WGS Statistics
Organism WGS Record. Vs Total IGHV IGLV IGKV TRAV TRBV TRGV TRDV
Bos taurus AAFC00000000.5 (AAFC05) 341 7 20 8 160 82 9 55
Bos taurus DAAA00000000.2 (DAAA02) 342 7 20 8 160 82 9 56
Vgene Table
Organism Vgene Locus contig Contig Pos. AA sequence
Bos taurus V0 trbv AAFC05014183.1 347 LTGSVDTEVIQSPGHLVKGKGQKAKMDCVPIKGHINVYWYRKKPEGAFEFLAYLKNQDIVEDTEVFQQRFLAPWPQNSPCSLEINSTKAADSALYFCASSQ
Bos taurus V1 trdv AAFC05022633.1 6293 KGVLCNQVTQSSPEQRVASGSEVTLLCTFQTTYSDPDLYWYRKRPDGVFQFVLYRDNTRSYDADFARGRFTVLHSMSQKTFHLVISSVRPEDTATYYCALRL
Bos taurus V2 trav AAFC05022638.1 1320 PSVAQTVTQPQPQESVQETGTVTLDCTYSTRDTDYLFWYKQPPSGEMVFIIRQNAYEQQNATNDRYSVNFQKEAKAFSLKISDSQLEDAAVYFCAYSG
Bos taurus V3 trav AAFC05022685.1 5662 LSDEDQVEQSPQTLRIQEGDSLSLNCSYSSFRRLQWYRQDPGKGPELLFLLYSVGDEKQKKRLKATLLKKGSSMHIEAPKHEDSATYHCAVQTQCSP
Bos taurus V4 trav AAFC05022685.1 18108 NVCDAKTTQPSSMDYPEGEDVTLPCNHSTISGTEYIHWYRQNPSQSPQYIIHGFRDTVNSSMASLTIASDRKSSTLVLPQVTLRDTAVYYCVLKE
Bos taurus V5 trdv AAFC05022685.1 34472 SGVAQKVTQDQPDISSEAGEAVTLNCRYETSWSSYNTFWYKLFASGEMTFLIGQGSYSLNARDGCYSINFQKSRKAISLTISDLQLEDSAKYFCTLWE
Bos taurus V6 trav AAFC05022685.1 40690 VSRLLTVEQHPLLLWVQEGESTNFTCTFPSSSFYALHWYRWKPAKGPKNLIVISVNGDEKKQGRVRVTLNTKEGYSSMYLRRSQPEDSATYLCA
Bos taurus V7 trdv AAFC05022685.1 51161 SGVAQKVTQDQSDVSSQVGQSVTLNCRYETSWSYYYLYWYKQLPSGQMTYVIRQGSEVTNARKDRYSVNFKKADKSISLTISALKLEDSAKYFCALSD
Bos taurus V8 trdv AAFC05022688.1 8689 SGVAQKVTQDRPEISSQVGESATMNCQYESNWNSYNIFWYKQLPSGEMIYLIGQNSYSSNARDGRYSISFQRSRKAISLIISALNLEDSAKYFCALWE
Bos taurus V9 trav AAFC05022688.1 20972 INGQQIKHFPEFLLLQEGENFTTYCNSSSILSSLQWYKQRPGGTPVLLMILAKGGEVKMQQRLTDRLGETRQHSSLYLAAAQPSDAGTYFCA
Bos taurus V10 trdv AAFC05022688.1 27088 CGVAQKVTQDQPDISSQVGQSVTLNCQYETSWRYYYLFWYKQLPSGQMTYLIQQYSEYSNARNGRYSVNFQKADKSISLIISSLQLEDSAKYFCTLSE
Bos taurus V11 trav AAFC05022688.1 33851 TVINAKTTQPGSMDCAEGEDVNLPCNHSTIGGNDYIHWYRQNPNQTPQYVIHGLRGTVNSSMASLTVASDRKSSTLVLPQVTLRDTAVYYCVLRE
