WGS Statistics
Organism WGS Record. Vs Total IGHV IGLV IGKV TRAV TRBV TRGV TRDV
Ovis aries AMGL00000000.2 (AMGL02) 144 0 16 7 52 42 6 21
Ovis aries ACIV000000000.1 (ACIV01) 14 0 0 0 4 8 1 1
Vgene Table
Organism Vgene Locus contig Contig Pos. AA sequence
Ovis aries V5 iglv AMGL02004772.1 7139 SVISYELTQPTSVSVALGQMAKVTCSGDLLDENFAHWYQQKPGQAPVLVIYLNSERASGIPDRFSGSSSGSTATLTISGVQAEDEADYFCQSYGSSYN
Ovis aries V6 iglv AMGL02004772.1 14633 SVVSYELTQPTSVSVVLGQTAKVTCSGDLLDEQYTQWHQQKPGQAPELVIYEDSKRRSGIPDRFSGSSSSKTAILTISGVRAEDEADYYCVSWDSGSYN
Ovis aries V49 trav AMGL02031502.1 26924 VRGVDVEQSPPALTPQEGASSTLWCNFSTLADTVRWYLQKPGGRLIHLIYIPSGTRQEGRLNATAVPKERRSSLHISSLRTTDSGTYFCAVRHSASQ
Ovis aries V50 trav AMGL02031502.1 57296 MNGQQIKHFPESLLLQEGENFTTYCNFSSTFYNLQWYKQRPGGSPVLLMILAKGGEVKTQQRLTVRFGESRQHSSLHLTATQPSDVGTYFCAT
Ovis aries V51 trav AMGL02031502.1 64446 IMVDVEITQLSSMDCAEGEDVNLPCNHSTIDALDYIHWYRQTPNQSPQYVIHGFRDTVNSSMGSLNIASDRKSSTLVLSQVTLRDTAVYYCVLRE
Ovis aries V52 trav AMGL02031506.1 3541 ESTQQLEQNPKFLRIQEGGNVTLYCNSSSTFTFFQWYRQKPEEGPVLLVTLTKPKEMKEQKRIRAEFGEARKDSSLLITAAQPGDAGTYLCAG
Ovis aries V53 trdv AMGL02037996.1 1654 SCVAQEVTQNRPDISSQVGQSVTLNCRYETSWSYYYLVWYKQLPSGQITYLIQQYSENSNARNGRYSVNFQKADKSISLIISSLQLEDSAKYFCALRD
Ovis aries V54 trav AMGL02037996.1 9658 NVIDAKTTQPSSMDYAEEEDVTLTCSHSTIGGDVYIHWCQQNPSQSPQYVIHGLRGTGNSSMASLTIDSDRKSSTLVLPQVTLRDAAVYYCIVRE
Ovis aries V55 trav AMGL02037997.1 5511 GTGAQLVTQPDGHINVSEGNHLELRCNYSYGGSISLFWYVQYPSQGLQFLLKYLSGPTRVKGIKGFEAEFKNDENSFHLMKASAHWSDSAKYFCALC
Ovis aries V56 trav AMGL02038076.1 1776 VRGVDVEQSPPALSLQEGASYTLQCNFSTSPQSVNWYLQNSEGHLIQLFYIPSGTKQDGRLKATTVPAERRSSLHISSSQTTDSGTYFCAAQHSAPQ
Ovis aries V100 trav AMGL02031511.1 2376 VSSQYTLDQNPSFLSIQERTHANLSCTFQKKTFYNFLWFKQEPGKGLVSLSLIQSSQKEQADKNFKELLAKEKFYSVLRMSASHLGDSATYFCAL
Ovis aries V1 iglv AMGL02004748.1 7679 SWAQAVLTQPPSMSGSPGQMVTISCTASSSNMRLGDVDWYQQLPGSAPRTVIYDTIDRPSGVPDRFSGSRSDSTVTLTITSLQAEDEADYHCSAYDSSISA
Ovis aries V2 iglv AMGL02004748.1 36820 SLSQPLLTQPASLSASPGASARLTCTLSSGYSVGSYTIYWYQQKAGSPPRYLLRFKSDSDKHQGSGVPSHFSGSKDASTNAGLLLISGLQPEDEANYHCAVWHD
Ovis aries V3 iglv AMGL02004756.1 10896 SWAQAVLTQPPSVSGSLGQTVTISCSGSSSNIGGGNYVGWYQQLPGSGLKTIIYGTSSRPSGVPDRFSGSRSGNTATLTISSLQAEDEADYYCAAEDSSSYN
Ovis aries V4 iglv AMGL02004765.1 21722 SWAQSGLTQPASVSGNPGQMVSISCAGTSSDIGGYNGVGWYQQLPGSAPKTLIYNVNKRPSGIPARFSGSKSGNTATLTISGLQAEDEADYYCGSARSGYN
Ovis aries V7 trgv AMGL02015428.1 506026 GLGLSKVEQAQISLSTEVKKSIDIHCKIESTDFESEAVYWYRQKRNQALEHLVYVISTTTAARNQVDGKNKIEARKDARMFTSTLTVNFVEKEDVGIYYCAGWS
Ovis aries V8 trgv AMGL02015428.1 517414 GLGQLTLEQPELSVTGTREKSIIMTCKVFSKDFSKDYIHWYRQKPDQGLEQLLYVSTAPAQNHLGGKKNKLEARKDAPSSTSTLKISFLEKEDEATYYCAGWLS
Ovis aries V9 trgv AMGL02015428.1 524174 GDIKMKISQHQLSSTRRPDRTVHISCKLSGVPLENAVVHWYQEKEGEPLKRILYGSANSYKLDKPNSRLEMDNKKNGIFYLIINNVVKSDEATYYCACWD
