHLRKPSTHWSDSAKYFCALS
Equus caballus V380 trav AAWR02001654.1 232811 VRGAQVEQSPPALSLQEGASSTLWCNFSTSVSKLQWFHQNPGGRFISLFYLPSWTKWNGRLNATTVAKECHSSLHISSSQTTDSGIYFCAVEPQCSP
Equus caballus V381 trav AAWR02001654.1 247665 AQQQVKQSPQSLIIQEGEISVLNCTYEDSVFSYFPWYRQYPGEGPAFLIAIRSGSGVNTSEGRFTVSLDESAKQFSLTITASQPGDSATYFCAAS
Equus caballus V382 trdv AAWR02001654.1 252624 SSVAQTVTQGQTATSKQEGATVTLDCVYETSWSTYSLFWYKQLPNGEMIFLIRQDSSRQNAKSGRYSTNFWKEANFVSLTISSLQLEDSANYFCALV
Equus caballus V383 trav AAWR02001654.1 259941 DQQQVKQSPQSLIIQEGEISILNCTYVDSTFDYFPWYRQFPGEGPAFLIAIRSVRNEIEGGRFTVFFNESTKQFSLTITASQPGDSATYFCAAS
Equus caballus V384 trdv AAWR02001654.1 266816 STVAQRVTQGQTATSMQEGATVTLDCLYETSWSTYYIFWYKQLPNGEIIFLIRQSSASQNAKNGRYSTNLQKAAKFITLTISALRLEDSAKYFCALC
Equus caballus V385 trav AAWR02001657.1 24130 VGAQMKVEQSPGVLILQEGSNASLMCNCSTTMSRVQWFQQNPGGPLISLFYMTSQPQEKGRLKSTISTKDRYSHLYIRDSQPGDSATYFCAV
Equus caballus V386 trav AAWR02001658.1 2879 VEAQMKVEQSPGVLILQEGSNSSLMCNCSTIITSVQWFQQNPGGPLISLFYMTSKPQEKGRLKSTISTKDRYSHLYIRDSQPGDSATYFCAV
Equus caballus V387 trav AAWR02001658.1 12025 VGAQVKVEQSPGVLILQEGSNSSLMCNYSTSVSSVQWFQQNPGGPLIALFYMTSKPQEKGRLKSTISTKDRYSHLYIRDSQPGDSATYFCAV
Equus caballus V388 trav AAWR02001658.1 27571 DARAQSVTQPDGHVLVSEAASLELRCNYSYGAAVYLFWYVQYPRQGLQLLLKHFSGQDTRVPGIKGFEAEFRKSNSSFNLRKSSAHWSDSAEYFCAVS
Equus caballus V389 trav AAWR02001659.1 14801 GTRAQSVTQPDSHITVSEGAGLELRCNYSSSVSQFLFWYVQYPNQGPQLLLKYFSGPLLVKGIKGFEAELKKSETTFHLRKPSAHWSDSAEYFCALM
Equus caballus V390 trav AAWR02001659.1 17348 GARAQTVTQPEDRISVIEGAPVQVKCNYSYSGSPYLFWYVQYPKRGLQLLLKHTSGESIKGFTANLNNDEGSFHLKKPSAQEEDSAMYYCALS
Equus caballus V391 trav AAWR02001659.1 30197 GTNGDSVTQTEGPIVLLEGTRLTLNCTYQSIYSVSLFWYVQYQNKEPELLLKSSSENQEVDNRGFHTKLVTSDSSFHLQKPSVQMSDSAVYYCALR
Equus caballus V392 trav AAWR02001659.1 35768 VRGAQVEQSPPVLSLQEGASSMLRCNFSISVSNLQWFRQNPGGRLISLFYVPSGTQQNGRLNTTTVAKERHSSLNISSSQTTDSGIYFCAVEPQCSP
Equus caballus V393 trdv AAWR02001660.1 7354 STVAQRVTQGRTATSMQEGATVTLDCVYETSWSAYYIFWYKHLPNGEIVFLIRQDSYSPIAKNGRYSTNLQKAAKFITLTISSLRLEDSAKYFCALY
Equus caballus V394 trav AAWR02001660.1 21334 VNGQQIQQIPPSLLLQEGENFTTYCNSSSTFNSFQWYKQRPGGSPVLLIILLSGGEVQKQERLAAQFGETRKHSSLHITAAQTADVGTYFCAG
Equus caballus V395 trav AAWR02001660.1 27014 TVIDAKTTQPNSMDCAEGEDVKLPCNHSTVSVDDYIHWYRQNPSQSPQYIIHGLRDNVTNNKASLTIATDRKSSTLILPQVTLRDTAVYYCIVRK
Equus caballus V396 trav AAWR02001660.1 36586 GMGAQSVTQPDDHITVSEGAPLELKCNFSYSTSLYFFWYIQYPSQGLQLLLKYITGDNRMVKGIKGFEAEFKKSETTFHLRKPLTYLNDSAEYFCALG
Equus caballus V397 trdv AAWR02001664.1 17286 FSNTQSVDQPKREEYKREGESVTLDCTIVVSYTYYIMYWYRQASSGEMTHIINLDSNKKDSRQGRYSVVFRKPNLKLTISALTLRDSAVYFCAVEQA