Bos taurus V12 trdv AAFC05022689.1 3890 SGVAQNVIQDQPNTSGHLGQSVTLNCRYGTTWSYYYMFWYKLLPNGEMIYLISQASSGQNARNGRYSVNFQKARKSISLTITDLQLEDSAEYFCALWE
Bos taurus V13 trav AAFC05022689.1 16031 VRGVDVEQSPPALTPQEGDSSTLWCIFSTLADSVRWYLQKPGGRLIHLIYIPSGTRQEGRLNVTAVPKERRSSLHISSLRTTDSGTYFCAVQHCATR
Bos taurus V14 trav AAFC05022696.1 2101 GVRGVKVEQSPSVLSLQEGANSTLRCNFSDTVNSVQWFQQNTRGSLTRLFFIASGTKKNERMSSTVNSKERYSTLHITASQLEDSATYLCVVE
Bos taurus V15 trav AAFC05022815.1 4168 VSLGNKVEQSPTLSVQEGNSTFITCTYTDGNSDYFPWYKQEPGKGPQLLIAIHSNKAKEEDQRLTVLLNKTAKHLSLHIANTEAGDSAVYFCAAS
Bos taurus V16 trav AAFC05022823.1 10094 GTRAQTVTQPESHTYVSEGAPVQVKCNYSYSGSPVLFWYVQYPRQHLQLLLKHTSRESIQGFTAELSQTEASFHLKKPSAQEEDSAVYYCALG
Bos taurus V17 trav AAFC05022823.1 29208 GTSGDSVTQTEGVVTLPEKTALTLKCTYQSSYSGFLLWYVQYQNKELELLLKSSLNQKVTSRGFEATHISSDSSFHLQKSSVQTSDSAVYYCALS
Bos taurus V18 trav AAFC05022824.1 1389 GTSGDSVTQTEGVVTLPEKTSLTLKCTYQSSYSGFLLWYVQYQNKELELLLKSSLGNQKVTSRGFEATHISSDSSFHLQKSSVQTSDSAVYYCALS
Bos taurus V19 trav AAFC05022824.1 5511 GTNGDSVNQTEGPVTVSEGALLTLNCTYQTASLALYLFWYIQHLNKAPQFLLKGSMSDQNPKSKGFEATLVKRDSSFHLQKQAVQASDSAVYYCALSDAV
Bos taurus V20 trav AAFC05022825.1 2517 RTNGDSVNQTEGPVTVSEGALLTLNCTYQTASSVPYLFWYVQHLNKAPQLLLKGLTADKKEEHEGFQATLVKSDSSFHLQKQAVQASDSAVYYCALS
Bos taurus V21 trav AAFC05022827.1 1531 TVINAKTTQPSSMDCAEGEDVNLPCNHSTIGGNDYIHWYWQNPNQSPQYVIHGLRGTVNSSMASLHIASDRKSSTLVLPQVTLRDAAVYYCVLRE
Bos taurus V22 trav AAFC05022828.1 325 GTNGDSVNQTEGPVTVSEGALLTLNCTYQITYSDPYVFWYVQHLNKAPQLLLKGSMKDQKPKSEGFQATLVRTDSSFHLQKRAVQTSDSAVYYCALS
Bos taurus V23 trav AAFC05022828.1 27518 SIMAQKVTQNQSEISVLEQEYVTLNCAYEANSYTYYLFWYKQLPSGEIIFLIHQDSYNEMNTTKDQYFLNFQKATSSISLTISDSQLEDSAVYFCALR
Bos taurus V24 trdv AAFC05022828.1 43012 SGVAQKVTQDQSDVSSHVGQSVTLNCRYETSWTAYYLYWYKQLPSGQMTSVIRQGSEVTNARKDRYSVNFKKADKSISLTISALQLEDSAKYFCALSD
Bos taurus V25 trav AAFC05022828.1 52246 TVINAKTTQPSSMDCAEGENVNLPCNHSTIGGDDYIYWYQQNPNQSPQYVIHGLRGTVNSSTGSLHIASDRKSSTLVLPQVTLRDTAVYYCVLRE
