WGS Statistics
Organism WGS Record. Vs Total IGHV IGLV IGKV TRAV TRBV TRGV TRDV
Neolamprologus brichardi AFNY00000000.1 (AFNY01) 174 123 0 12 3 34 1 1
Vgene Table
Organism Vgene Locus contig Contig Pos. AA sequence
Neolamprologus brichardi Vs213 ighv AFNY01104844.1 806 IEGQTLTQSEPVVKRPGDSHRLTCTYSGFGYDVGVAWIRQAAGKGLEWIASIDSYSGSSKYYSQSVQGRFTISRDNSRKQVYLQMNSLTTEDSAVYYCARY
Neolamprologus brichardi Vs212 ighv AFNY01104843.1 4973 VDGQTLTESEPAVKRPGESHRLTCTGSGFTFSSYAMNWVRQAPGKGLEWIAFIHTYSSHIYYSQSVQGRFTISRDDSSSKVYLQMNNLKTEDTAVYYCARR
Neolamprologus brichardi Vs211 ighv AFNY01104843.1 94 VKCEQLTQPASVTVHPGNRLTITCQASYSLSSARTFWIRQPAGKELECIGSVHIGHSTRYKDSLQNKFSIDIDSSNRTVTLIGQNVQPEDSAVYYCARE
Neolamprologus brichardi Vs210 ighv AFNY01104840.1 2630 VKCEQLTQPASVIVQPGQRLTITCQVSYSLGYYTAWIRQPGGKGLEWIGMKYTGGSHYKDSLKNKFSIDLATSSNTVTLNGQNMQPEDTAVYYCAR
Neolamprologus brichardi Vs216 ighv AFNY01104845.1 755 NISVGTEGQTLTESESVVKRPGDSHTLTCTYSGFSSDIDAAWIRQAAGKGLEWIAYRSSGSGTIVYSQSVRGRFTITRDNSRKQVYLQMNSLTTEDSAVYYCARE
Neolamprologus brichardi Vs215 ighv AFNY01104844.1 5682 VKCEQLTQPASVIVQPGQRLTITCQVSYSLGNYRTAWIRQPAGKGLEWIGMKYTGDSFYKDSLKNKFSIDLDTSSKAVTLNGQNMQPEDTAVYYCARE
Neolamprologus brichardi Vs214 ighv AFNY01104844.1 2954 TEGQTLTESESVIKQPGQSHRLTCTYSGFGGDIPAAWIRQAAGKGLEWIAYISSGSSGIYYSQSVRGRFTITRDNSRKQVYLQMNSLTTEDSAVYYCARE
Neolamprologus brichardi Vs219 igkv AFNY01106204.1 204 SSGEQVLTQTPKAQPVVPGQTVSIRCKASSSVSNNLHWYLQKDGESPKLLIYSATNRQSGVSDRFSGSGSGTDYTLTISRVQAEDAGVYYCQHY
Neolamprologus brichardi Vs314 ighv AFNY01026728.1 1182 IDGQTLTESEPVVKRPGESHTLTCTASGFTFRDYNMAWVRQAPGKGLEWIALLSSPSGSDKHYSQSVQGRFTISRDNDKQQVYLQMSSLTTADSAVYYCAR
Neolamprologus brichardi Vs317 ighv AFNY01026729.1 1868 TEGQTLTQSEAVVKRPGDSHRLTCTYSGLSSNYDTAWIRQAPGKGLEWIAWISYGGSSIYYSQSVRGRFTISRDNSRNQVYLQMNSLTTEDLAVYYCARE
Neolamprologus brichardi Vs189 ighv AFNY01099226.1 244 VDGQTLTESEPVIKRPGESHTLTCTASGFTFRDYYMAWVRQAPGKGLEWVAYISSGGGSKSYSQSVRGRFTISRDNSRQQLYLQMNSLKTEDSAVYYCTRD
Neolamprologus brichardi Vs188 ighv AFNY01099225.1 5548 VDGQTLTESEPAVKRPGDSHRLTCTASGFSFSSFEMNWVRQAPGKGLEWVAYINSGSGSKYYSQSVQGRFTISRDNSRQQLYLQMNSLRTEDSAVYYCVRE
Neolamprologus brichardi Vs187 ighv AFNY01099225.1 3250 VFFVGTEGQTLTESESVIKRPGDSHRLTCTYSGFSSDHWNAWIRQAAGKGLEWISAISDSSAYIYYSQSVQGRFTISRDNSRKQVYLQMSSLMTEDSAVYYCARE
Neolamprologus brichardi Vs186 ighv AFNY01099224.1 1146 TESQTLTESESVIKRPGDSHRLTCTYSGFSGDIHAAWIRQAAGKGQEWIAWIYYTGSDISYSQSVRGRFTISRDNSRKQVYLQMNSLTTEDSAVYYCARE
Neolamprologus brichardi Vs185 ighv AFNY01099223.1 514 VNCEQLTQPPSVILQPGQRLTITCQVSYSLGYYTAWIRQPAGKGLEWIGIKNTGSSYYKDSLKSKFSIDLDTSSKTVTLNGQNMQPEDTAVYYCARV
Neolamprologus brichardi Vs184 ighv AFNY01099221.1 24640 VNCEQLTQPPSVILQPGQRLTITCQVSYSLGYWTAWIRQPAGKGLEWIGMKDTGSSYYKDSLKSKFSIDLDTSSKTVTLNGQNMQPEDSAVYYCARV
Neolamprologus brichardi Vs183 ighv AFNY01099221.1 22754 VKCEQLTQPEFVTVQPGQHLTITCQVSYSLSSYWTGLEWIGVKYTGDSRYKDSLKSKFSIDLDTSSKTVTLNGQNIEPEDTAVYYCARESQ
Neolamprologus brichardi Vs182 ighv AFNY01099221.1 20384 TEGQTLTESESVIKQPGQSHRLTCTYSGFGGDIYAAWIRQTAGKGLEWIAYINPGSSSIYYSQSVRGRFTISRDNSRKQVYLQMNSLTTEDSGVYYCARE
Neolamprologus brichardi Vs181 ighv AFNY01099221.1 18612 VNIFVGTEGQTLTESESVVKRPGDSHRLTCTYSGFSGDYSNAWIRQAAGKGLEWIALINTGSSTWYSQSFRGQFTISRDNSRKQVYLQMNSLTTGDSAVYHCARE
Neolamprologus brichardi Vs180 ighv AFNY01099221.1 12377 VNCEPLTQPPSVILQPGQRLTITCQVSYSLSSYWTAWIRQPAGKGLEWIGVKGTGSSHYKDSLKSKFSIDLNVLSNTVTLNGQNMQPEDSAVYYCASV
Neolamprologus brichardi Vs105 trbv AFNY01048736.1 2501 GSSLSDQVNQTPADIYTKGEDVKIQCSHSISSYETILWYKQTEKKLQLLGYMLNDRGYPETGVNVMMDGDARQHKNCTLTIKDIKLSSSGVYFCAAR