Equus caballus V398 trav AAWR02001666.1 6504 GVRGVNVEQSPSALTLQEGTSSTLRCNFSTTVNNVQWFRQNPESGLINLFFTASGTEQKGRLNCTVNSKELYSTLHITSSQLEDSATYLCAV
Equus caballus V399 trav AAWR02001669.1 4889 VNSQQGEQNLQTLSIQEGENVTMNCSYKTTITNLRWYRQDAGRGLAQLILIRSNEREKPGGRLQVTLDTSSKSSSLSITASRAADSAAYFCAVE
Equus caballus V400 trav AAWR02001669.1 16063 DQQQVKQSPQSLIIQEGEISVLNCTYVDSTLDYFPWYRQYPGEGPVFLIAIRSVVSTEEGRFTVSFNKSAKQFSLTITASQPGDSATYFCAAR
Equus caballus V401 trdv AAWR02001669.1 23109 SSVAQRVIQLQTATSMQEGATVTLDCRYQTSWSTYYMFWYKQLPNGEIVFLIRQDPASQNAKNGRYSTNLEKATKFITLTISTLQLEDSAKYFCALC
Equus caballus V402 trav AAWR02001669.1 36250 TVIDAQTTQPNSIDCAEGEDVKLPCNHSTISVDDYIHWNRQNPSQSPQYIIHGLRDNVTNNKASLTIATDRKSSTLILPRVTLRDTAVYYCIVRK
Equus caballus V403 trav AAWR02001669.1 46059 GTGAQSVTQPDDHITVSEGAFLQLKCNYSYGGSLALFWYVQYPSQGLQLLLKYTTGDPLVKGIKGFEAEFKKSETTFHLRKPSAHLSDSAEYFCALR
Equus caballus V404 trdv AAWR02001670.1 19318 SSMAQKVTQAQIIITRQEGEAVTMDCKYEISWTSYDLYWYKLPPSGEMVFLIYQDYYKPSAKQGRFSVNFQSTQKSISLTISSLQSADSAMYFCALWI
Equus caballus V405 trdv AAWR02001670.1 44910 SSNTQSVDQPKKEEHKREGESVTLDCRITVSYAYYVMYWYRQASSGEMPHIIYLLSDSRNSRRGRYSVVFQRPNLKLTISALTLTDSAVYFCAV
Equus caballus V406 trav AAWR02001670.1 66357 VRSQQKGVEQSPGSLRVPEGDVASLNCTYSDRTSQNFMWYRQYSGKGPEFLVYAYSNNDKNEGKFIAQHSRAGQYISLLIRDSQPSDSATYLCAV
Equus caballus V407 trav AAWR02001671.1 2814 GARAQTVTQPEDRISVIEGAPVQVKCNYSYSLSPELFWYVQYPNQGPQLFLTHTSRKSIKGFTANLNKGEKSFHLKKLSAQKEDSAMYYCALS
Equus caballus V408 trav AAWR02001672.1 10607 AQQQVKQSPQSLIFQEGEISVLNCTYENSAFDYFPWYRQYPGEGPAFLIAIRSGSRVNTSEGRFTVSFNKSAKQFSLTITASQPGDSATYFCAAS
Equus caballus V409 trdv AAWR02001672.1 18323 SSVAQRVTQGQTATSMQEGASVTLDCRYETSQSTYSIFWYKQLPNGEIVFLIRQSSSSQDAKNGRYSTNLQKAAKFISFTISTLQLEDSAKYLCALQE
Equus caballus V410 trav AAWR02001672.1 33523 LNGQQIQQIPPSLLLQEGENFTMYCNSSSTLASFQWYKQRPGGSPVFLILVSGREVQKQERLAAQFGETRKDSFLHITAAQTADVGTYFCAGAQSSR
Equus caballus V411 trav AAWR02001672.1 39792 TVIDAKTTQPNSMDCTEGEDANLPCNHSSIGIADYIHWYRQNPSQSPQYIINGLQGNVTNNMASLTIATDRKSSTLILPRVTLRETAVYYCMLRE
Equus caballus V412 trav AAWR02001672.1 49564 GTGAQSVTQPDDHISVSEETSLELKCNYSSGNLYFFWYVQYPSQGLQLLLRYSSGPTLVNGIKGFEAELKKNETSFHLRKSSAHLGDSAVYFCAAS
Equus caballus V413 trdv AAWR02001672.1 66821 SSMAQKVTQAQTVITGKESEAVTMDCKYETSWSRHHLHWYKQPPSGEMIFLIYQDTDKPSAKQGRFSVNLQKTKKIISLTISSLQLADSATYFCALED
Equus caballus V414 trav AAWR02001672.1 94233 RSNGDSVTQTKGQVTLSEGALLTVNCSYETTQYPALLWYVQYPRKGPQLLLRASKANDKDRNKGFEATYNTETTSFHLEKASVQESDSAMYYCALS
Equus caballus V415 trav AAWR02001672.1 99243 SSIAQKVTQAQPAMLVQEKEAATLNCTYDTSDFSYSLFWYKQPSSGAMMFLIRQDSHKQQNATEGRYSVNFQKTDKSVNLVILDSQLQDSAVYFCALRE
Equus caballus V416 trav AAWR02001672.1 118728 GVRALKVEQSPSALSLQKGTSSTLRCNFSATVNRVQWFRQNPGSGLINLLFLTSVTKQNGRLNSTINTKELYSNLHITDSRLEDSATYLCAV