Bos taurus V26 trav AAFC05022828.1 55256 VRGVDVEQSPPALSLQEGASYTLQCNFSTFPQSVNWYLQNPGGCIIHLFYIPSGTKKDGRLHATAVPKEGRGSLHISSSQTTDSGTYFCAVQHSAPQ
Bos taurus V27 trav AAFC05023195.1 10196 QTHGNSVTQMDGQVSRSEGTSVTINCTYSISGYPNLFWYVQYLGEGPELLLKAMKANDKGTNKGFEATYNTETTSFHLEKASVQESDSAVYYCALS
Bos taurus V28 trav AAFC05023195.1 14583 VSLGNKVEQSPTLSVQEGNSSVITCTYTDGNSEYFPWYKQESGKGLQFLIGIYSNKAKEEDQRLTVLLNKTAKHLSLHIATTEAGDSAVYFCAAS
Bos taurus V29 igkv AAFC05024149.1 177637 SSGDIVLTQTPLSLSVFPGETASISCRTSQSLEDSYGDTYLSWHLQKPSQSPQLLIYLVSNRASGVPDRFTGSGSGTDFTFKISRVEAEDAGVYYCQQSIQ
Bos taurus V30 igkv AAFC05024149.1 222404 SSGDVVLTQTPLSLSVIPGETVSISCKSTQSLKYSGKTYLRWLQHKPGQSPQSLIYQVSNRYTGVPDRFTGSGSETDFTLTISSVQAEDAGVYYCVQE
Bos taurus V31 igkv AAFC05024149.1 240703 SSGDVVLTQTPLSLSVIPGETVSISCKSTQSLKYSDGKTYLRWVQHKPGQSPQGVIYQVSNRNTGVPDRFTGSGSETDFTLTISSVQAEDAGVYYCFQGTYEP
Bos taurus V32 igkv AAFC05024149.1 274104 SSGDVVLTQTPLSLSVIPGETVTISCKSTQSLKYSDGKTYLQWFQHKPGQSPRLLIYQISNRYTGVPDRFTGSGSETDFTLTISSVQAEDAGVYYCLQRSYAP
Bos taurus V33 igkv AAFC05024149.1 280495 SIGATMQTQTLRSLSVIPGEMASISCRASQSVQNRYGDNFLHWYVQKPSQSPQLLIYRASNWESWVPDRFTSSGLGTHFILIISRVESEDAGVYYCQQSLQ
Bos taurus V34 igkv AAFC05024149.1 291296 SSGDVVLTQTPLSLSIIPGEMASISCKSSQSLVHSDGKTYLNWIQYKPGQSPQGLIYQVSNRYSGVSDRFTGSGSGTDFTLTISRVQAEDAGVYYCYQGTEDP
Bos taurus V35 igkv AAFC05024149.1 306716 ARCDIQVTQSPSYLSASLGDRVSITCQANQSVSHYLNWYQQKPGEAPKLLIYYATSRYTRVPSRFSGSGSGTDFTLTISSLEADDAANYYCQQDYS
Bos taurus V36 trbv AAFC05026640.1 3599 SMDNEVTQSPSHLVKGKGQKAKMDCVPIKGHINVYWYRRKLEEAFEFLVYFQEQDIVEGTEVFKERCSAECHQNSPCSLEINSTEAVDSALYFCASSQ
Bos taurus V37 trbv AAFC05026640.1 11835 TVAGGVTQTPKYLLKKEGGAVTLECEQDFDYDSMYWYRQDPGLGLRRIFSSRVVNTVQKEDIAKGYSASREKKPFFPLTVTSAQKNQTALYLCAASR
Bos taurus V38 trbv AAFC05026640.1 15344 GSGLGALVSQQPHRAVSKSGASVTIECRALDFQATAVFWYRQFPKRGLVLMATSNVGSDATYEQGYNKDKIPISHPDQTFSSLTVTRVDPADSSLYFCGAR