Neolamprologus brichardi Vs104 trbv AFNY01048736.1 404 GSPASDQVDQTPANIYTKRGDAKIHCSHSIQDYYQILWYKQSKKQLQLLGYMSYDRSNPEPGVNVTMDGGAEKDQNCTLTIKDIKASSSGVYFCAAS
Neolamprologus brichardi Vs459 ighv AFNY01104008.1 1559 VWSEIKLEQSASEVKRPGERVKMLCTLSGYSLTSYNIFWIRQRPGRALEWIGYMSTGNNSPSYGSSFQSRFIMTEEDSSSRQYLEIKSLTAEDSAVYFCARE
Neolamprologus brichardi Vs208 ighv AFNY01104840.1 69 VDGQTLIESEPVIKRPGESHRLTCTGSGFTFRDYPMNWVRQAPGKGLEWIAFVHTGSSHFFYSQSVQGRFTISRDDSSSKVYLQMNNLKTEDTAVYYCARQ
Neolamprologus brichardi Vs209 ighv AFNY01104840.1 1707 VNTSVGTEGQTLTESEPVVKRPGDSHRLTCTYSGFRSDIYANWIRQAAGKGLEWIAYINPSSVIFYSQSFRGRFTITRDNSRKQVYLQMSSLTTEDSAVYYCAQG
Neolamprologus brichardi Vs204 trbv AFNY01104605.1 322 IVLTQTPAVHTVSQGQQAVLNCNIERYDANYVRWYKQVPGEAHQYVLRFLHSDSSPSFGTGFSSDRFNSKSSSNIDYQFIIKRAETGDSAVYYCQTYDDSAS
Neolamprologus brichardi Vs205 ighv AFNY01104837.1 3361 IDGQTLTESEPVVKRPGESHTLTCTASGFTFRDYRMAWVRQAPGKGLEWIALLSSPSGSDKYYSQSVQGRFTISRDNDKQQVYLQMSSLTTADSAVYYCAR
Neolamprologus brichardi Vs206 ighv AFNY01104838.1 3604 VKCEQLTQPSSMTVRPGQPLTITCQVSYSVSSYNTAWIRQPAGKSLEWIVMNCHGCTPLHKDSLKNKFSISIDSSSKTVTLTGQNVQPEDTAVYYCARY
Neolamprologus brichardi Vs207 ighv AFNY01104838.1 6119 VNGQTLTESEPAVKQPGESHRLTCTTSGISFSSYWMNWIRQAPGKGLEWIATDAGGSNKYYSQSVQGRLTVSRDNSREQLYLQMNSLKIEDSAVYYCARE
Neolamprologus brichardi Vs168 ighv AFNY01099205.1 10240 VTGQSLESVPSSPVMKRPGETLSLSCKGSGSDFTCCAMSWIRQQPGKTLEWIGVGHRPSSNNRYANSLSGRIEVSRDESNYIVYLRLSNLKAEDSAVYYCA
Neolamprologus brichardi Vs203 trdv AFNY01104442.1 77 LTAGDSITPQQPEVTETEGESVTLTCSYETSASDAYLHWYRHHSDLQAPQFILWKQGKGGSAENIPDKRYGSKTTDRSTNLTIAALTLADTALYYCALE
Neolamprologus brichardi Vs35 trbv AFNY01026198.1 997 IVLTQTPAVHTVSPGQQAVLNCNIERYDGNYVRWYKQVHGKAPQYVLRFRHSDSSLEFGTGFSSDRFNSKSSSNIDYQFIIKRAETGDSAVYYCQTYDDSAS
Neolamprologus brichardi Vs36 trbv AFNY01026203.1 4180 IVLAQTPAVHTVSPGQQAVLNCNIERYDRNYINWYKQVPGGIPQYVLRFCHSSSSLSFGTGFSSDRFNSKSSSNIDYQFIIKRTETGDSAVYFCQTWDDSAS
Neolamprologus brichardi Vs38 ighv AFNY01026716.1 1251 VDGQALTESEPVVKRPGESHRLTCTASGFTFSDYWMVWVRQAPGKGPEWIAFIETSTYSYATSYSQSVQGRFTISRDDSSSKLYLQMNSLKTEDTAVYYCARG
Neolamprologus brichardi Vs190 ighv AFNY01099227.1 1280 VDGQTLTQSEPVVKRPGESHTLTCTASGFSFSGYWMGWVRQAPGKGLEWVAYINSGSGSSKYYSQSVRGRFTISRDNSRQQLYLQMNSLTTEDSAVYYCARE
Neolamprologus brichardi Vs191 ighv AFNY01099229.1 348 VQCEQLTQKASETVQPGQRLTITCQVSYSVTSRWTAWIRQPAGKGLEWIGSRVGASLAYKDSLKNKFSISLDSSSNTVTLTGQNMQPEDTAVYYCARD
Neolamprologus brichardi Vs192 ighv AFNY01099230.1 266 VDGQTLTESEPVVKRSSESHRLTCSASGFTLSSYTMAWVRQAAEKGLEWIAFIQLVLLSPTLRQFRADSPSPKMTPAVKSIYRCLKKNSLKTEDTAVYYCARRE
Neolamprologus brichardi Vs193 ighv AFNY01099230.1 1431 IDGQTLTQSEPVVKKPGESHRLTCTTSGLSFSSWWMAWIRQAPGKGLEWIATEANGGTNYYSQSVRGRFTASRDNSREQLFLQMNNLKTEDSAVYYCARD
Neolamprologus brichardi Vs197 igkv AFNY01102648.1 1552 HLSAVIQSATVKQETGVRFAAVGDDVTLRCFYESQVSMHFSWYRQFLGSQPKRLSTIYKYDKPSEVLHTLENPRFSVERKEGTNHLQISGVRLSDSATYYCGS
Neolamprologus brichardi Vs112 trbv AFNY01048739.1 2771 SSLNSQIYQTPAQLYISRETEEVKINCSHSIQGYDRILWYRQMNNRHLQFLGYMYGTLDNPEKGLDVKLKGDANINKTCTLTIEKLGPNSSAVYFCA
Neolamprologus brichardi Vs298 ighv AFNY01026708.1 1095 VWSENKLEQSNSEVKRPGERVKMSCIISGYNPTSSYLHWIRQRSGRALEWIGRMDTGENSAIYGSTFQSRFVMTEEDSSSRQYLEIKSLTAEDSAVYFCARQ
Neolamprologus brichardi Vs440 trav AFNY01097045.1 805 FIFLLSLNSDAVVPVKTVQLGEPATITCAIPKELSSRGVHWYKQSFGGTLKLIVTVFKSTEPTFGPEFTSLKFDIGDDSASLTILKADQDDEGIYHCA
Neolamprologus brichardi Vs117 trbv AFNY01048742.1 1798 LTVVVLQSEDQMSDRGRTVTLECKMGSGFSMSSYTMLWYRQNHHGAPVDYLLNEYDKTVGRLNSFLDASKNNFSLQITELHMNDSSTYYCAA