Equus caballus V417 trav AAWR02001672.1 125302 VSGKNQVEQSPPSLTILEGENCTFQCNYTVSPFNNLRWYKWDTGRGPVSLIIMSSSERRRSNGRYTATLDTANKGSSLHITAAQLSDAAVYICVVG
Equus caballus V418 trav AAWR02001672.1 137069 MRSQQKGVEQSPGSLRVPEGANASLNCTYSDSASQYFTWYRQYSEKGPQLLIYIYSNEDKNEGRFRAQHNKAGQYVSLLIRDSQPSDSATYLCAV
Equus caballus V419 trav AAWR02001673.1 5493 GARAQTVTQPEESTSVIEGAPVQVKCNYSSSGSPYLFWYVQYPNQGPQLLLKHTSGESIKGFTANLNKGEKSFHLKKLSAQEEDSAMYYCALS
Equus caballus V420 trav AAWR02001673.1 13999 VNSQKVEQNLQALSIREGENVTMNCSYETTITNLQWYRQDAGRGLALLILIRSHEKLKPGGRLQVTLDSSSKSSSLSITASRAADTATYFCAVE
Equus caballus V421 trav AAWR02001673.1 19257 GTNGDSVTQTEGPVILPEGALLTLNCTYQSSYSVFLFWYVQYQNKEPELLLKSSSENQEEDSRGFQAKLVTSDSSFHLRKASVQVSDSAVYYCALR
Equus caballus V422 trav AAWR02001673.1 47377 GTGAQSVTQPDVHITVSEGASLELRCRYSSSLPPYLFWYMQYPNQGLQLLLKYTSGNSRVSVIKGFEAELNRSDTSFHLRKSSGHWSDSAKYFCAVS
Equus caballus V423 trav AAWR02001673.1 86102 VNGQQIQQIPPSLLLQEGENFTTYCNSSSTLNRLQWYKQRPGGSPVLLMMVVTGGDVQKQERLTARFGETRKHSSLHITAAQTADVGTYFCAG
Equus caballus V424 trav AAWR02001673.1 93534 TVTDAKTIQPNSMDCAEGEDANLPCNHSTISGYDYIHWYRQNSNKSPQYIIHSLRDNVTNNIASLTIATDRRSSTLILPQVTLRDTAVYYCMLRE
Equus caballus V425 trav AAWR02001673.1 103490 GTRAQSVTQPDDHITVSEGNSLELRCNFSYSGTPYLFWYVQYPSQGLQLLLKDITRDTLVEGIKGFEAEFNKSETSFHLRKPSAHLGDSAVYFCAVS
Equus caballus V427 trdv AAWR02001674.1 59127 SSNTQSVSQPTNVMYTRVGESVTLDCKITVSYSSYYMYWYRQLSSGEMTHIIQLHSLNRNSRDGRYSVVFQKPTLKLTISAVIPGDSAVYFCAV
Equus caballus V428 trav AAWR02001674.1 76840 GVRGVNVKQNPPALSLQEGTSSTLSCNFSTTVYSVQWFRQNPGGSLISLFFMTSVMRQNGRLNCTLNSKELYSTLYIMASQPEDSATYLCAVE
Equus caballus V429 trdv AAWR02001674.1 98725 SSNTQSVSQPVSVMYTQEGESVTLDCKITVSYAYYNMYWYRQLPNGEMTHIIQIYSGSRNSREGRYSVEFQKPTLTLSISALTPRDSALYFCAIVKL
Equus caballus V430 trav AAWR02001675.1 14091 SSIAQKVTQAQPAMLVQEKEAVTLKCRYDTSDGRYSLFWYKQPSSGAMIFLIRQDSYNQQNATEGRYSLNFQKANKSINLAISASQLEDSAVYFCALME
Equus caballus V431 trav AAWR02001675.1 24747 QTHGNSVNQMEGPVTLSEGAFLTMDCTYSTTGYPTLLWYVQYPGKGPQLLLRATKAGEKGRNDGFEALYNEESTSFHLEKASVQESDSAMYYCVLG
Equus caballus V432 trav AAWR02001676.1 7946 GVLGVNVEQSPSALSLQEGTSSTLRCNFSTTVDNVQWFRQNPGGSLINLFVIVSDTKKNERLNGTVNSKELYSTLLITASQLEDSATYLCAV
Equus caballus V433 trdv AAWR02001677.1 20033 SSMAQKVTQDEATLTRQEGEDVTMNCTYEIYWRSHYNLYWYKQPASGEMVFLDYQDYYKPSGKQDRFSVDFQKEKNFISLTISPLQLVDSATYFCVLGI
Equus caballus V434 trav AAWR02001677.1 27508 FLNPSGTVGDAKTTQPNAMECTEEETVHLPCNHSTISGNEYIYWYRQIPHQGPEYVIHGLKKNETNEMASLTMTTDRKSSTLILPQVTLKDTAVYYCMLRE
Equus caballus V435 trdv AAWR02001677.1 42114 SSNTQSVFQPTNVMYTRVGESVTLDCKITVSYSYYYMYWYRQLSNGEMTYLIQLYSSRSSSREGRYSVAFQKPTLTLSISALTPGDSAVYFCAV