Ovis aries V10 trgv AMGL02015428.1 561050 TQVSSNMGEDKLSVTRATGSSVVIDCDLTQNYIHWYKFQEGTVPRRLLYYDVYYSKVVLDSGISEGKYHVYKGTGKSYTFVISNLQESDSGTYYCAVWE
Ovis aries V11 trgv AMGL02015428.1 577001 MQVSSNMEGEKMSITKAAVPGAFVEIICDLITQTVKYIHWYKHQEGTAPRRLLYYDISYSKVVLESGISEGKYKVYKEKSYTFAISNLQESDSGMYYCAVWE
Ovis aries V12 trbv AMGL02015680.1 134448 TWGIGVFQTPKYRLTQMGTKTSLECEQKLNHDNMYWYKQDSKKLLKAMFHYNNKELVGNETVPSRFSPESPDKAHLNLYIDSLEPGDSAVYFCASS
Ovis aries V13 trbv AMGL02015680.1 138787 VSADPGITQIPKYLVMGMTDKKSLKCEQHLGHNAIYWYKQSAQKPPELMFIHSYMELSGNESVPSRFWPECPDSSQCRLDLSAPKPQDSAVYLCASSG
Ovis aries V14 trbv AMGL02015680.1 156415 LVDSEVTQTPKYLIKSRKEQATLRCSPDSGHFSVYWYQQALGQGPQFRFLVQYYRGQPSGEENMPDRFSAKQFSDFRSELNLSSLELTDSAVYLCASSQ
Ovis aries V15 trbv AMGL02015680.1 161258 AVHAGVTQDPRFQVVRRGQRVTLRCTQDLKYDYMYWYRQDPGHGLRLIHYSDGPSTTEKGDVPDGYNVSRPSTENFPLTLESASRSQTSVYFCASSY
Ovis aries V16 trbv AMGL02015680.1 168844 VVHAGVTQDPRFQVVKTGQRATLNCTQDLGHNYMYWYRQDPGHGLRLIHYSAGPPTTQQGDVPEGYSISRPSKENFPLTLESANPSQTSVYFCASSY
Ovis aries V17 trbv AMGL02015680.1 174663 LVDSEVTQTPKFLTKSRKQQVTLRCSPESGHRSGYWFQQALGQGPQFLVQYFDGKVYQRGNMSDRFSGQQSGSELNLTSLELMDSALYLCASSP
Ovis aries V18 trbv AMGL02015680.1 178632 LVDSEVTQTPKYLIKSRKQQGILRCSPESGHLYVSWYQQALGQGPQFLVQYYDGKVRTKGNMPGRFSGEQFSDSHSQMNLSSLELSDSAVYLCASSQ
Ovis aries V19 trbv AMGL02015681.1 2540 LVDSEVTQTPKYLIKSRKQQAMLRCSPESGHRSVYWYQQALGQGLQFLIQYYNSAENEKGNIPDRFSGKQFSDSSSELNLTSLELMDSAVYLCASSQ
Ovis aries V20 trbv AMGL02015681.1 4343 AVHAGVTQDPRFQVVTTGQSTTLRCTQDLSFSYMYWYRQDPGHGLRLIHYSVIPPATEKGAVPEGYSVSRSSTENFPLTLESANPSQTSVYFCSCGY
Ovis aries V21 trbv AMGL02015682.1 1528 LVDSGVTQTPRYLIKARGQRGTLGCSPVSGHLSVYWYQQALGQGPQFLVQYYRQQVRGEAQLPDLFSGEQFSDSSSELNLTSLELTDSAVYLCASSQ
Ovis aries V22 trbv AMGL02015682.1 16783 LVDSGVIQTPKYLIKSRKQQVTLRCFPESGHRYVSWYQQALGQGPQFLVQYFDREVNEKGNMPDRFSGEQFSDSRSQMNLSSLELTDSAMYLCASSQ
Ovis aries V23 trbv AMGL02015683.1 1810 AVHAGVTQDPRFQVVRTGQSLTLKCTQDLNHDSMYWYRQDLGHGLRLIHYSSFTDATYKGDMPDGYNVSRSSTENFPLTLESANRSQTSVYFCASST
Ovis aries V24 trbv AMGL02015683.1 4660 HTGAGVVSQSPRHRVAGRGQNVTLRCDPISGHISLYWYRQMLGQGPEFLTYFQNKQELDKSGMPKNRFSAKRPQSTYSYLNIQPAEPGDSAVYLCASSP
Ovis aries V25 trbv AMGL02015684.1 527 PLEAEVTQTPRHLIKTKGQTATLRCSPMSGHSSVSWYQQARSQGPQFLFEFYETLQRDKGNFSNRFSAKQFRDFSSELNVNFLELTDSALYLCASSL
Ovis aries V26 trbv AMGL02015686.1 413 HTRAGVVSQSPGYRVAGRGQNVTLRCDPIPGHQVLYWYRQMLGQGPEYLTYFQGKEESDKSGMPKNRFSAERPESTYSYLKIQPVEPKDSAVYLCASSP
Ovis aries V27 trbv AMGL02015686.1 22181 TTDANLGVTQTPRHEVTEKGQAVTLSCEPIKSHTALYWYRQTSMRGLELLIYFRSEAPVDESGMPKDRFSAKMPNASFSTLKIQPTDPGDSATYLCASSK
Ovis aries V28 trbv AMGL02015687.1 11379 PTDAGVTQTPRHEVTEKGQAVTLSCEPIKSHAALFWYRQTSVRGLELLIYFNNQSPVDESGMPKDRFSAKMPNASFSTLKIQPTDPGDSATYLCASSK
Ovis aries V29 trbv AMGL02015687.1 13868 YISAEVAQSPSHRVIEKKQAVNLSCDPISGHNSLFWYYHAVGTEMKLLVYFLRESVQDNSGMPKGRFTAERTEGTSSTLRVHSAELGDSGVYFCASSR