Neolamprologus brichardi Vs118 trbv AFNY01048742.1 2965 FSRGVKIDQLQIIFSREGTANVTLDCKQDDNQYYYMYWYRQSSSGKLELVTFSTGQNSWNIEAPFTKSKYTMSRPSVLESTLQIHPVKSGDTALYYCASRI
Neolamprologus brichardi Vs292 ighv AFNY01026700.1 3019 VNGQTLTESEPVTKRPGESHRLTCTVSGFTLGSYAMAWVRQAPGKALEWIAFIGTASSPICYSQSVQGRFIISRDDSSSKIYLQMNSLKTEDTAVYYCAR
Neolamprologus brichardi Vs291 ighv AFNY01026698.1 2035 VKCEQLTQPASLTVQPGQRLTITCQVSYSMSTYWTAWIRQPAGKGLEWIGRACDGCTSQYKDSLKTKFSISTDSSSKTVTLTGQNVQPEDTAVYYCARD
Neolamprologus brichardi Vs290 ighv AFNY01026698.1 3657 VDGQTLTQSEPVVKNPGNSHRLTCTASGFTFSNYWMHWIRQAPGKGLEWIAIIRTSGYSQSTSYSQSVQGRFTISRDDSSSRLYLQMNSLKTEDTAVYYCA
Neolamprologus brichardi Vs297 ighv AFNY01026708.1 3816 VWSEIKLEQSPSEVKRPGERVKMSCILSGYSPTSYNIGWIRQRPGRALEWIGWMSTGSNSADYASSFQSHFIITEEDSSRSQYLEIKSLTAEDSAVYFCARE
Neolamprologus brichardi Vs296 ighv AFNY01026708.1 7060 VNGQTLTESEPAVKQPGQSHRLTCTTSGFTLSSYWIHWVRQAPGKGLEWIAADANSATNYYSQSVQGRFTVSRDNSRQQLYLQMNSLKTEDSAVYYCARN
Neolamprologus brichardi Vs295 ighv AFNY01026707.1 1380 ADSQTLTESEPVIKRLGESHRLTCTASGLTFSSHAMLWVRQAPGKGLEWVALIETSSYSYSAFYSQSVQGRFTISRDDPSSKLYLQMNSLKTEDTAVYYCTRK
Neolamprologus brichardi Vs294 ighv AFNY01026706.1 1173 VFGQTLTESDPAVKQPGESHRLTCTASGFTFSSYWMAWVRQAPGKGPEWVSTVRNDNGNSYYAQAVQGRFTISRDDSRQQVSLQMNSLKTEDSAVYYCARE
Neolamprologus brichardi Vs176 ighv AFNY01099221.1 1025 VMCEQLTQPDSVIVQPGQRLTITCQVSYSVGSYYTAWIRQPAGKGLEWIGMRYTGGTHFKDSLKSKFSIDLDSSSNRVTLNGQNMQPEDTAVYYCARV
Neolamprologus brichardi Vs177 ighv AFNY01099221.1 4073 LNGQAMESIPSTPVLKKPQEAVSLSCRGSGFSFGSFGMDWIRQPAGKALEWLGVIWSDASRTAYASSVEGRIEITKDNSNNMVYLRLSNLKPEDSAVYYCA
Neolamprologus brichardi Vs174 ighv AFNY01099220.1 1473 VKCEQLTQPASVIVHPSQRLTLTCQVSYSLGAWTAWIRQPAGKGLEWIGMKYTGNSHFKDSLKSNFSIDLDTSSKTVTLNQQNMQPEDTAVYYCARESK
Neolamprologus brichardi Vs175 ighv AFNY01099220.1 4921 TESQTLTESESVIKRPGDSHRLTCTYSGFGGNYETAWIRQAAGKGLEWIAYISGGSSYIHYSQSFRGRFTISRDNSRKQVYLQMNSLTSEDSAVYYCARE
Neolamprologus brichardi Vs172 ighv AFNY01099209.1 3216 VKCEQLTQPASVIVQPGQRLTITCQVSYSLGYYTAWIRQHAGKGLEWIGMKHTSTSYYKDSLKNKFSIDIDTSSNTVTLNGQNIQPEDTAVYYCARE
Neolamprologus brichardi Vs170 ighv AFNY01099207.1 875 VTPQSMESIPSSPVVKSSGETLSLSCRGSGFTFSCCTMNWIRQKPGETLEWIGIGYSSSSSNRYVSSLSGRIQISRDDSNSMVHLSLSNLKPEDSAVYYCA
Neolamprologus brichardi Vs171 ighv AFNY01099208.1 88 TEGQTLTESESVVKRPGDSHRLTCTYSGFSGNIDAAWIRQAAGKGLEWIAYIEDDSSYIYYSQSVRGRFTISRDNSRKQVYLQMNSLTTEDSAVYYCAKE
Neolamprologus brichardi Vs271 ighv AFNY01026675.1 6551 VCSQTLTESEPVVKRPGDSHKLTCTYAGISDSYADISWIRQAEGKGLEWVSFISAPSGSDKYYSTSVQNRFTISRDNNVDQVYLHMTSLTTEDSAIYYCART
Neolamprologus brichardi Vs270 ighv AFNY01026675.1 7884 VCSQTLTESEPVVKRPGESHKLTCTYAGISDDNAAVSWIRQAEGKELEWVAYISAPSGSNKYYSTSVQNRFTISRDNNVDQVYLHMSSLTTEDSAIYYCVRT
Neolamprologus brichardi Vs273 ighv AFNY01026676.1 10679 VWSDVKLDQSSSELKRPGEIVKMSCIVSGYTMTSGYFSWIRQRAGKAMEWIGRMNSGSNSATYSSSFQSRFIMTEDVPSSTQYLEIKSLTAEDSAVYFCARE
Neolamprologus brichardi Vs272 ighv AFNY01026675.1 2514 ARCQSLTSSEPVVSRPEQSVTLSCRVQGLSLAWLHWIRQKPGKGLEWIGRIDGGTGTIFAQSLQGQFSITKDTSQNRVNLVVNSLKQEDSAVYYCARE
Neolamprologus brichardi Vs275 ighv AFNY01026676.1 5425 VDSQTITQSESVVKSPAESHRLTCTGSNIDFSSRWMAWIRQAPGKGLEWIAIIEYDSDRIFYSQSVQGRFTVSRDNSKEQLYLQMNSLKTEDTAVYYCVRE
Neolamprologus brichardi Vs274 ighv AFNY01026676.1 9140 IYGQTLTESEPVVISPGDSHRLTCTASGFTFSNSWMSWIRQAPGKGLEWVATIRYDSGEIYHCQSVRGRFTISRDNNRQQLYLQMNSLKTEESAVYYCVGD