Equus caballus V436 trav AAWR02001677.1 53700 GVKGVNVEQSPSTLSLQEGTSSALRCNFSTTVRYVQWFLQNSGGNLISLFFVTSEMKNSGRLNATINSKELYSTLHITASQMEGSATYLCAVE
Equus caballus V437 trav AAWR02001677.1 62488 QTYGESVTQMEGQVTLSEGASLTVHCTYSAIVYPALYWYVQYPGKGPQLLLRATKANEKGSNKGFEATYNKETTSFHLEKASVQESDSAMYYCAV
Equus caballus V438 trav AAWR02001677.1 80581 VRSQQKGVEQSLGSLRVPEGANASLNCTYSDSASQTFMWYRQYSGKGPELLMYISSNKVKDEGRFTAQHSRAGQYVSLLIRDSQPSDSATYLCAV
Equus caballus V439 trav AAWR02001677.1 87821 GARAQTVTQPEDRISVIEGAPVQVKCNYSYSGSPDLFWYVQYPKQGLQLLLKHTSGESIKGFTANLNKSEKSFHLKKLSAQEEDSAMYYCALS
Equus caballus V440 trav AAWR02001678.1 2198 VNSQQEEWNFQALSVQEGENATMNCSYQTSIENLQWYRQDAGRGLARLILIGSNEKHKTNGRLRVTLDTSSKSSSLSITASRAADAATYFCAED
Equus caballus V441 trav AAWR02001678.1 7439 GTDGDSVTQREGPVILPEGAPLTLNCTYQSSYSFFLFWYVQYQNKEPELLLKSSSENQEEDSRGFQAKFVKSDSSFHLQKASVQVSDSAVYYCALR
Equus caballus V442 trav AAWR02001678.1 29907 GTNGDSVTQTEGPVILSEGAPVILNCTYQTSYSMPFLFWYVQYLNNAPQLILKSSTENQRTENQDFHATLIKSDSSFHLQKPSVQMSDSAVYYCALR
Equus caballus V443 trav AAWR02001678.1 42639 GLSAEDQVEQSPQTLRLQEGDSLSLGCSYRVSSFRGLQWYRQDPGKGPELLFLLYSVGEPKQKERLKATLSKMGSSLHITDCKPEDSATYLCAVE
Equus caballus V444 trav AAWR02001679.1 29517 VSSMLNVEQSPQLLHVQEGESTNFTCKFPSSSFYALHWYRWEPAKSPKILLIITVNGDEREEGRASATLNTNEGYSYFYIKGAQPEDSATYLCAS
Equus caballus V445 trav AAWR02001679.1 44922 TVIDAQITQPNSVDCAEGEDVNLPCNHSTIVREEYVYWYRQNPNQSPQFIIHGLRNNVTNNMASLTIATDRKSSILILPQVTLRDTAVYYCAVRE
Equus caballus V446 trav AAWR02001680.1 2211 GTRAQSVTQPDDHIIVSEGAPLELKCSYSYTGTPTLFWYIQYPSQGLQLLLGYFSGPTLVKGIKGFEAELKKNETSFHLRKQSAHLGDSAVYFCALR
Equus caballus V447 trdv AAWR02001681.1 14877 SSMAQKVTQTHTIMTRKEGESVTMDCKYELGWSNYYYALYWYKQLPSGELVFLIYQDSSKPSAKQGHFSVNFQSSKNFISLTISPLKLADSATYFCALWD
Equus caballus V448 trav AAWR02001681.1 24296 IIGDAKTTQPNAMDCTEEETVHLPCNHSTISGNEYIYWYRQIPHQGPEYVIYGLKSNVTNGMASLTITTDRKSSILILPQVTLRDTAVYYCIVRE
Equus caballus V449 trav AAWR02001681.1 42246 VSSQEVQQSPQSLNIREGEDFIINCNASKTLYAFHWYRQKHGEGLISLMVLQKSGEEIHYEKMTAKLDEKKQQSSLHITASQPSHSGIYLCGAE
Equus caballus V450 trav AAWR02001681.1 47096 VSGQQLNQSPQSVSVQEGEDVSMNCNSSSTLSTFLWYKQDVGEGLVLLIALYKIGEWTRNGKLAAQIARTRKDSFLNISVSEPKDAGTYFCAG
Equus caballus V451 trav AAWR02001681.1 63513 PGRADWIRPRETELSGTEGKTVNLLCNYGTSSRGFVDLYWYRQYPNQALEYILYRGWGYSGKGDASFATERFYSKTTANSTDLYIGNLEPADTAVYYCALR
Equus caballus V452 trav AAWR02001682.1 15202 SSMAQTVTQPQPEMSVPEAETATLNCVYDTSESNYYLFWYKQPPSGEMILIIRQEAYKQQNATNNRFSVNFQKADKSFSLRISDSQLEDAAVYFCAFMR
Equus caballus V453 trdv AAWR02001682.1 22048 SSMAQTVTQPQPEMSVHEAETATLNCVYDTSDSDYYLFWYKQPPSGEMILIIRQEAYKQQNATNNRFSVNFQKADKSFSLRISDSQLEDAAMYFCAFMR
Equus caballus V455 trdv AAWR02001683.1 61121 SSNTQSVNQPINVVYTQEGESVTFDCKITVSFSVYVVYWYRQLSSGEMTHLIHLRSDNKNTAEGRYSMVFQKSDIKFTISNLMHRDSGVYFCAVAEC