Ovis aries V30 trbv AMGL02015687.1 16187 HVGAMVIQNPRYLVTGLGKPVTLSCSQNMKHDAMYWYQQKPSQAPKLLLYYYDKEITREKNTSENFQSSRPNTSLCSLDIRSAGLGDSAVYLCASSR
Ovis aries V31 trbv AMGL02015687.1 21212 FLEAEVTQTPGHLVQGKGLEVEMYCVPKKGHIYVFWYQQILAKEFKFLISFQNDKVLDDKEMPKKRFSAECPSNSPCSLKIQPAEPQDSAMYFCASSD
Ovis aries V32 trbv AMGL02015687.1 35021 TVAGEVTQTPKYLLKKEGGAVTLECEQDFDYDSMYWYRQDPGLGLRRIFFSQVVMDVQEEDIAKGYSASREKKPFFPLTVTSAQKNQTALYLCAASR
Ovis aries V33 trbv AMGL02015687.1 40401 GSGLGAVVSQQPRRAVSKSGASVTIECRAVDFQATTVFWYRQFPKRGLVLMATSNAGTNATYEQGYNKDKLRISQPNLTFSSLMVTNVDPADSSLYFCGAR
Ovis aries V34 trbv AMGL02015687.1 47143 SMDTEVIQSPSHLVKGKDQKAKMDCVPIKGHSYVYWYRKKPEGAFEFLVYLQNQDVVEDTAMFKQQFSAECPQNSPCSLEIKSTKAADSALYFCASSQ
Ovis aries V35 trbv AMGL02015687.1 52347 SMDTGVTQSPSHLVKGKDQRAKMDCVPIKGHPYVYWYCKKLEAFEFLVYLWNGKITEDTAMFKQRFSAECPQNSPCSLEIKSTEAPDSALYICASS
Ovis aries V36 trbv AMGL02015687.1 61504 SMDTEVTQSPSHLVKGKDQRVKMDCVPKKGHSYVYWYRRKLEEAFEFLVYLQDEKIIEDTDMFKQRFSAECPQNSPCSLGIKSTKASDSALYFCASSQ
Ovis aries V37 trbv AMGL02015687.1 65784 SMDTEVIQSPGHLVKGKDQKATMDCVPIKGHVHVYWYRKKLEGAFEFLVYLQNQDVVEDTEIFQQQFLAQWPQNSPCSLEIKSTKAVDSALYFCASSQ
Ovis aries V38 trbv AMGL02015688.1 9085 SMDTEVTQRPSHLIKGKDQKAKMDCVPKEGHAYVYWYRKKPEGAFEFLVYLQNQVTMEDTAEFKQRFSAECPQNSPCSLEIKSTKAADSALYFCASSQ
Ovis aries V39 trbv AMGL02015688.1 13633 PTDAEIYQVRFLPAEAGQDVTLECKQNLGYSAMYWYRQDTGQGLKLIYYSTVEKDIQRGDLSEGYSVSREKKELFPLTVKSAQTKQTAVYLCSRA
Ovis aries V40 trbv AMGL02015688.1 17368 SMDTGVTQTPRNRIAITGNSTVLECSQTKGHEYMYWYRQDPGQGLRLVYSSYDINGINKGDVSAGYNVSRKEKAKFSLYLEPATPNQTAIYFCASSI
Ovis aries V41 trbv AMGL02015688.1 23706 FTDADVYQTPRHCVTGTGRKITLQCSQTMGHDNMYWYQQDPGMELQLIHYSYGVNTTEKGERSSRSTVSRISKEHFPLTLETASSSQTSSYFCASSD
Ovis aries V42 trbv AMGL02015688.1 25688 LEDATVIQFPRHRILEAEKEFTLQCSQKMNHYAMYWYRQDPGLGLQLIYYSTGPDTFKKGDVPEGYHVSRDELERFPLTLKSASPNQTSVYFCASAE
Ovis aries V43 trbv AMGL02015689.1 10355 LMDAQVTQTPRYLVKRRGEKVLIECMQNMDHERMFWYRQDPALGLRLLHFSINVDLLEEGDVPYGYSVSRTKKKSFPLTLESATTNQTSMYLCASSE
Ovis aries V44 trbv AMGL02015689.1 17991 SVFSALLSQKPSRAIRQRGTSMMIECQVDSQLTLMYWYRQLPGQSLVLMATANQGSKATYESGFTEDKFPISRPNLAFSTLTVSNASSEDSSSYFCSAG
Ovis aries V46 trav AMGL02030975.1 4609 GVRGVKVEQRPSILSLQEGANSTLWCNSSDTVKSVQWFQQNPRGSLITLFFIASGMKQNERLSSTVNSKEQYSTLHITASQLEDAATYLCAVE
Ovis aries V47 trdv AMGL02031495.1 188892 KGVLCNQVTQSSPEQRVASGREVTLQCTFQTTYSNPDLYWYRKTPDAVFQFVLYRDNTRSRDADFARGRFTVQHSVRSKTFHLVISSVRPEDTATYYCALEL
Ovis aries V48 trdv AMGL02031502.1 11205 SGVAQRVIQDQPDISGQLGQLVTLNCRYATTWSYYYVFWYKLLPSGEMIYLIHQVSSGQNAKNGRYSVNIQKAQKSISLTISDLQLEDSAEYFCA
Ovis aries V57 trdv AMGL02038077.1 2223 SGAAQKVTQDQPDITRQVEQSVTLNCLYEVSWYMDAYSIFWFKQLPRGQMIYLICQYSEDGNARDGRYSVNFQKADKSISLTISALQLEDTAKYFCALRE
Ovis aries V58 trav AMGL02038392.1 6793 VNSQQGEQNLQTLSIQEGENITMNCSYKSITITALQWYRQDSRRGFVHLILMRSNERQKHSGRLHFTLDSSIKSSSMSITASQAEDTATYFCAP