Neolamprologus brichardi Vs179 ighv AFNY01099221.1 9873 TEGQTMTESEPVVKRPGDSHRLTCTYSGFSSDIHAAWVRQAAGKGLEWVARILSDSSYIFYSQSVRGRFTISRDNSRNQVYLQMNSLTAEDSAVYYCARE
Neolamprologus brichardi Vs269 ighv AFNY01026675.1 11690 VDSQTITQSESVVKGPAESHRLTCTGSNIDFSSYWMAWIRQAPGKGLEWVASIRYDSAYIYYSQSVQGRFTISRDNSKEQLYLQMNSLKTEDTAVYYCVRE
Neolamprologus brichardi Vs284 ighv AFNY01026687.1 7505 VDGQTLTESESVIKRPGESHRLTCTGSGFTFSSYWMAWVRQAPGKGLEWIASNYDSSNIYYSQSFRGRFTISRDNSKQQLYLQMNSLKTEDSAVYYCA
Neolamprologus brichardi Vs285 ighv AFNY01026687.1 4404 VYSIDLIQPDSMIVQPGQSLTITCRVSGYSLTSISYATSWIRQRDGKQMDWIFTMWYDGSTSKNDALKNKFSMSRDTSAQTVTITGQNLQPEDTAVYYCARY
Neolamprologus brichardi Vs286 ighv AFNY01026687.1 1834 ADCQTLTESEPAVKRPGESHRLTCTPSGFNFGDYSMHWVRQAPGKGLEWIAYIRYDSAYIYYSQSVQGRFTISRDNSKQQVYLQMNSLKTEDSAVYYCARD
Neolamprologus brichardi Vs287 ighv AFNY01026688.1 1259 VYSIDLVQPDSRVIQPGQSLTITCQVSGYSVTSYGTAWIRQREGKQLEWILIIWGSGSINKNDALKNKFSVSRDTSAQTVTITGQNLQPEDTAVYYCARY
Neolamprologus brichardi Vs280 ighv AFNY01026682.1 3465 VDGQTLTQSEPAVKRPGDSHRLTCTASGYSFGGHGMHWIRQAPGKGLEWIAYIYSDGSGTFYSDSVRGHFTISRDNSKQQLYLQMNSLKPDDSAVYYCA
Neolamprologus brichardi Vs281 ighv AFNY01026682.1 577 IKGQTLTQSDSAVKRPGESHRLTCTGSGYNFAGFGMDWIRQAPGKGLEWIAYIWSDGSNTYYSQSVQGRFTISKDNNRQQVYLQMNSLKTEDSAVYYCA
Neolamprologus brichardi Vs282 ighv AFNY01026683.1 1344 QTITESEPAVKRPGESHRLTCTTSGFSFGSSVWSWIRQAPGKGLEWIAFIDTGSTPIYYSQSVRGRFTISRDDSSSKVYLQMNTLKTEDTAVYYCAKG
Neolamprologus brichardi Vs283 ighv AFNY01026684.1 6683 VDGQTLTQSEAALKRPGESHRLTCTASGYNFGVHSLVWVRQAHGKGLEWIAYIYWGDGSTSYFQSVQGRFTISKDNSKEQVYLQMNSLKPEDSSVYYCAR
Neolamprologus brichardi Vs307 ighv AFNY01026719.1 1600 VWSEIKLEQSPSDVKRPEERVKMSCIISGYTLTNYYLHWIRQRPGRALEWIGRMDTGSNSADYSSSFQSGFIMTEEDSSSRQYLEIKSLTEEDSAVYFCARE
Neolamprologus brichardi Vs288 ighv AFNY01026693.1 597 VYSIDLIQPDSRVLQPGQPLTIVCQVSGYSLTDSSYGTCWVRQRDGKQMDWINCMWSDGSTDNNNALKNKFSVSRDTSTRTVTITGQNLQPEDTAVYYCAR
Neolamprologus brichardi Vs289 ighv AFNY01026696.1 506 VWSEIKLEQSPSEVKRPGERVKMSCIISGYSLTSYNIHWIQQRPGRALEWIGRMNTGLNSALYGSSFQSRVIITEEDSSSRQYLEIKSLTAEDSAVYFCAR
Neolamprologus brichardi Vs470 ighv AFNY01104016.1 409 VNGQTLTESEPAVKQPGQSHRLTCTTSGFTLSSYWIHWIRQAPGKGLEWIAADGGGTKYYSQSVQGRFTVSRDDSRQQVYLQMNSLKTEDSAVYYCARE
Neolamprologus brichardi Vs299 ighv AFNY01026710.1 3130 VDGQTLTQSEPVVKRPGESHSLTCTGSGFTFSNYWMHWVRQAPGKGLEWVATIQVTSTDYSQSVRGWFTISRDNSRQQVYLQMNSLKTEDSAVYYCARE
Neolamprologus brichardi Vs479 ighv AFNY01106606.1 644 VDGQTLTESESVVKRPGESHRLTCTASGFTFSSYWMAWVRQAPGKALEWVASHYNSANIHYSQSVRGRFTISRDNSRQQLYLQMSSLRTEDSAVYYCARD
Neolamprologus brichardi Vs478 ighv AFNY01106603.1 1499 VDGQTLTESEPAVKRPGDSHRLTCTASGFTLSSYHMGWVRQAPGKGLEWIAYIYTDSSGSFYSQSVRGRFTISRDNSRQQLYLQMNSLKTEDSAVYYCARE
Neolamprologus brichardi Vs305 ighv AFNY01026717.1 3559 VEGQTLTQSEPDLIKRPGESHRLTCTASGFTFRDYEMVWVRQAPGKGLEWIAYIGTLGYPTYYSQSVQGRFTISRDDSSSKLYLQMDSLKTEDTAVYYCARE
Neolamprologus brichardi Vs304 ighv AFNY01026717.1 7487 VDGQTLTESEPVVKRPGQSHRLTCTASGFTFRDYWMVWVRQAPGKGPEWIAYISTSTYSYATSYSQSVQGRLTISRDDSSSKLYLQMDSLKTEDSAVYYCARG
Neolamprologus brichardi Vs268 ighv AFNY01026672.1 581 VCSQTLTESEPVVKRPGESHKLTCTYAGISDSSDMSWIRQAEGKGLEWVAYISGPSGSTQRYSTSVQNHFTISRDNNVDQVYLHMSSLTTEDSAVYYCART
Neolamprologus brichardi Vs99 trbv AFNY01048731.1 1333 VPKSGIHQTPAALIKAPGEEIQIHCNHSNNKLDMIQWYKQSPGENEMILLGYVRFTFTAVEDAFENIYKVTGEGSKLSTFHIPKLRESVDSAMYFCAASA
Neolamprologus brichardi Vs301 ighv AFNY01026711.1 5210 VKCEQLTQPGAVTVRPGQRLTIICQVSYSVSSYSTAWIRQPAGKNLEWIGQQCHGCTPAYKDSLKNKFSISTDSSSNTVTLNGQNVQPEDTAVYYCARY