Equus caballus V456 trdv AAWR02001687.1 38400 VSVDIILEPVTKTLIVLAGETATFRCNITGGDLKNYRMSWYKKNEDNSLTLVYGPRNNSNDDLRKSFKGEINILKNQYILDIQKATTKDVGTYYCGSD
Equus caballus V476 igkv AAWR02003519.1 42862 CRGQIILTQSPETLAASQGSFISITCRSSIEVGTSMAWYQQKPNEAPRLLIFGASARAEGTPSRFRGSGSGSVFSLTIHGLEAKDFGVYYCQ
Equus caballus V477 igkv AAWR02003519.1 89949 STGDTVLTQTPLSLSVIPGESASISCKSSQSLLHGNGNTYLHWYLQKPGQSLQRLISMVSNRASGVPDRFSGSGSGTDFTLKISKLEAEDVGVYYCMQA
Equus caballus V478 igkv AAWR02003519.1 113239 SSADVVLTQTPLSLSVVPGEPASISCKSSQSLKYSDGKTYLYWFLQKPGQSPKLLIYLVSTRYSGVSDRFSGSGSETDFTLKISRVEPEDVGVYYCFQALYAS
Equus caballus V479 igkv AAWR02003520.1 15257 SSGDVVMTQTPLSLSVVPGEPASISCKSSQSLKHSDGKTYLYWFLQKPGQSPKCLIYLVSTRVSGVSDRFSGSGSETDFTLKISRGEPEDVGVYYCVQALYAS
Equus caballus V480 igkv AAWR02003520.1 39514 TRAEITVTQSPESMLVIPGDKVIITCKASQDIGDDVNWYQWKPGEAPKLIIKEATTLWSGVPSRFSGTVHGVDFTLTIEDVKSEDAAYYFCLQHDRIP
Equus caballus V481 igkv AAWR02003521.1 13536 SSGDVVMTQTPLSLPVVPGEPASISCKSSQSLLDSDGKTYLYWYLQKPGQSPKLLIYSVSNRDSGISDRFSGSGSGTDFTLKISRVEPEDVEVYYCVQA
Equus caballus V482 igkv AAWR02003521.1 27236 SSGEIVLTQSPAFLSGTPGEKATITCRANQGISNYLHWYQQKPNQPPKPIIKYVSESISGVPARFSGSRSGTDFTLTISRPEAEDAATYYCQHSYYHL
Equus caballus V483 igkv AAWR02003521.1 45390 ARCEIQMTQSPASLSASLGDRVTITCQATQGINTWLAWYQQKPGKALKFLISKATILHTGVSSRFSGSGTWTDFTLTISSLEPEDAATYYCQQYKSSP
Equus caballus V484 igkv AAWR02003522.1 10866 SSGDIVMTQTPLSLPVVPGELASNSCRFSQSLLHSNGNTYLHWFLQKPGQSPRRLTYRVSNRNSGVPDRFIGSGSGTDFTLKISKVEAEDGGVYYCSQG
Equus caballus V485 igkv AAWR02003522.1 70511 SSGDIVMTQTPLCLAVTLGEPVSISCRSSQSLLRSDDYTYLDWYLQKPGQSPRLLIYEVSKLVSGVSDRFSGSGSGTDFTLQISRVEAEDVGVYYCMQG
Equus caballus V864 trgv AAWR02031700.1 179671 TQVSSNLEGTQKPIIRQAGSSVQFTCDIKQSVTYVHWYRYQEGIALQRLVYYHYQYSRLMTDPGISSGKYHTFGGTDKNRNIEVRSLEERDSGVYYCAVWE
Equus caballus V865 trgv AAWR02031700.1 85557 GLGLTKVEQSQISISTEVKKSINIHCKITSSDFAGEYIHWYRQKPKKALEHLIYVSSTKSPARANLGGKKNKLEARKDSQTSTSILTVNFIENEDVAIYYCAGW
Equus caballus V866 trgv AAWR02031701.1 378054 TQESSNLEGTQISVTRQAGSSVPITCDILKRSDNYVHWYRYQEGMAPQRLLYYDFSSSKAVWDSGISSGKYHAYEAIGRTCKFLIENLEESDSGVYYCAVWE
Equus caballus V867 trgv AAWR02031701.1 330542 IQLSSNLEGTQMSVTRQAGSSVVITCDIKESSDYVHWYRYQNRMAPQRLLYYQFSSSNDVLDSEISSRKYHAYEGTGRTSKLLIKILEESDSGVYYCAAWE
Equus caballus V868 trgv AAWR02031701.1 314861 GLGLSDVEQSQISISTEVKKSINIHCKITSSDFEGDYIHWYRQKPKKALEHLISVSSTKSPARASLGGRKNKLEARKYSQTSTSVLTVNFIENEDVAIYYCAGW
Equus caballus V869 trgv AAWR02031701.1 249093 GLGLTKVEQSQISITKAVKKSVNIYCKITSSDFEGEYIHWYRQKPNKALEHLIYVRFTGSPALANLGGKKNKLEARKDSQTSTSMLTIHAIENEDVAIYYCAGW