Bos taurus V39 iglv AAFC05028502.1 111474 SLSQPVLTQPVTVSASLGASARLSCTLSSGYNVSNYSIYWYQQKAGNPLRYLLRFKSDSDKHQGSGVPSRFSGSKDASTNAGLLLISGLQPEDEADYYCAVWHG
Bos taurus V40 iglv AAFC05028502.1 114484 SWAQAVLTQLPSVFRTLGQRVTISCTGSSNNIGGYYVSWYQQLPGKAPRLLTYEISKRPPGVPDRVSGSKSGNSASLTSSVHAEDDTDYYCFSWADGLKV
Bos taurus V41 iglv AAFC05028502.1 117912 SWAQAVLTQPPSVSGSLGQRVTISCTGSSSNIGGGNYVGWYQQIPGSAPKTLIYRSTSRPSGVPDRFSGSRSGNTATLTISSLQAEDEADYYCATYESSSYH
Bos taurus V42 iglv AAFC05028502.1 129502 SWAQAVLTQPSSVSGSLGQRVSITCSGSSSNIGSYNVGWYQQVPGSGLRTIIYGSSSRPSGVPDRFSGSKSGNTATLTISSLQAEDEADYFCVAYDSSSSI
Bos taurus V44 iglv AAFC05028512.1 3217 SWAQAVLTQPSSVSGSLGQRVSITCSGSSSNVGYGNYVSWFQQIPGSAPRMLIYGATSRASGVPDRFSGSRSGNTATLTISSLQAEDEADYFCASPDSSSSG
Bos taurus V45 iglv AAFC05028513.1 12470 SWAQDVLTQPSSVSGSLGQKVSITCSGSSSNVGYANYVSWHQQKPGSAPRTLIYGATSRASGVPDQFSGSKSGNTATLTISSLQPEDEADYYCSSYDSSSNI
Bos taurus V46 iglv AAFC05028513.1 30637 SWAQAVLTQPPSVSGSLGQTVTISCTGSSNNIGILGVSWYQQIPGSAPRTLIYNSNKRPSGVPDRFSGTKSGNTGTLTIASLQAEDEADYYCASADLSLTS
Bos taurus V47 iglv AAFC05028513.1 117327 SWAQSGLTQPSSVSGNLGQTVITSCAGTSSYVGSYNGVGWYQQLPGSAPKTLIYNVSKRPSGIPDRFSGSKSGNTATLTVSGLQAEDEADYYCSSYKSGGS
Bos taurus V48 iglv AAFC05028518.1 9543 SWAQSGLTQPSSVSGNLGQTVTISCAGTSSDVGAYNGVGWYQQLPGSAPKTLIYNLNKRSSGIPARFSGSKSGNTATLTISGLQAEDEADYYCSSYKSGGS
Bos taurus V49 iglv AAFC05028518.1 20374 HLASSQLTQPPAVSVSLGQTASITCQGDDLESYYAHWYQQKPSQAPVLVIYESSERPSGIPDRFSGSSSGNTATLTISGAQTEDEADYYCQSYDSSGD
Bos taurus V50 iglv AAFC05028518.1 26780 SVVSYELTQPTSVSVALGQTAKITCSGDLLDEQYTQWYQQKPGQGPVRVIYKDSERPSGISDRFSGSSSGKTATLTISGAQTEDEADYYCQSADSSDN
Bos taurus V51 iglv AAFC05028519.1 9917 SVVSYELTQLTSVSVALGQTAKITCSGELLDEQYTQWYQQKPGQAPKLVIYKDSKRRSGIPDQFSGSSSGKTAILTISGVRAEDEADYYCLSWDSGSYN
Bos taurus V52 iglv AAFC05028519.1 14623 HLASSQLTQPPAVSVSLGQTASITCQGDDLELLSAHWYQQKPGQAPVLVIYADDNLASGIPDRFSGSKSDTTATLTIRGAQAEDEADYYCQSADISG
Bos taurus V53 iglv AAFC05028519.1 18694 AVSSYELTQSPPASMSPGQTARITCGGPSVGGENVEWHQQKPGQARALVTYGDDNRPTGVPDQFSGANSGNMATLTISGARAKDEADYYCQLWDSSSNN