Neolamprologus brichardi Vs300 ighv AFNY01026710.1 1396 VDGQTLTQSEPVVKRPGDSHTLTCTGSGFTFSDYWMHWVRQAPGIGLEWVAGISESSGYIHYSQSVQGRFTISIDNSKQQVYLQMNRLKTEDSAVYYCARR
Neolamprologus brichardi Vs302 ighv AFNY01026712.1 4411 VWSEVKLEQSPSEVKGFGERVKMSCTLSGYILTNNDIHWIRQRPGRALEWIGYMSTGYNSPRYGSSFQHRFIMTEEDSSRRQYLDINSLTAEDSAVYFCARQ
Neolamprologus brichardi Vs92 trbv AFNY01048728.1 6639 GADGSDVQQTLSLWEKEGKSATMQCNHTKGSDYLWMYWFRQLPGETMTLIVFATTGKKDNEHDYGDFGTEKFSASKTVAETGTFTVKNLDPKDQGWYFCAVS
Neolamprologus brichardi Vs93 trbv AFNY01048728.1 7565 HVDGSDVTQTPILWKYQGDSATMSCNHTKGDLYFQMYWYRQLPGETMKLIVFTTRGKKDDDQDFGEFSKEKFSVTKPTADTGTFTVKNLQPNDKGWYFCAVS
Neolamprologus brichardi Vs91 trbv AFNY01048725.1 61 FSFSVKIKQDPFINSHIGDQSATLSCSQDEDNPYMFWYRQSKSGKIELITYSLGEKVWDTEAPFNKSKYSMSRPSLLRSSLRIHSVAAGDSAVYYCVSRR
Neolamprologus brichardi Vs96 trbv AFNY01048729.1 884 LTDGSDVEQTPTLWEREGKSATMQCNHTKDFTYSYMYWFRQLPGETMTLIVFATTGKKDNEHDYGNFDKEKFSASKPVVESGTFIVKNLKPEDKGWYFCAVS
Neolamprologus brichardi Vs97 trbv AFNY01048730.1 1345 LTGGSDVSQTPLLWSTEGQSVTMNCNHTKGAAFRQMYWYQQLPGKGMKQIVFTTAYSTHTYESGFSEEKFPATKTNEETGSLTVKQLVPEDSGVYFCSVS
Neolamprologus brichardi Vs94 trbv AFNY01048728.1 8453 LTDGSDVSQTPLLWKSEGQSATMTCNQTKNFDYSQMYWYQQLPGQKIKQIVFTAPKTQHTYESGFSEEKFPATKSSYETGSLTVEKLVPGDSGVYFCAVS
Neolamprologus brichardi Vs95 trbv AFNY01048728.1 9648 LTDGSDVEQTPLLWEREGQSATMWCNHTKDATYRWMYWFRQLPGETMTLIVFATTGKKDDEHDYGDFDKEKFSASKPVAESGTFTVKNLKPEDKGWYFCAVS
Neolamprologus brichardi Vs311 ighv AFNY01026724.1 6581 VNGQTLTESEPAVKQPGQSHRLTCTTSGFTLSSYWIHWIRQAPGKGLEWIAADTSSSTNYYSQSVRGRFTVSRDNNRQQLYLQMNSLKTEDSAVYYCARD
Neolamprologus brichardi Vs293 ighv AFNY01026702.1 887 VWSEIKLEQSASEVKRPGERVKMLCTLSGYRLTSYNIQWIRQRPGRALEWIGYMSTGNNSPGYASSFQSRFIITEEDSSSRQYLEITSLTAEDSAVYFCARV
Neolamprologus brichardi Vs468 ighv AFNY01104015.1 3527 VNSETLTQPASMIVQPGEQLAITCQVSYSLGSLPTAWIRQPAGKGLEWIGRAGDGWTTYYKDSLKNKFKISFESSSKTVTLRGTNVQPEDTAVYYCARE
Neolamprologus brichardi Vs469 ighv AFNY01104015.1 2232 VDGQILTESESVVKRPGESHRLTCTTSGFTFSSYRMVWVRQAPGKGLEWIAYISTSSSPIYYSQSVQGRFTISRDDSSSKVYLQMNSLNTEDTAVYYCARC
Neolamprologus brichardi Vs464 ighv AFNY01104014.1 12266 VKCEQLTQPASLTVQPGQRLTITCQVSYSGYWTAWIRQPAGKGLEWIGMGVGSTTHYKDSLKTKFSISTDSSSKTVTLTGQNLQPEDTAVYYCARD
Neolamprologus brichardi Vs465 ighv AFNY01104014.1 7546 VWSEIKLEQSPSEVKRPGERVKLSCIISGYSLTGYNIHWVRQRPGRALEWIGWMNTGRNSASYGNSFQSRFIMTEEDSSSRQYLEIKSLTAEDSAVYFCAR
Neolamprologus brichardi Vs466 ighv AFNY01104014.1 1259 VKCEQLTQPASMLVQPGQHLTITCQVSYSLSSYYTSWIRQPAGKALEWMSQDTAVKDSLKNKFSVELDSSSNTVTLKGQNLQPEDTAVYYCARQ
Neolamprologus brichardi Vs467 ighv AFNY01104015.1 7551 VWSEIKLEQSPSEVKRPGERVKLSCIISGYTPTDYYLHWIRQRPGRALEWIGRMNTGSNSARYASSFQSRFIMTAEDSSSKQYLEINSLTAEDSAVYFCARE
Neolamprologus brichardi Vs460 ighv AFNY01104013.1 5567 VDGQTLTQSEPVVKRPGDSHTLTCTGSGFTFSGYWIHWVRQAPGKGLEWVAGISETSGYIHYSQSVQGRFTISRDNSKQQVYLQMNRLKTEDSAVYYCDRR
Neolamprologus brichardi Vs461 ighv AFNY01104013.1 3519 VNGQTLTESESAVKQPGESHRLTCTTSGISFSSYSMAWIRQAPGKGLEWIAYISSGSGYIYYSQSVRGHFTISRDNSREQLYLQMNSLKTEDSAVYYCARE
Neolamprologus brichardi Vs462 ighv AFNY01104014.1 18189 VDGQTLTQSEPVVKRPGESHRLTCTASGFTFSNYEMVWVRQATGKGPEWIAFISISTYSYATFYSQSVQGRFTISRDDSSSKLYLQMNSLKTEDTAVYYCARE
Neolamprologus brichardi Vs463 ighv AFNY01104014.1 13825 VKCEQLNQPASVIVQPGQRLTITCQVSYSVSGYWTAWIRQPAGKGLEWIGMAAGSSTEYKDSLKSKFSISTDSSSKTVTLTGQNMQPDDTAVYYCARY
Neolamprologus brichardi Vs316 ighv AFNY01026729.1 5275 VTGQSMESIPSSPVVKRPRETLSLSCRGSGFSFSCCSMHWNRQPAGKALEWLGRVHSSGGGTDYSSSLQGRMEITRDNSNSMTYLKLSNLKPEDSAVYYCAKQ