Equus caballus V870 trgv AAWR02031701.1 188268 TQVSSNLEGTQMSVTKQAGSSVVITCDFKQSITYVHWYRYVEGMAPQRLLYYHYHSAKFVMEPGISSQKYRTYEGTGKNRKIEIRNLEERDSGVYYCAVWE
Equus caballus V871 trgv AAWR02031701.1 150638 TWISSNVEGTQMSITKQAGSSVVFTCDIKQRITYVHWYRHKEGIAPQRIVYYHHQDSRLVSDPGIRLERYRVYESTERNRKIEIRKLEQSDSGVYYCAIWE
Equus caballus V872 trgv AAWR02031701.1 99671 TQVSSNLEGKQMSLTRQAGLSAVITCDIEHTSKYIHWYQYQEGMAPRRLLYYQVFSSNVVVESGITSGKYHAYGGTGRTCKFSLENLEEGDSGVYYCAVWE
Equus caballus V873 trgv AAWR02031702.1 31341 TQVSSNLEGTQMSVTRQAGSSAVITCDIKQSNNYVHWYRYQEGTAPQRLLYYQLSSSKFVMDSGFSSQKYHAYAGTGKTCELLIKILEESDSGVYYCAVWE
Equus caballus V874 trgv AAWR02031705.1 2202 TQVSSNLEGTQMSVTRQPGSSVVITCDIKQSSDYVHWYRYQEGMAPQRLLYYQLSSSKVVVDSAFSSWKYHASKDTGGTYKLLIKFLDESDSAVYYCAVWE
Equus caballus V875 trgv AAWR02031709.1 272962 TQVSSNMEGIQMVFIRQAGSSVLITCDLKQSSDYIHWYQYQEGMAPRRLLYYQFSSSKVVVEPGIRSQKYQAYEGTGRTCKLYIQILEESDSAVYYCAAWE
Equus caballus V877 trgv AAWR02031709.1 249680 TQVSSNMEGTQMLVTKQAGSSVVITCDITQNSDYVHWYRYQEGMAPRRLLYYHFSSSKVVVESGISSQKYHAYGGTGRRCKLLIRILEGSDSGVYYCAVWE
Equus caballus V878 trgv AAWR02031709.1 195509 TQVSSNMEGIQIVFTRQAGSSVLITCDLKQSSDYIHWYRFQEGMAPRRLLYYHLSSSKVVVESGISSQKYQAYQGTGRTCNLYIQSLEESDSALYYCASWE
Equus caballus V879 trgv AAWR02031709.1 191756 TQVSSNMEGTQMSLTRQAGSSAEITCGIQQTSDYIHWYQHQEGTAPQRLLYYQLSSSKVVAASGITSRKYHVSRGTGMTCKLSIKNLEESDSAVYYCAAWE
Equus caballus V880 trgv AAWR02031709.1 140226 GLGLTKVEQSQISISTEVKKSIDIYCKITSSDFEGEYIHWYRQKPNEALEYVITVSSTKSPARANLGGKKNKLEARKDSQTSTAILTVNFIEKEDVAIYYCAGW
Equus caballus V881 trgv AAWR02031709.1 90292 TQVYSNLEGPQISVTKQARSSVVITCDIKQSSDYVHWYRYQEGTAPQRLLYYQFSSAKFVVDSGISSEKYHAFEDTGRTCKLFIKILEERDSAMYYCAAWE
Equus caballus V882 trgv AAWR02031712.1 85165 TSEDILITQLITSITKKKGNTAFLECKVKRDDLKKNAHIHWYRQKPGQPLRRILYISSNENVVHERGVSEDRYEARRRQGNPSASLRIHHVEEADAGLYYCACW
Equus caballus V883 trgv AAWR02031712.1 43721 TQVSSNLEGTQMLVTKQVGSSVEITCDIKQSSSYIHWYQYQEGMAPQRLLYYQLSGSRVVMDSGFSSWKYRAYEGSGRTYKLSIKLLEESDSGVYYCAVWE
Equus caballus V884 trgv AAWR02031712.1 16687 TQVSSNLEGTQMLVTKQAGSSVVITCDITQSSDYVHWYRYQEGMAPRRLLYYQFSSSKVVVDPGISSQKYNAYQGTGRTCKLYIKFLEESDSGVYYCAVWE
Equus caballus V885 trgv AAWR02031712.1 12737 HLGKPQLSSNKCLSKRSHIGCVVSHVTIYTMSIYWYQESPGQALLPLQHVSPDNTVRMESGILMGKFEVDEIPEPSASTLTTHSGGKEDSATYYCAFWK
Equus caballus V886 trgv AAWR02031714.1 37663 TQISPNLEGTQMSVIRQAGSSVAITCDIKQSSDYIHWYRFQKRMAPRHLLYYQFSSSKFVESGTSSQKYHAYEGPGRTCKLYIRFLEESDSGVYYCAVWE
Equus caballus V887 trgv AAWR02031714.1 35668 NQAAVSLEQPPSVTARLGSSAILPCVASTTVSYIHWYRHQEGKAPERLLLLAMFQSDVQWDSVVKADKVTAMEAKDGTSCTLSILKLEKSNEGVYYCAAWD
Equus caballus V888 trgv AAWR02031714.1 16009 GLGLTKVEQSQISISAEVKKSIDIHCKITSSNFEGEYIHWYRRKTYEALEHLIYVSSTKSPAQANLGGKKNKIEARKDSQTSTAILTVNFIENEDVAIYYCAGWY