Ovis aries V59 iglv AMGL02038800.1 2002 SLSQPLLTQPASLSASPGASARLSCTLSSGYNVGNYSIYWYQQKAGSPPRYLLRFKSDSDKHQGSGVPNRFSGSKDASTNAGLLLISEVQPEDEADYYCAVWHD
Ovis aries V60 trav AMGL02038887.1 4502 GTNGDSVNQTEGSVTVSEGALMTLNCTYQTAGLTPYLYWYVQHLSKAPRLLLKGSERDPKPKSEGFQATLVQSDRSFHLQKLAVQTSDSAVYYCALS
Ovis aries V61 iglv AMGL02039431.1 4091 SWAQAVLTQPSSVSRSLGQSVSITCSGSSSNIGGGYYVGWYQQLPGSAPRTLIYQNSKRPTGVPDRFSGSKSGSTATLTISSLQAEDEADYYCSAYDSSISA
Ovis aries V62 iglv AMGL02039432.1 3983 SPPQPLLTQPASLSASPGASARLSCTLSSGYSVGDFSLSWFQQKPGSPPWYVVRVKSDSDKNQSSGVPNRFSGSKDASANAGLLLISGLQPEDEADYHCAVWHG
Ovis aries V63 iglv AMGL02040353.1 2265 SWAQSALTQPASVSGNPGQTVTISCTGTSSDIGGYNYIGWYQQLPGSAPKTLIYNVNKRPSGIPARFSGSKSGNTATLTISGLQAEDEADYYCSSYKSA
Ovis aries V64 trav AMGL02040982.1 9279 VSGKNQVEQSPPSLAVLEGENCTFQCNYTVSPFNTLRWYTQDTGRGLVSLITMTYSDNKKSNGRYTATMDATAKHSFLHLTAAQLSDLAFYICVVG
Ovis aries V65 iglv AMGL02041636.1 1544 SWAQSALTQPASVSGNPGQTVSISCAGTSSDIGGYNGVGWYQQLPGSAPKTLIYNVNKRPSGIPARFSGSKSGNTATLTISGLQAEDEADYYCSSYKSA
Ovis aries V66 trdv AMGL02041707.1 1235 SSVAQRVTQDQPDISSQVGEVVTLSCRYETIQSRYNIFWYKQLPSGEMIYLIGHDSSSQNARYGRYSVNFKISRKFISLTISDLELEDSAKYFCTLWE
Ovis aries V67 trav AMGL02042528.1 1017 QTRGDSVSQMDGQVTLLEGATLTVNCTYSAIGYPTLFWYVQYPGEGPQLLLKATKANDKGTNEGFEATYDAKTTSFHLEKASVQESDSAVYHCALS
Ovis aries V68 trbv AMGL02042892.1 736 LVDSGVTQTPRYLIKARGQRGTLGCSPVSGHLSVYWYQQALGQGPQFLVQYYRQQVRGEAQLPDRFSGEQFSDSSSELNLTFLELTDSAVYLCASSQ
Ovis aries V69 trbv AMGL02042894.1 626 AVHAGVTQDPRFQVMRTGQNATLNCTQDLGHDRMYWYRQDPGHGLRLIYYSAGPLSTEKGDVPDGYRVSRSSKQNFPLTLESASRSQTSVYFCASSY
Ovis aries V70 trbv AMGL02042894.1 2911 LVDSGVTQTPKYLIKSRKQEVTLRCSPESGPRYVSWYQQALGQGPQFLVQYYDGKVHIKGNMPGQFSGEQFSDSRSQMNLSSLELSDSAVYLCASSQ
Ovis aries V71 iglv AMGL02004755.1 2573 SWAQAVLTQPSSVSRSLGQSVSITCSGSSSNVGYGNYVGWFQQVPGSAPKLLIYGATSRASGVPDRFSGSRSGNTATLTISSLQAEDEADYYCASYD
Ovis aries V72 igkv AMGL02011803.1 319691 DIQVTQSPSSLSASLADKVSITCQASQNTDTKLAWYQQKPRKAPKLLIYAVSRSPSWFPSQFSGSGFGIDFTLTISSLKADDIAAYYCQQDHGLP
Ovis aries V73 igkv AMGL02011804.1 63149 SSGDVVLTQTPLSLSVTPGGTVSISCKSSQSLKYSDGNTYLYWFQHKPGQSPQLLIYQVSNRYTGVPDRFTGSGAETDFTLTISSVQAEDAGVYYCLQAINYP
Ovis aries V74 igkv AMGL02011804.1 48061 SSGDVVLTQTPLSLSVIPGETASISCKSSQSLVHSDGNTYLNWIQHKPGQSPQGLIYQVSNRYSGVSDRLTGSGSGTDFTFTISSVQAEDAGVYYCYQGTEAP
Ovis aries V75 igkv AMGL02011804.1 17857 ARCDIQVTQSPSSLSASLTERVSITCRTSQSVSNYLNWYQQKPGQAPKLLIYYATRLHTDVPSRFSGSGSGTDYTLTISSLEANDTATYYCLQYDS
Ovis aries V76 igkv AMGL02011804.1 2008 ASGEAVLYQTPAYIAVPLGESISITCRANQSISDYLSWHKQKPGQAPMILIYDADNRLNGVPERFTATQSGTEFVFTISQVEADDAAMYYCQQSYVLP
Ovis aries V77 igkv AMGL02011805.1 18272 SSGDTADPDSTLPVYHPWRMASISCKSRRSLLYSDGNTYLYWFQHKPGQSPQRLIYQISSRDTGVSDRFTGSGSGTDFTLAVCRVQAEDAGVYYCFQD
Ovis aries V78 igkv AMGL02011805.1 5344 SNGAIVLTQTPRSLSVIPGETASISCRASQSVQNRYGDNFLHWYVQKPSQSPQLLIYAASNRASGVSDRFTGSGSGTDFTLKISRVEAEDAGVYYCQQSKETP