Neolamprologus brichardi Vs279 ighv AFNY01026681.1 1283 VDGQTLTQSEPVVKRPGEPHRLTCTGSGFTFSSHWMHWIRQAPGKGLEWIALIYTDSSGMFYSDSVRGRFTVSRDNSKQQLYLQMNSLKPEDSAVYYCARD
Neolamprologus brichardi Vs267 ighv AFNY01026671.1 3126 VCSQTLTESEPVVKRPGDSHKLTCTYAGISDDNAYISWIRQTEGKGLEWVAHISAPSGGTKVYSTSVQNRFTISRDNNVDQVYLQMNRLIAEDSAVYYCARK
Neolamprologus brichardi Vs315 ighv AFNY01026729.1 7291 VNCEQLSQPDTVTVQPGQSLTITCQVSYSVGNHHTAWIRQPAGKELEFVQSARVGYSTYYKDSLKNKFSISLDSSSNTVTLNGQNVQPEDTAVYYCARD
Neolamprologus brichardi Vs312 ighv AFNY01026724.1 2189 FLFTGVNGQTLTESEPAVKQPGQSHRLTCTTSGFTLSSYWMNWIRQAPGKGLEWIAADTNSATNYYSQSVQGRFTVSRENSRQQLYLQMNSLKTEDSAVYYCA
Neolamprologus brichardi Vs313 ighv AFNY01026726.1 525 TEGQTLTESEPVVKRPGDSHRLTCTYSGFAGDIYADWIRQRPGKGLEWIAHIESSSNSFYSQSFRGRFTISRDNSRKQVYLQMNSLTTEDSAVYYCVQE
Neolamprologus brichardi Vs310 ighv AFNY01026724.1 8964 VDCQTLRESEPVIKRPGDSHRLTCTASGFTFSSYWMNWIRQAPGKGLEWIATDTGGSSKYYSQSVQGRFTVSRDNSREQLYLQMNSLKTEDSAVYYCARE
Neolamprologus brichardi Vs278 ighv AFNY01026679.1 561 QTITESEPAVKRPGESHRLMCTTSGFSFGSSVWSWIRQAPGKGLEWIAFIHTASTPIHYSQSVRGRFTISRDDSSSKVYLQMNNLKTEDTAVYYCARV
Neolamprologus brichardi Vs318 ighv AFNY01026731.1 2052 NISVGTEGQTLTESESVVKRPGDSHTLTCTYSGFGGDIHAAWIRQAAGKGLEWIAYRSSGSSTISYSQSVRGRFTITRDNSRKQVYLQMSSLATEDSAVYYCARE
Neolamprologus brichardi Vs319 ighv AFNY01026732.1 3023 TGGQTLTESESVVKRPGDSHRLTCTYSGFSYDIAAAWIRQAAGKGLEWIARIESGSGSSKYYSQSVQGRFTISRDNSRKQVYLQMNSLTTEDSAVYYCARE
Neolamprologus brichardi Vs491 igkv AFNY01110552.1 3034 SSGQIIVTQSPGAQSVVAGQTVSITCRTSTGVSNYLHWYFQKPGGAPKLPIYLATNRQSGVSDRFSGSGSGTDFTLSIRGVQAEDSGVYYCQQSNNL
Neolamprologus brichardi Vs490 ighv AFNY01110484.1 587 VYSIDLIQSDSMVAQPGKSVTITCQVSGYSLTDRNYATGWIRQSKGKTLEWILHRWGNGDMAQNNALKNKLLHHTYTSTSSVTLTGVNLQPEDTAVYYCVRS
Neolamprologus brichardi Vs492 igkv AFNY01110552.1 372 SAGQNVVVTQSASRSVQLGQTVNINCKVSTQVAQYSGSRYFLAWYHQKTGEAPKALIYLTSDRLSGISSRLSGSGAGNGLDFTLSISAAQADDAGVYYCQS
Neolamprologus brichardi Vs495 igkv AFNY01117198.1 1081 SSAEIVLTQTPKAQSVVPGHTVSIRCKASSSMGSYLHWYLQKPSESPKLLVYYATSRQSGIPDRFSGSLSGTDFTLTISGVQAEDAGVYYCGQSGYSFP
Neolamprologus brichardi Vs494 trbv AFNY01116090.1 396 FCCSVKIYQPPFTLSREGENSATLQCEQDNDEYLYMFWYKHTDFRQMQLLTYSINKGIQTTEAPFNETKYFMSRPAVRNSSLHIKRVEPGDSAVYYCASRL
Neolamprologus brichardi Vs384 trav AFNY01066137.1 1638 YISVSLTQFYTVAVEPGQEITLQCSNFSSFATHIFWFRLADRLNASRISFMLTANSRVTFCDGFQDTKFNMTSNTSVLFLKIKQVDPSDSGLYFCGE
Neolamprologus brichardi Vs323 ighv AFNY01026736.1 920 VTGQSMESIPSSPVVKKPGDTLSLSCRGSGFSFDCCVMIWVREPAEKRLELIGSGFSTSSRNSYASSLRGRVEISRDDSNSMVSLRLSNLRPEDSAIYYCAKE
Neolamprologus brichardi Vs322 ighv AFNY01026736.1 2821 LNGQALESIPPTSVLKKPQEAFSLSCRGSGFDFGQYGMHWIRQPAGKTLEWMGVIWYDASKTIYASSVQGRIEITRDNSNSMVHLRLSNLKPEDSAVYYCARE
Neolamprologus brichardi Vs321 ighv AFNY01026733.1 1580 TEGQTLTESESVVKRPGDSQRLTCTYSGFSGDYSNAWIRQAAGKGLEWIAWISSSSSGSWHSQSFRGRFTISRDNSRKQVYLQMNSLTTGDSAVYYCARE
Neolamprologus brichardi Vs320 ighv AFNY01026732.1 906 TEGQTLTQSEPEVKSPGESHRLTCTYSGFSGHSATVWIRQAAGKGLEWIAFIWGESSGSFYSQSVRGRFTISRDNSRQQVYLQMNSLTVEDSAVYYCARL
Neolamprologus brichardi Vs327 ighv AFNY01026741.1 445 ACAQTLTESEPAVKRPGQSHTLTCAASGLTLSSNYMAWIRQPVGKGLEWIAWHDSGSGSRRFYSQSVQGRFTISRDDNRQLLLLQMNNLKAEDSAVYYCARE
Neolamprologus brichardi Vs326 ighv AFNY01026741.1 2440 VKCEQLTQPASVTVQPGHRLTITCQVSYSLSSYWTGWIRQPAGKGLEWIGVKSTGSSYYKDSLKNKFSIDLDTSSNTVTLNGQNMLPEDTAVYYCARD
Neolamprologus brichardi Vs325 ighv AFNY01026741.1 4838 VNISVGTEGQTLTQSEPVVKRPGDSHRLTCTYSGFNYNIDGVWVRQAAGKGLEWIAYISRSSAIFYSQSFRSRFTTSRDNSRKQVYLQMNSLTTEDSAVYYCAEQ