Equus caballus V988 iglv AAWR02038173.1 44930 SWAQSVLTQPASVSGNLGQRVTISCTGSSSNTRDNYVNWYQQLPGTAPKLIIYENSKRPSGTPDRISGSKSGNPASLTITGLQAEDEADYYCQSYDDNLNA
Equus caballus V992 iglv AAWR02038307.1 71372 SVASSMLTQPLTLSVAFGSTVTITCQGELLDSYYAEWYQQKPDQAPVLVIYYGSKRPSGISTRFSGSYSSKMATLTLSGALAEDEADYYCQVWDSSGNQ
Equus caballus V993 iglv AAWR02038307.1 47982 SVISSELTQPPSVSVTLIQTVSTICQGEILKTYYANWYHQKPGQVSLLNIYKDNVRPSGISDRFTGSKSENTATLTIGGTQTEDEADYYCQSQDSSGN
Equus caballus V994 iglv AAWR02038308.1 89188 SLASSELTQPLGVSVALAQTATITCQGESIESYNANWYQQKPGQAPVLLIYANSERPSGIPERFSGSSSEGSATLTISGALAEDEADYHCQVFDFSGNE
Equus caballus V995 iglv AAWR02038308.1 60628 GCAVSSELTQPPSVSVAPGQTAMITCGGNNIGGKYSYWYQLKPGQAPVLVIYSDGKRPSEISSRFSGSNSGNMSALIIGGARTEDEADYYCAVADGSGSS
Equus caballus V996 iglv AAWR02038308.1 11891 SVTTYDLTQPHSTSVALGQTATITCSGDNLEDEYAYWYQQKTGQSPALVIYKDSEHPSGIPDRFSGSNSGNTATLTIRGAKTEDKADYYCQSWSSAN
Equus caballus V997 iglv AAWR02038309.1 118524 PVVSSAVTQPSEVSVALGQRATLTCQGSNFEFFSPSWYQQKPGQAPVLLININNERHSGIPERFSGSSSGDTSTLTISGAQAEDEADYYCLAVDALSSE
Equus caballus V998 iglv AAWR02038309.1 88231 PMASSEVTQPSAVSVALGQTATLTCQGDYYERYIVNWYQQKPGQAPVLVIYANSERPSGIPERFSGSSSLGTSTLTISGAQAEDEADYYCQPADAHRSE
Equus caballus V999 iglv AAWR02038309.1 73724 PVASSKLTQPSSVSVALGQTATITCKGGDFESFVGSWYQQKPGQAPVLVIDASNERPSGIPERFSGSSSGDTATLTISGAQAEDEADYYCLAADASDYE
Equus caballus V1000 iglv AAWR02038309.1 37981 PVVSSEVTQPTAVSVALGQTASITCQGSDFENYYASWYQQKPGQAPVLVINANNERPSGIPERFSGSSSGETATLTISGAHAEDEADYYCLATDAYVAE
Equus caballus V1002 iglv AAWR02038310.1 140827 SWAQSALTQPASVSGTLGQSVTITCAGSTGSYKYISWYQQHPGTAPKLLIYNGNNRASGIPDRFSGSTSGNTMSLTISGLQAEDEADYYCHAYVGSYN
Equus caballus V1003 iglv AAWR02038310.1 128129 SWAQSALTQPASVSGTLGQSVTISCAGSSSNIGSYNYVSWYQQHPGTAPKLLIYSASSRASGIPDRFSGSKSGNTASLTISGLQAEDEADYYCSSYINADP
Equus caballus V1004 iglv AAWR02038310.1 70378 SWAQSALTQPASVSGALGQSVTITCAGSSSDIGGYNAVSWLQQHPGTAPKVLIYSVNTRASGIPDRFSGSKSGNTASLTISGLQVEDEADYYCYSLVSG
Equus caballus V1005 iglv AAWR02038310.1 51311 SWGQSALVQPSSVSVALGQSVTISCAGSSSDIGYYNSISWYQQHPGTTPKLLIYYTNKKHSGIPDRFSGSKSGNTASLTISGLQAEDEAEYYCCSYAGSGN
Equus caballus V1006 iglv AAWR02038310.1 34666 SVSSSELTQSTAVSFSLGQTATITCQGETLRSHYASWYQKNPGQAPVLVIYGNNNRPSGIPARFSSSYSEDTGTLTISGVQIEDEADYYCQSLGSDY
Equus caballus V1007 iglv AAWR02038312.1 205355 ADSQSVVTQEPSLSVSSGGTVTLTCGLNSGSVSSSNHPSWHQQTPGQAPRTLIYYTNTRASGVPNLFSGSISGNRATLTITGAQREDEADYYCALYTGS
Equus caballus V1008 iglv AAWR02038312.1 186091 SWAQSVTQPASVSGTLGQTVTISCTGSISNIGVYVDWYQQIPGTAPKTIIYATNKQPSGVPDRFSGSKSGNTATLTITGLQAEDEADYYCGIYDSSLSS
Equus caballus V1009 iglv AAWR02038312.1 155538 SRAQSVTQPASVSGTLGQTVTISCSGSSSNIGSGHVSWYQQIPGTAPKRLIYSSTNRASGVPDRFSGSRSGNTATLTISGLQAEDEADYYCGTLYSSWSN