Bos taurus V54 iglv AAFC05028588.1 5166 SWAQAGLTQPASVFRTLGQRVTISCTGSSNNIGGYYVSWYQQLPGKAPRLLTYEISKRPPGVPDRFSGSKSGNSASLTSSVHAEDDTDYYCFSWADGLKV
Bos taurus V55 iglv AAFC05028588.1 8572 SWAQAVLTQPPSVSGSLGQRVTISCTGSSSNIGGGNCVGWYQQIPGSAPKTLIYRSTSRPSGVPDRFSGSRSGNTATLTISSLQAEDEADYYCATYESSSYH
Bos taurus V56 ighv AAFC05031345.1 11455 VLSQVQLRESGPSLVKPSQTLSLTCTVSGFSLSDNSVGWVRQAPGKALEWLGVIYSGGSTGYNPALKSRLSITKDNSKSQVSLSLSSVTTEDTATYYCAR
Bos taurus V57 ighv AAFC05031346.1 5189 VLSQVQLRESGPSLVKPSQTLSLTCTVSGFSLSSNGVGWVRQAPGKALEWVGGIDNDGDTYYNPALKSRLSITKDNSKSQVSLSVSSVTPEDTATYYCAK
Bos taurus V58 trgv AAFC05036571.1 4133 IQQEIRVFQRSVMVGHAGGAITLPCQISRSVDYVHWFRQLEGQAPERLLYLALSKRDVQWDSVLRGDKVNAARGADGKSYTMSLRKLAKSDEGLYYCATWGS
Bos taurus V59 trgv AAFC05036976.1 7164 GLGQLTLVQTEVSVTGTREKSIIMSCKVFSKDFSKDYIHWYRQKPDQGLEQLLFVLDAPALNDLGGKKNKLEARKDKPSSTSTLKISFLEKEDEATYYCAGWLL
Bos taurus V60 trgv AAFC05036976.1 13930 IKMKISQHQLSSTRRPDRTVHISCKLSGVPLENAIMHWYQEKEGEPLKRILYGSANSYKLDKPNSRLEIDNKKNGIFYLIINNVVKSDEATYYCACWD
Bos taurus V61 trgv AAFC05036977.1 11914 GLGLSKVEQAQISLSTEVKKSINIHCKIESTNFESEIVYWYRQKKNQALEHLVYVTSTTTAARNQVDGKNKIEARKDAQMFTSTLTVNFIEKEDVGIYYCAGWS
Bos taurus V62 trgv AAFC05036980.1 7450 MQVSSNMEEDKLSVMRATGSSVVMDCDLTGSYIHWYKFQDGAVPRRLLHYIVSNSKVVLDSGISEGKYHVYKGTGKSYTFVISNLQESDSGTYYCAVWE
Bos taurus V63 trgv AAFC05036980.1 17649 TQVSSNMEEDKLSVMRATGSSIVIDCDLTGSYIHWYKFQEGAVPRRLLYYDVSNSKAVLDSGISEGKYHAYKGTGKSYTFVISNLQESDSGTYYCAVWE
Bos taurus V64 trgv AAFC05036980.1 23386 TQVSSNMEEDKLSVMRATGSSVVIDCDLTGSYIHWYKFQEGAVPRRLLYYDVYYSKVELDSGISERKYRVYKGKILISNLQESDSGTYYCAVWE
Bos taurus V65 trgv AAFC05036980.1 37494 TQVSSNTEGEKMSITKATGSGSSVEIICDLITQTLKYIHWYKYQEGTAPRRLLYYDISYSKVVLESGVSEGKYKVYKEKSYTFAILNLQESDSGMYYCAAWE
Bos taurus V66 trbv AAFC05037156.1 607068 TWGTGVFQTPKYLLTQMGTKTSLECEQKLNHDSMYWYKQDSKKLLKAMFSYNNKLLVGNETVPSRFSPESPDKAHLNLHIDSLEPGDSAMYFCASS