Neolamprologus brichardi Vs120 trbv AFNY01048743.1 895 FSHSVKIDQPQFISSSEGSAFVTLKCEQDDRQHYYMYWYRQSSSGNLELLTYSTGQDNSFIEAPFEKMKYTMSRRSVLNSTLQIHPVKAEDTALYYCASSR
Neolamprologus brichardi Vs123 trbv AFNY01048743.1 4593 FSRGVKIDQPKFIFSYEGTANVTLDCKQDDSGYYYMYWYRQSSSGKLELVTYSLSKDSWNIEAPFKNSQYTMSRPSLLESTLKIHLVGAGDTALYYCASSI
Neolamprologus brichardi Vs122 trbv AFNY01048743.1 3335 LTVVVLQSEDQMSDPGRTLMLECKMGSGFSMSGYTMLWYRQNHHGAPIEFLVKEYDKPLGRLESFIDTSKNNFSLQITELHMNDSSTYYCAA
Neolamprologus brichardi Vs125 igkv AFNY01048981.1 3936 CSGQVTVTQPPVLTFTPGSTVTLTCRTSQAVRRFDDGDDAMYWYQQKSGQAPKLLIKYATTLESGTPTRFSGSGSSSDFSMTISGVQAEDAAVYYCKS
Neolamprologus brichardi Vs124 igkv AFNY01048975.1 765 SDASSSVTQSPVFKAAALGQTVSLSCTASKGVDDDLSWYLQKPGQPPKLLFYKISSRESDTPSHFSSSGSEPEFTLTINGVQAADAGDYYCMGAYRGPE
Neolamprologus brichardi Vs126 igkv AFNY01048983.1 311 SDASSSVTQSPVFKAAALGQTVSLSCTASQGVDDDLSWYLQKPGQPPKLLFYQISSRESDTPSHFSSSGSEPEFTLTINGVQAADAGDYYCMGVYVGQ
Neolamprologus brichardi Vs78 trbv AFNY01048714.1 3750 QSQDVFQQPEIRWSYVYKAAHMNCSHNKDKGHSQMYWYIQRPGETMRLIVYTVFGGKSDYGGAPENKYSASKEAIENGALTVNDLQQNDSGVYFCAVS
Neolamprologus brichardi Vs480 ighv AFNY01107904.1 8688 VHSINLIQPESRVVQPGQSLTITCQVSGYSLTSYGTCWIRQREGKQLDWINCMWSGGSTANNDALKNKFSVSRDTSAQTVTITGQNLQPEDTAVYYCARY
Neolamprologus brichardi Vs481 ighv AFNY01107904.1 1473 WTITESEPAVKGPGESHRLTCTTSGFSFRGEVWNWIRQAPGKGLEWIALVHTSSTPIYYSQSVQGRFTISRDDSSSKVYLQMNNLKTEDTAVYYCAKR
Neolamprologus brichardi Vs277 ighv AFNY01026678.1 2394 WTIKESGPAVKGPGESHRLTCTTSGFSFSGEVWNWIRQAPGKGLEWIALVHTSSTPIYYSQSVLGRFTISRDDSSSKVYLQMNNLKTEDTAVYYCAKR
Neolamprologus brichardi Vs484 trbv AFNY01108239.1 4549 ASSFSDQVDQTPANIYTNGEEAKIHCSHSVQSFYQILWYQQSKKELQYLGHMYLGKSSVETGVNVTIDGGANKDEDCTLTIKDLKLSSSGVYFCAAS
Neolamprologus brichardi Vs485 trbv AFNY01108239.1 3007 GSSDGDQVDQTPANIHTNGEEAKIHCSHSISTYNQILWYKQSEKQLLLLGYMYYDKSYPEPGVNVTIDGDGRQHKNCTLTIKELELSSSGVYFCAAS
Neolamprologus brichardi Vs70 trbv AFNY01048707.1 2255 RTYGSVNQASMLWKNQGEDATLNCNHTMTIEFYQMYWYRQLPGELMKQMVYTIPNAEPDFEPDFRDEKFSVTKPDAHSGTLTVKNLVPGDQGLYFCAVR
Neolamprologus brichardi Vs71 trbv AFNY01048707.1 3505 DGSDVTQTSMIWKKQDEDATINCNHTKDYTYSQMYWYRQLPGETMKLVVFTSTAKPDHDFGNFSTEKFAATKPDAYTGTFTVKNLEPKDKGLYFCAVS
Neolamprologus brichardi Vs72 trbv AFNY01048708.1 1058 DGSDVTQTSMIWKKQGEDVTINCNHTKDIFHNQMYWYRQLPGETMKLVVFTSTAKPDHDFGNFSPEKFAATKPDAYTGTFTVKNLEPKDKGLYFCAVS
Neolamprologus brichardi Vs73 trbv AFNY01048709.1 1652 ASETKNVSQTPPAIIRRIGESVQSEIKCSHSIKDYEVILWYKQDQHQTLEILGYVNLQFVNKESNPSGNISFDGDGRKKSALTIYNLKFSDSAVYFCAAK
Neolamprologus brichardi Vs74 trbv AFNY01048709.1 3215 VSTTYNVQQTPPSIIKKVGQSVSSQIHCSHNMSIFERILWYKQDEHRAPQFLGYLNLNFPYPEEDVKGKISFNGNGQKYSNLTISNVSVTDSAVYFCAAS
Neolamprologus brichardi Vs75 trbv AFNY01048711.1 1510 VSSIYTVQQTPPFIIKKVGQSVSSQIHCSHNVSIFDRILWYKQDEHRALKFLGYLNEGYPNPENDVKGKISFNGNARKHSNLTISNVSVTDSAVYFCAA
Neolamprologus brichardi Vs87 trbv AFNY01048717.1 6308 HSQDVIQYPEISWRFLNKAAEMNCSHSKDIRYTQMYWYIQRPGETMRLIVYTAFRGNPDYGGAPENKYSAIKEAIENGALTVNNLQQNDSGVYFCAGS
Neolamprologus brichardi Vs81 trbv AFNY01048716.1 298 SSLSDRVHQDPADMYKMQGQTAEITCSHSIDSYNVILWYKQTKNNQLQLLGHVYSTSPSLEPGVTVTIAGNANKDQTCTLTIKEVFMNSSAVYFCAAR
Neolamprologus brichardi Vs80 trbv AFNY01048715.1 145 VCLGVEVHQSPSEFITNVGSKVEIFCSHEKTDYRVMLWYQQQPGETAMKLIGYLYYKDDKYEEQYKDHFNITGDLSVNTVKKGYLIVQVAQQEHSAAYYCAASK
Neolamprologus brichardi Vs88 trbv AFNY01048718.1 1166 VCLGVEVHQTPSEVFRTRGDEVQLVCSHGKTDYTFMQWYQKSPGDQALKRIGHLNYNNKEHEESFKTHFNITGDLSGSKPKNASMFIVDLKPEHSAVYYCAASY