Ovis aries V80 trgv AMGL02015083.1 100085 IQQEIRLSQRSVMVGSAGGAMTMPCHVSRSVDYVHWFRQLEGQAPERLLYLALSKRDVQWDSVLGGDKVSTEDGKSCTMSLRKLAKSDEGLYYCAAWGS
Ovis aries V82 trbv AMGL02015690.1 14187 VRAQTIHQWPSTRVQPAGSLLSLECTVKGTSNPTLYWYRQEAGGSLQLLFSSVGVNQIEPREFQNFEASRPQDGQFTLSSKKLQLNNSGFYLCAWS
Ovis aries V83 trav AMGL02031495.1 407884 VSGKNGVEQSPRYLSAQEGDLITINCNYLEGMTTLQWLQQNPGGSIISLLTLSLEMKKKGRVSATINRRERYSSLNITAPQPTDSAIYFCAVE
Ovis aries V84 trdv AMGL02031495.1 378222 SDNVESADVPTVYKKEGESVTVECKFSVSYTYYMMYWYRQPSSGEMIYMINIYSQSKQTREGRYSVEFYKPNQMLKLTISALTLSDSAVYFCGVRE
Ovis aries V85 trdv AMGL02031495.1 310199 VMSAVVLVPQDQEKTVPVGKSVTLSCSMKGAMFISKHYIFWYRKTPGNTMTFIYREEGVYGPGFEDNFRGKIDNSTNQAMLEILKASERDGGFYYCASD
Ovis aries V86 trdv AMGL02031496.1 5136 PSVAQTVTQPQPEESVQEADTVTLDCTYTTSESDCYLFWYKQPPSGEMVFIIHQYAYEQQNSTNDRYSVNFQKESKAFSLRISDSQLEDAAKYFCAYSG
Ovis aries V87 trav AMGL02031497.1 62958 VLGDSKTTQPNSVEGTEEEPVHLPCNHSTISGSEYVYWYRQIPRQGPEYLIHGLNNNVTNRMASLSIAKDRKSSTLVLPQVTLRDTAVYYCILR
Ovis aries V88 trav AMGL02031497.1 55843 LRVQMKVEQSPGVLTLQEGRNSSLICNYSISMTSVQWFQQNPDGHLISLFYIASGMQQKGRLKSTINSKERYSQLYIRDSQPGDSATYFCAVE
Ovis aries V89 trdv AMGL02031497.1 45276 SSMADKVTQAQTTVTGQEREAVTIGCTYETSQTYYTLFWYRQFPGGRMEFLIYQDSNQANARRDRYSVNFQKGKKIISLTISSLHLADSAKYFCALWE
Ovis aries V90 trav AMGL02031497.1 33828 VLGDTKTTQPNSVEGAEEEPVHLPCNHSTISGPEYIYWYRQIPHQGPEYLVHGLNNNVTNRMASLSIAKDRKSSTLVLPQVTLRDTAVYYCILRE
Ovis aries V91 trav AMGL02031497.1 25784 VSAQQLNQSPQSMSIQEGEDLSMNCNSSSTLNLLLWYKQDAGEGLILLIKLLKGGELARNGKLTAQFGGTRKDSLLNNSAFEPKDGGTYFCAG
Ovis aries V92 trav AMGL02031497.1 13025 VKSDDNVMQSPSSLIVLEGSNATLSCSYKVTNFQSLHWYKQEEKVPTFLFVLISTGIEKTSGRLKGTLDRKELLSTLYITVTKPGDSATYLCAVE
Ovis aries V93 trav AMGL02031497.1 6848 PRRADWIRSQESEVPGTEGKTVSLFCNYYTSSRSFVSLFWYRQYPNQAPEYILYRQWGSSGKGYASFATERFYSDNTANTTNLYIKKVVPADTALYLCALE
Ovis aries V94 trav AMGL02031498.1 17395 LSVQMKVEQSPGVLTLQEGRNSSLICNYSISIRSVQWFQQNPDGRLISLFYIASGMQQKGRLKSTINSKERYSQLYIRDSQPGDSATYFCAVE
Ovis aries V95 trdv AMGL02031499.1 12346 SGVAQKVTQDQPDISSQVGELATMNCQYETSWSSYNIFWYKQLPRGELIYLIGQNSYSPNARDGCYSINFQRSRKAINLIISALKLEDSAKYFCALWE
Ovis aries V96 trav AMGL02031500.1 28043 TVIDAKTIQPSSMDCAEEEDVNLPCNHSTISGNEHIHWYRHNPNQSPQYVIHGLRGTVNSSMASLHIASDRKSSTLVLPQVTLRDTAVYYCILRE
Ovis aries V97 trdv AMGL02031500.1 5057 SSVAQRVTQNQPDISTQVGEIVTLSCRYETVQSHYHIFWYKQLPSGEMIYLIGHDSSSQNARYGRYSVNFKISRKFISLTISDLELEDSAKYFCTLWE
Ovis aries V98 trdv AMGL02031508.1 13164 SCVAQKVTQNQPDISSQVGQSVTLNCRYETSWSYYYLVWYKQLPSGQITYLIQQYSENSNARNGRYSVNFQKADKSISLIISSLQLEDSAKYFCALRD
Ovis aries V99 trav AMGL02031509.1 7497 GTRAQTVTQPESHISVSEGDPVQVKCSYSYSGSPVLFWYVQYPRQHLQLLLKHTSKESIQGFTAELSRAEASFHLKKPSTQEEDSAVYYCALG
Ovis aries V101 trav AMGL02031512.1 4467 QTRGDSVSQMDGQVTLLEGATLTVNCTYSAIGYPTLFWYVQYPGEGPQLLLKATKANDKGTNEGFEATYDAKTTSFHLEKASVQESDSAVYHCALS