Bos taurus V67 trbv AAFC05037156.1 611337 VCADPGITQIPKYLVMGMTDKKSLTCEQHLGHDAMYWYKQSAQKPPELMFIHNYQKLTGNESVPSRFWSECPDSSQCRLDLNALKPQDSAIYLCASSR
Bos taurus V68 trbv AAFC05037157.1 14315 LVDSGVTQTPKYLIKSRKQQATLRCSPNSGHSSVNWYQQALGQGPQFLVQCYRGQVSRGENMPDRFSAKQFSDLRSELNLSSLELTDSAVYLCASSQ
Bos taurus V69 trbv AAFC05037159.1 8205 LVDSEVTQTPKYLIKSRKQQATLRCSPNSGHSSVNWYQQALGQGPQFLVQCYRGQVSRGENMPDRFSAKQFSDFRSELNLSSLELTDSAVYLCASSQ
Bos taurus V70 trbv AAFC05037159.1 13056 AVHAGVTQDPRFQVIRSGQKPTLRCTQDLNHNYMYWYRQDLGRGLRLIHYSNGPPNTENGDVPESYSVSRPSTEDFPLTLESANPSQTSVYFCASSY
Bos taurus V71 trbv AAFC05037159.1 16831 LVDSGVTQTPKYLIKSRNQQATLRCSPHSGHFSVYWYQQALGQGLQFLVQYYNQKVRGESHLLDRFSGKQFSDSRSELNLSSLELTDSAMYLCASSE
Bos taurus V72 trbv AAFC05037159.1 22977 LVDSGVTQIPKYLIKSRKQQVILRCSPESGHRSVYWYQQVLGQGPQFLIQYFNTQENEKGNISDRFSGKQFSDSSSELNLTSLELTDSAVYLCASSQ
Bos taurus V73 trbv AAFC05037159.1 32233 AVHPGVTQDPRFQVVRRGQSGTLKCTQDLGHDRMYWYRQDLGHGLRLIHYSAGVHTSEPGDMPDGYSVSRSNTENFPLTLVCANHSQTSVYFCASSY
Bos taurus V74 trbv AAFC05037159.1 34443 LVDSEVTQTPKYLIKSRKQQVILRCSPKSGHTSVYWYQQALGQGLQFLIQYYNRAEYDKGNISDRFSGKQFSDSRSELNLTSLELKDSAVYLCASSQ
Bos taurus V75 trbv AAFC05037159.1 36260 AVHAGVSQDPRFQVVRRGLNTTLTCTQDLSFSYMYWYRQDPGHGLRLIHYSVIPPSTERGAVPEGYSVSRPSTENFPLTLESANRSQTSVYFCTCGY
Bos taurus V76 trbv AAFC05037159.1 40044 AVYAGVTQDPSFQVVRKGLNVTLTCTQDLGHDSMYWYRQDLGHGLRLIHYSDGPPTTVKGDVPEGYSVSRPSKKDFPLTLKSANHSQTSVYFCASSY
Bos taurus V77 trbv AAFC05037159.1 41446 AIHAGVTQDPRFQVVRTGQNATLTCTQDLGHDSVYWYRQDLGHGLRLIYYSAGPPTMVKGDVPDGYSVSRSSKNHFPLTLESANHSQTSVYFCASSY
Bos taurus V78 trbv AAFC05037159.1 44736 AVHAGVSQDPRFQVVRSGQKPTLRCTQDLNHDYMYWYRQDLGRGLRLIYYSNGPPYTENGDVPEGYSVSRPSTEDFPLTLESANPSQTSVYFCASSY
Bos taurus V79 trbv AAFC05037159.1 48510 GLVDSGVTQTPKYLIKSRKQQAILRCSPVSGHLSVYWYQQALGHGPQFLVQYYNQKVRGEAHLLDRFSGKQFSDSRSELNLSSLELTDSAVYLCASSE
Bos taurus V80 trbv AAFC05037159.1 52400 VVHAGVTQDPRFQVVRRGQSMTLTCTQDLGHNYMYWYRQDLGHGLRLIYYSAGPPTTEKGDVLNGYRVSRSSKENFPLTLESANHSQISVYFCASSYFMVLH