Equus caballus V1011 iglv AAWR02038312.1 127655 SWAQSVTQPASVSGTLGQTVTISCSGSSSNIGYSYSYVGWFQQIPGTAPKTLIYGNNKRASGVPDRFSGSKSGNTATLTISGVQAEDEADYYCGSYDSSSSS
Equus caballus V1012 iglv AAWR02038312.1 65833 SWAQSLTQPASVSGTLGQTVTISCSGSSSNIGYSYSAVGWYQQIPGTAPKTLIYGNNKRASGVPDRFSGSKSGNTATLTISGVQAEDEADYYCSAGDSSGSS
Equus caballus V1067 iglv AAWR02042338.1 79583 WVTQEASVSGSVRQKVTLSCAGNSNNGGIFDVGWYQISHGAPKTVMLRSSWPSGIPARLSSSKSGNTAYLTISGLQPEDEADYYCSAWDDSISN
Equus caballus V1080 iglv AAWR02042718.1 39866 SWAQSVLTQPASVSGNLGQRVTISCTGSSSDIGDYDVHWYHQLPGMAPKLIIYDNSKRPSGVPEGFSGSKSGNSATLTITGLKSEDDADYYCECYDDSLS
Equus caballus V1089 iglv AAWR02043269.1 10334 SWAQSGLTQEASVSGSVGQKVTLSCAGNSNNVGIFDVGWYQISHGAPKTVTLRSSRPSGIPARFSGSKSSNTAYLTISGLQPEDEADYYCSAWDDSISN
Equus caballus V1097 ighv AAWR02044110.1 2774 VSSEVQLIQSGPELKKPGSSVKISCKASGYTFTEYAMHWVRQANGKGIEWMGSISPHDDDTSYAPKFQGRVTITVDKSTSTVYMELSSLTSEDTAMYYCAK
Equus caballus V1100 trav AAWR02044332.1 3111 GTRAQSVTQPDVHITVSEGAALELRCKYSSAISESLFWCVQYPNQGLQLLLEYFSGATVVKGIKGFEAEFKKSETSFHLRQPSAHWSDSAEYFCALV
Equus caballus V1101 trav AAWR02044335.1 2597 QSHGDSVTQMEGQMILSEGASLNMTCTYSARGYPALFWYLQYPGEGPQLLLSAKKDNEMARNKGFEATYNKEATSFHLVKASVLESDSAMYYCALR
Equus caballus V1106 trav AAWR02045319.1 5530 GTGAQSVTQPDDHISVSEGAPLELRCIYSYSGTPTLFWYVQYPSQGPQLLLKYYSGNTRVKGIKDFEAEFKKNETSFHLRKSSAHWSDSAEYFCALS
Equus caballus V1109 trgv AAWR02045900.1 6737 TQVSSNLEGTQMLVTKQAGSSVEITCDIKQSSSYIHWYQYQEGMAPQRLLYYQLSGSRVVMDSGFSSWKYRAYEGSGRTYKLSIKLLEESDSGVYYCAVWE
Equus caballus V1143 trdv AAWR02001692.1 34648 KDVICNEVTQSPPELTVASGNKVTLFCTYKTAYSNPDLYWYRIRPDYSFQFILYRDNARSHDADFTQGRFSVQHGKTQKTFHLVISSVRTEDSAVYYCAIL
Equus caballus V1167 igkv AAWR02003527.1 198486 ACGDVMMTQSPDSLAASLGQRVEMKCKASQSVSSYLAWYQHKPGQAPKRLIYAASSRASGVPDRFSGSGSGMDFTLTISSLQAEDVAIYYCMQHYNNP
Equus caballus V1168 igkv AAWR02003527.1 184531 ACGDIVMTQSPDSLAVSLGQRVEMKCKASQSVSSSLDWHQHKPGQAPKLLIYRASSRASGVPDRFSGSGSGTDFTLTISSLQVEDVAVYYCMQSNTAP
Equus caballus V1169 igkv AAWR02003527.1 137201 ACGDIVLTQSPESLAVSLGQRVEMKCKASQSASSNLDWHQHKPGQAPKQLIYRASSRASGVPDRFSGSGSGTDFTLTISSLQAEDVAVYYCQQYNSAP
Equus caballus V1170 igkv AAWR02003527.1 85367 ACGDIVMTQSPDSLSVSAGQRVDMKCRASQSVSNELSWYQQKPGQAPKLLIYAASNRASVVPDRFSGGGSGTDFTLTISSLQAEDVAVYYCLQHYNNP
Equus caballus V1171 igkv AAWR02003527.1 68844 ACGDIMMTQSPESLAVSLGQRVEMKCKASQSVSSYLAWYQQKLGQAPKLLIYSASSRASGVPDRFSGSGSGTDFTLTISSLQAEDVAVYYCFQSYNAP
Equus caballus V1172 igkv AAWR02003527.1 60646 ACGDLVMTQSPGSLAASLGQRVEMKCKASQSVSSYLDWYQQKPGQAPKQLIYAASSRASGVPDRFSGSGSGTDFTITISSLQAEDLAIYYCQQYNSAP
Equus caballus V1416 trav AAWR02020922.1 91795 AHTQVVQVNDSMYGFIGTDVVLHCSFANLLPGVKITQVTWQKATNGSKQNVALYNPAMGVSVLAPYRERVEFLRPSFTDGTIRLSRLELEDEGVYICEF