Ovis aries V102 trav AMGL02031512.1 466 GVRGLKVEQSPSILSLQEGANSTLWCNSSDTVKSVQWFQQNPRGSLITLFFIASGMKQNERLSSTVNSKEQYSTLHITASQLEDAATYLCAVE
Ovis aries V103 trav AMGL02031513.1 2959 MNGQQIKHFPEFLLLQEGENFTTYCNSSSTFYNLQWYKQRPGGSPVFLMILTKPGEAKTEQRLTGRLGETRQHSSLHLAAAQLSDAGTYFCAE
Ovis aries V104 trdv AMGL02031514.1 16890 SGVAQNVTQNQTVIISQVGKIVTLNCQYEISRNVHDYWIFWYQQLPSGEMTYLIHQYSEDRNERDGRYSVNFQKARKSISLTISFLKLEHSAKYFCALW
Ovis aries V105 trav AMGL02031515.1 24140 SSSKQDVSQSPEALSVREGDSLVLNCSYTDSALYFLQWFRQDPGKGLISLLSIQANQKEQTSGRITVSLDKSSRHSALYIATSQHSDSTTYLCAV
Ovis aries V106 trav AMGL02031515.1 19512 AGAQSVTQPDDHITVSEGARLELKCNYSSSVSPYLFWYVQYPNQGLQLLLKYESGDNLVSGIKGFEAELRRSEESFHLRKIPAHWKDSAKYFCVLS
Ovis aries V107 trav AMGL02031515.1 16639 VRGMDVAQSPPALSLQEGASSTLRCNFSTFADDVRWYLQNSRGRLIHLIYIPSGTKQEGRLNATTVPTERRSSLHISPLQTTDSGTYFCAAQHSASQ
Ovis aries V108 trdv AMGL02031515.1 3021 SGVAQKVTQDQPYITSQTGQSVILNCRYEVSWSGYMHYLFWYKQLPSGEMTFLIRQESSGPNARNGRYSVNFQRAQNTISLTISALQLEDSAKYFCAVWE
Ovis aries V109 trav AMGL02031516.1 6109 QTRGDSVSQMDGQVTLLEGATLTVNCTYSATRYPTLFWYVQYPGEGPQLLLKATKASDKGSNKGFEATYNAKTTSFHLEKASVQESDSAVYHCALS
Ovis aries V110 trav AMGL02031516.1 1846 GVRGVKVEQRPSILSLQEGANSTLWCNFSDTVSTVQWFQQNPGGSLTRLFVIASGTKQNERLSSTVNSKEQYSTLHITASQLEDAATYLCAVE
Ovis aries V111 trav AMGL02031517.1 99195 TLSLAKTSQPIIIDSYEGQEVNIPCNHTTIAISEYIFWYRQFPNQGPQFVIQGYTTTVENEVASLLIPPDRKFSTLSLPRASLGDAAVYYCIVRD
Ovis aries V112 trav AMGL02031517.1 87845 GVRGVKVEQSPSVLSLQEGANSTLWCNFSDTVSSVQWFQQNPEGSIISLFFIASGTKQNERLSSTLNSKERYSTLHITASQLEDAATYLCAAE
Ovis aries V113 trav AMGL02031517.1 77013 KSRGEKVEQYPSFQSVQEGDNCVINCTYTDSASAYFVWYKQEPGKGLQLLIHTLSNVDKKEGQGLIVLLNKKNKHLSLNITATHPGDSATYFCAAR
Ovis aries V114 trav AMGL02031517.1 50667 QLVTQPDDPVLVSEGTSLELKCNYSYGATPYLFWYVQYPGQRPQLLLKYFSGNTMVQGIRGFVAEFRSSDFSFNLRKFSAHWSDSAEYFCALS
Ovis aries V115 trav AMGL02031517.1 23051 STVAQKVTQDPQPILVQEKEAVTLDCTYDTSDSSYSLFWYKQPNSGAMIFLLSQDSYGKQNASEGRYSLNFQKASKSITLVISASQLEDSAVYFCALREPAVR
Ovis aries V116 trav AMGL02031517.1 16869 QTHGNSVTQMDGQVSRSEGTSVTINCTYSASGYPALFWYVQYPGEGPQLLLKATKAGDKGTNKGFEATYNTETTSFHLEKASVQESDSAVYYCALS
Ovis aries V117 trav AMGL02031517.1 12228 VSLGNKVEQSPSTLNVQEGNSSVITCTYTNGYSEYFPWYKQEPGKGPQLLIAIRSNKDKEEDQRLTVLLNKTAKRLSLHIAATEAGDSAVYFCAAG
Ovis aries V118 trav AMGL02031517.1 6906 SSIAQKVTQDQPPMSVQEKENVTLDCTYDISITTYSLFWYKQPSSGVMTFLIRQDSSNKPNATEGRYSLNFQKAGKFITLTISASQLEDSAVYFCALSE
Ovis aries V119 trav AMGL02031519.1 2131 SAGKGVEQPTELTAMEGASAQVNCTYQTSGFNGLFWYQQHDGGAPVFLSYNVLDGLETRGHFSSFLRRSDAHSYLLLKELHMKDFASYLCAVI
Ovis aries V120 trav AMGL02038528.1 5998 GTNGDSVSQTEGPVTVSEGALMTLNCTYQTAYPDFYLFWYVQHLNKAPQFLLKGSMTNQRPEHEGFEATLFKSDSSFHLQKRAVQASDSAVYYCALS
Ovis aries V121 trav AMGL02038528.1 3811 SIMAQKVTQNLSEISVLEKEDVTLNCAYEANSYTYYLFWYKQPPSGEMIFLIHQESYNELNTTKGQYFLNFQKATSSISLTISDLQLEDSAVYFCALR