Neolamprologus brichardi Vs306 ighv AFNY01026717.1 2016 VWSEIKLDQSPSEVQRPGERVKMLCIISGYSLTSYNIHWIRQRPGRALEWIGYMSTGNNSPSYASSFQSRFIMTEEDSSSRQYLEIKSLTAEDSAVYFCARE
Neolamprologus brichardi Vs230 ighv AFNY01116245.1 602 VYSIDLIQPESRSVQPGQSLTITCQVSGYSMTDNSYATGWIRQREGKAMDWISHQWGTSGLRQNDALKNKFSYSRDTSARTATITGQNLQTEDTAVYYCVRVS
Neolamprologus brichardi Vs330 ighv AFNY01026746.1 5269 NISVGTEGQTLTQSEPVVKSPGDSHRLTCTYSGFGGNYETAWIRQAAGKGLEWIAYISSGSSSIYYSQSVRGRFTISRDNSRKQVYLQMNSLTTEDSAVYYCA
Neolamprologus brichardi Vs331 ighv AFNY01026746.1 4021 TEGQTLTESESVVKRPGDSHRLTCTYSGLGGDIAAAWVRQAAGKHQEWIALIYGDSITFNSQSFRGRFTISRDNSRKQVYLQMSSLTTEDSAVYYCAQG
Neolamprologus brichardi Vs69 trbv AFNY01048706.1 599 DGSDVTQNSTIWKKQGEDVTINCRHTKSVDYSQMYWYRQLPGETMKLVVFTTTAKPDHDFGNFSREKFTATKPDAYTGTFTVKDLEAKDKGLYFCAVS
Neolamprologus brichardi Vs68 igkv AFNY01048371.1 6088 SDASSSVTQSPVFKTAALGQTVSLSCTASKGVDDDLSWYLQKPGQPPKLLFYKISSRESDTPSHFSSSGSEPEFTLTINGVQAADAGDYYCMGVYRGPV
Neolamprologus brichardi Vs161 trav AFNY01088098.1 2230 CKGEDKVIQDQGDVIAAEGDTVTLGCNFETTDTYPYLFWYKQEVNDFPKYVLRRDKTTGDNAQEFPKDRFDAELKENSVHLKIQKLQLSDSAVYYCALK
Neolamprologus brichardi Vs434 igkv AFNY01091783.1 1177 SAGQNVVVTQSASKSVQLGQTVNINCKVSTQVAQYSGSQYFLAWYHQKTGEAPKALIYLTSNRLSGISSRLSGSGAGNGLDFTLSISAAQADDAGVYYCQS
Neolamprologus brichardi Vs276 ighv AFNY01026678.1 4838 VDGQTLTESEPAVKRPGDSHRLTCTASGFTFSSYYMVWVRQAPGKGLEWIAFIYTDSSGMFYSDSVRGRFTISRDNSRQQLYLQMNSLNTEDSAVYYCARE
Neolamprologus brichardi Vs329 ighv AFNY01026743.1 1578 VDGQTLTQSEPVVKRPGESHTLTCTASGFSFSGYWMGWVRQAPGKGLEWVAYINSGSGSSKYYSQSVRGRFTISRDNSRQQLYLQMNSLTTEDSAVYYCARE
Neolamprologus brichardi Vs226 ighv AFNY01113511.1 735 TEGQTLTQSEPVIKRPGESHRQTCTYIGWDIQAAWIRQAAGKGLEWIAWINNGGSISYSQSFRGRFTISRDNNRKQLYLQMNSLTTEDSAVYYCAKE
Neolamprologus brichardi Vs328 ighv AFNY01026742.1 944 VQCEQLTQPAYVTKQPGQRLSISCQVSYSVGSYYTAWIRQPAGKGLEWIGSKYTGASYYKDSLKSKFSIDLDSSSNTVTLNGQNVQPEDTAVYYCARD
Neolamprologus brichardi Vs309 ighv AFNY01026724.1 11733 VKCEQLTQSGPVTLQPGQRLTISCQVTYSISTYWTAWIRQPAGKGLEWIGGSGVGHSTFYKDSLKNKFSISLDSSSKTVTLNGQNLQPEDTAVYYCARKPQ
Neolamprologus brichardi Vs420 igkv AFNY01089221.1 7733 AQMFSSVHPESRFISAQVGGNLTLKCFHDGDRSARLYWFKQNLGRKPKIISHFFKYNVNNSSNDELKNNPRFTLETQDGKYHLTIRDLQVSDSASYYCVYYL
Neolamprologus brichardi Vs424 igkv AFNY01089227.1 2412 SQMFSSEHRESRFISAQVGGKVTLKCLYDAHVSARVFWFKQNLGQKPKIISHFFKYNVNNSFSEELKNNPRFTLDTQDGKYHLTIKDLQVSDSAIYYCVQYS
Neolamprologus brichardi Vs308 ighv AFNY01026720.1 1141 VDGQTLTQSEPDLIKRPGESHRLTCTASGFTFRDYEMVWVRQATGKRPEWIAFISISTHSYATFYSQSVQGRFTISRDDSSSKVYLQMNSLKTEDTAVYYCARE
Neolamprologus brichardi Vs169 ighv AFNY01099206.1 882 VTGQSMESIPSSPVVKKPGETLSLSCRGSGFTFSCCTMNWVRQQPGKALEWIGEGYSDSSSNSYASSLRGRIEVSRDDSNSLTYLRLSNLKPEDSAVYYCAK
Neolamprologus brichardi Vs173 ighv AFNY01099217.1 450 TDGQTLSESEPVVKRTGESHRLTCTYSGFSSHIHAAWIRQAAGKGLEWIAFIWDDSSGSYYTESVRGRFTISRDNSRKQVYLQMNSLTTEDSAVYYCARE
Neolamprologus brichardi Vs178 ighv AFNY01099221.1 6080 VTPQSMESIPSSPVVKRPGETLSLSCRGSGFTFSCCTMHWIRQKPGKALEWMAEGYSSSSSNRYVSSLSGRIDVSKDNSNSMVHLSLSNLKPEDSAVYYCA
Neolamprologus brichardi Vs303 ighv AFNY01026712.1 2929 VNGQTLTESEPAVKQPGESHRLTCTTSGLSFSSYYMAWIRQAPGKGLEWIASISNSGGSTWYSQSVQGRFTISRDNSREQLYLQMNSLKTEDSAVYYCARE
Neolamprologus brichardi Vs377 trgv AFNY01063574.1 7771 LVTMAAELIQKDLTLTATPGKKVSFSCGTAQCSGSYVHWYQKKDGDKFRVILHINMRTGEVNSDYNHAQKKDFSAVKNENSCELEINAVSLVHSAIYYCSCAQS
Neolamprologus brichardi Vs324 ighv AFNY01026737.1 5105 VDGQTLTESEPVIKRPGESHRLTCTASGFSFSSYDMHWVRQTPGKVLEWVAEVSTGSSKYYSQSVRGRFTISRDNSRQQVYLQMNSLTTEDSAVYYCARE