Ovis aries V122 trav AMGL02038675.1 5095 QTRGDSVSQMDGQVTLLEGATLTVNCTYSAIGYPTLFWYVQYPGEGPQLLLKATKANDKGTNEGFEATYDAKTTSFHLEKASVQESDSAVYHCALS
Ovis aries V123 trav AMGL02039312.1 1822 VSSQQNTVEQSPASLPVPEGVIASLGCTYSDSYSQYFTWYRQYPGKGPEFLLQVYADKDKEEGKFTVQSNKTNKRVSLRIRDSEPSDSATYLCAV
Ovis aries V124 trbv AMGL02039522.1 4169 VVHAGVTQDPGFQVMRTGESATLRCTQDLSFSYMYWYQQDPGHGLRLIHHSVIPPSTEKGAVPEGYSVSRPSTENFPLTLESANHSQTSVYFCASSY
Ovis aries V125 iglv AMGL02039555.1 841 SVISYELTQPTSVSVALGQMAKVTCSGDLLDENFAHWYQQKPGQAPVLVIYLNSERASGIPDRFSGSSSGSTATLTISGVQAEDEADYFCQSYGSSYN
Ovis aries V126 trav AMGL02039628.1 12929 VRGVDVEQSPPALSLQEGASYTLRCNFSTFPQSVNWYLQNPGGHLIHLFYIPSGTKQDEKLNTVTVLTERRSSLHVSSSQTTDSGTYFCAVQCSAPK
Ovis aries V127 trdv AMGL02039628.1 7324 SGVAQKVTQDQPDITSQVGQSVTLNCKYEVSWYKISYSIFWYKQLPSGQMTYLIRQYSENANARDGRYSVNFQKADKSISLTIPALQLKDTAKYFCA
Ovis aries V128 trav AMGL02040470.1 15807 GTSGDSVTQTEGVVILPEKASLTLKCTYQSSYSDFLFWYVQYKNKELELLLKSSLDNQKVTSRGFEATHISSDSSFHLQKSSVQTSDSAVYYCALS
Ovis aries V129 trav AMGL02040470.1 11797 GTNGDSVNQTEGPVTVSEGALMTLNCTYQATYSIVYLFWYVQHLNKAPRLLLKGSMSDLKPKSEGFQATLVQSDRSFHLQKRAVQASDSAVYYCALS
Ovis aries V130 trav AMGL02040470.1 856 GTNGDSVDQTEGPVTVSEGALMTLNCTYQATYSNVYLFWYVQHLSKAPQLLLKGLTADKKVEHEGFQATLVQSDRSFHLQKRAVQASDSAVYYCALS
Ovis aries V131 trdv AMGL02041433.1 981 SGVAQRVIQDQPDISGQLGQSVTLNCRYGTTWSYYYVFWYKLLPNGEMIYLIHQVSSGQNARNGRYSVNFQKARKSISLTISDLQLEDSAEYFCALWE
Ovis aries V132 trav AMGL02041436.1 1044 GTNGDSVSQTEGPVTVSEGALMTLNCTYQTTYPDFYLFWYVQHLNKAPQFLLKGSITNQRPEHEGFQATLVQSDRSFHLQKRAVQASDSAVYYCALS
Ovis aries V133 trdv AMGL02041831.1 2328 SGVAQKVTQDQPDISSQVGQSVTLNCRYETSWRVYYLFWYKQLPSGQMTYLIQQYSGYSNARNGRYSVNFKKADKSISLIISSLQLEDSAKYFCALCD
Ovis aries V134 trdv AMGL02042428.1 3036 SGVAQKVTQDQPDIASQVGESAAMNCQYETSRNSYNIFWYKQLPSGEMIYLIGQNSYSPNARDGRYSINFLRSLKAISLIISALKLEDSAKYFCALWE
Ovis aries V135 trav AMGL02042429.1 15474 TMIDTKTTQPSSVDCAEGENVNLPCNHSTIGGDDYIHWYRQNPNQSPQYVIHGFRDTVNGSMASLTIASDRKSSTLVLPQVTLRDAAVYYCIVRE
Ovis aries V136 trdv AMGL02042429.1 1360 SSVAQRVTQDQPDISSQVGEVVTLSCRYETIQSRYNIFWYKQLPSGEMIYLIGQGSSSQNARYGRYSVNLQRSRKSISLTISDLELEDSAKYFCALWE
Ovis aries V137 trdv AMGL02042431.1 7333 SGVAQSVTQDQPDILSEVGKTITLNCRYETSWDMLSYYIFWYKQLPSGKMTYLIRQHSDDGNARDGRYSVNFQKAHKSISLTISALELEDSAKYFCILRV
Ovis aries V138 trbv AMGL02042640.1 1099 VVHAGDTQDPRFQIVRTGQKATVTCTQDLGHDPMYWYRQDLGHGLRLIHYSVAYPTTEKGDVPEGYSVSRPSTEDFPLTLKSANRSQTSVYFCASSY
Ovis aries V139 trav AMGL02043101.1 11217 GTNGDSVNQTEGPVTVSEGALMTLNCTYQATYSTVYLFWYVQHLSKAPQLLLKGLTADKKVEHEGFQATLVKSDRSFHLQKRAVQASDSAVYYCALS
Ovis aries V140 iglv AMGL02043359.1 3232 SWAQAVLTQPPSVSGSLGQTVTISCSGSSSNIGLLGVSWYQQLPGSAPKTLIYGSNKRPSGVPDRFSGTKSGNTGTLTITSLQAEDEADYYCASADLSLKS
Ovis aries V141 iglv AMGL02043359.1 449 SLSQPLLTQPASLSASPGASARLSCTLSSGYNVGNYSIYWYQQKAGSPPRYLLRFKSDSDKHQGSGVPNRFSGSKDASTNAGLLLISEVQPEDEADYYCAVWHD
Ovis aries V142 iglv AMGL02043360.1 3747 SWAQAVLTQPSSVSRSLGQSVSITCSGSSSNVGYGNYVGWFQQVPGSAPKLLIYGATSRASGVPDRFSGSRSGNTATLTISSLQAEDEADYFCGSYAGSSYN
Ovis aries V143 trbv AMGL02043444.1 1780 LVDSGLSLTPKYLIKSRKEQLTLRCSPESGYRSVYWYQQALGQGPQFLVQYYDGEIYQKGNLSDRVSGKQFSDACSELSLIPLELTPSAVYLCASSQ
Ovis aries V144 trbv AMGL02043445.1 8379 AVHAGVTQDPRFQVVRRGQSTTLYCTQDLGHDRMYWYRQDLGHGLRLIHYSVAYPTTEKGDVPEGYSVSRPSTEDFPLTLKSANRSQTSVYFCASSY
Ovis aries V145 trbv AMGL02043445.1 6336 LVDSGVTQTPRYLIKARGQRGTLGCSPVSGHLSVYWYQQVLGQGPQFLVQYYSQNVYGETQLPDRFSGEQFSDSSSELNLTSLELTDSAVYLCASSQ
Ovis aries V146 trdv AMGL02044486.1 607 SGVAQKVTQDQPDISSQVGQSVTLNCRYETSWRVYYLFWYKQLPSGQMTYVIRQGSEMTNARKDRYSVNFKKADKSISLIISSLQLEDSAKYFCALRE
Ovis aries V147 trav AMGL02046320.1 5033 GLRAQSVTQPEDEVPVAEGDPVTVKCTYSVSGSPYLSWYVQHRNQGLQFLLKYITGDPLVKGNYGFEAEFNESQTSFHLKKPSVLGSDSAVYFCAVS
Ovis aries V12 trbv ACIV010364121.1 1117 TWGIGVFQTPKYRLTQMGTKTSLECEQKLNHDNMYWYKQDSKKLLKAMFHYNNKELVGNETVPSRFSPESPDKAHLNLYIDSLEPGDSAVYFCASS
Ovis aries V13 trbv ACIV010364140.1 470 PLEAEVTQTPRHLIKTKGQTATLRCSPMSGHSSVSWYQQARSQGPQFLFEFYETLQRDKGNFSNRFSAKQFRDFSSELNVNFLELTDSALYLCASSL
Ovis aries V14 trbv ACIV010364185.1 516 FLEAEVTQTPGHLVQGKGLEVEMYCVPKKGHIYVFWYQQILAKEFKFLISFQNDKVLDDKEMPKKRFSAECPSNSPCSLKIQPAEPQDSAMYFCASSD
Ovis aries V15 trbv ACIV010364208.1 647 PTDAEIYQVRFLPAEAGQDVTLECKQNLGYSAMYWYRQDTGQGLKLIYYSTVEKDIQRGDLSEGYSVSREKKELFPLTVKSAQTKQTAVYLCSRA
Ovis aries V16 trbv ACIV010364220.1 426 LEDATVIQFPRHRILEAEKEFTLQCSQKMNHYAMYWYRQDPGFGLQLIYYSTGPDTFKKGDVPEGYHVSRDELERFPLTLKSASPNQTSVYFCASAE
Ovis aries V17 trbv ACIV010364228.1 50 LMDAQVTQTPRYLVKRRGEKVLIECMQNMDHERMFWYRQDPALGLRLLHFSINVDLLEEGDVPYGYSVSRTKKKSFPLTLESATTNQTSMYLCASSE
Ovis aries V18 trbv ACIV010364320.1 258 SMDTGVTQTPRNRIAITGNSTVLECSQTKGHEYMYWYRQDPGQGLRLVYSSYDINGINKGDVSAGYNVSRKEKAKFSLYLEPATPNQTAIYFCASSI
Ovis aries V21 trgv ACIV010445120.1 902 MQVSSNMEGEKMSITKAAVPGAFVEIICDLITQTAKYIHWYKYQEGTAPRRLLYYDISYSKVVLESGISEGKYQVYKEKSYTFAISNLQESDSGMYYCAVWE
Ovis aries V87 trdv ACIV012287413.1 13 SIIAQKVTQDAQPMLIQEKKAVTLDCTYDTRDSSYSLFWYKQPAVGNDFLLRQDSYGKQMPQKVADSLNFQKASKSITLVISASQLEDSAVYFCALREPTVR
Ovis aries V98 trbv ACIV010364389.1 609 VRAQTIHQWPSTRVQPAGSPLSLECTVKGTSSPNLYWYRQEAGGSLQLLFSSVGVNQIEPREFQNFEASRPQDGQFTLSSKKLQLNNSGFYLCAWS
Ovis aries V117 trav ACIV010958892.1 513 VSAQQLNQSPQSMSIQEGEDLSMNCNSSSTLNLLLWYKQDAGEGLILLIKLLKGGELARNGKLTAQFGGTRKDSLLNNSAFEPKDGGTYFCAG
Ovis aries V118 trav ACIV010958911.1 680 VSGKNGVEQSPRYLSAQEGDLITINCNYLGGMTTLQWLQQNPGGSIISLLTLSLEMKKKGRVSATINRRERYSSLNITAPQPTDSAIYFCAVE
Ovis aries V119 trav ACIV010958929.1 2434 DSRGQSVTQPDDPVLVSEGTSLELKCNYSHGATLYLFWYIQYPRQSPQLLLKYFSGNTMVQGIRGLVAEFKSSDFSFNLRIFSAHWRDSAEYFCALS
Ovis aries V120 trav ACIV010958956.1 320 LSVQMKVEQSPGVLTLQEGRNSSLICNYSISMTTLQWLQQNPGGSIISLLTLSLEMKKKGRVSATINRRERYSSLNITAPQPTDSAIYFCAVE