Bos taurus V81 trbv AAFC05037159.1 54679 LVDSGVNQTPKYLIKSRKQQVTLRCSPESGHRYVSWYQQTLVQGPQFLIQYFNRQQNEKGNISDRFSGKQFSDSSSELNLTSLELTNSAVYLCASSQ
Bos taurus V82 trbv AAFC05037159.1 58844 LVDSEVTQIPKFLTKSRKQQVTLRCSPESGHRSVYWFQQALGQGPQFLVQYFDGEVYQRGSMSDRFSVQQLGDSRSELNLTPLELTDSAVYLCASSP
Bos taurus V83 trbv AAFC05037159.1 62695 LVDSGVTQTPKYLIKSREQQVILRCSPESGHRSVYWYQQALGQGPQFLVQYYNGKENEKGNMPDRFSGKQFSDFHSELNLSSLELTDSAAYLCASSQ
Bos taurus V84 trbv AAFC05037159.1 67131 LVDSEVTQTPMYLIKSRKQQGILRCSPESGHRPVYWYQQVLGQGLQFLIQYYNRAEYEKGNISDRVSGKQFSDSSSELNLTSLELTDSAVYLCASSQ
Bos taurus V85 trbv AAFC05037159.1 68944 AVHAGVSQDPRFQVVRRGLNTTLTCTQDLSFSYMYWYRQDSGHRLRLIHYSVIPPSTERGAMPEGYRVSRPSTENFPLTLESANHSQTSVYFCTCGY
Bos taurus V86 trbv AAFC05037159.1 71318 AVHAGVTPDPRFQVVRTGQSATLRCTQDLNHDYMYWYRQDPGHGLRLIHYSDGTPTTEKGDVPEGYRVSRPSTNDFLLTLKSANHSQTSVYFCASSYSMV
Bos taurus V87 trbv AAFC05037159.1 73733 LVDSGVTQTPRYLIKARGQRGTLGCSPVSGHLSVYWYQQALGQGPEFLVQYYSQEVRGEAQLPDRFSGKQFSDFHSELNLSSVELTDSAVYLCASSQ
Bos taurus V88 trbv AAFC05037159.1 78624 LVDSGVTQTPKYLIKSRKQQVTLRCSPESGHLSVSWYQQALGQSPEFLVQYYDGEMYQKGNISDRVSGKQFSDAASELSLTPLDLTDSAVYLCASSQ
Bos taurus V89 trbv AAFC05037159.1 84673 VCADPGITQIPKYLVMGMTDKKSLTCEQHLGHNAMYWYKQSAQKPPELMFIHNYQELAGNENVPSRFWPECPDSSQCRLDLNALKPQDSAVYLCASSR
Bos taurus V90 trbv AAFC05037160.1 922 AVHAGVSKDPIFHVVRRGQSATLTCTQDLNFSYMYWYRQDPGNGLRLIHYSVIPPSMEKGPVPEGYRFSRPSTENFPLTLESANCSLTSVYFCTCGY
Bos taurus V91 trbv AAFC05037160.1 4556 AVHAGVTQDPRFQVLRTGQKATLTCTQDLGHNCMYWYRQDLGQGLRLIHYSVAAPNTVKGDIPEGYSVSRPSTKAFPLTLESANHSQTSVYFCASSY
Bos taurus V92 trbv AAFC05037160.1 6783 LVDSGVTQTPRHLIKARGQRGTLGCSPVFGHLSVYWYQQALGQGPEFLVEYYRQEVRGEAQLLDGFSGKQFSDFHSELNLSLLELTDSAAYLCASSQ
Bos taurus V93 trbv AAFC05037160.1 16026 AVHAGVTQDPRFQVVRTGQNATLKCTQDLNHDYMYWYRQDLGHGLRLIHYSAGVRSSEPGDVPDGYSVSRSSKENFALTLESANQSQTSVYFCTSSY
Bos taurus V94 trbv AAFC05037160.1 22819 AVHAGVTQDPRFQVVRTGQKATLTCTQDLGHDCMYWYRQDLGHRLRLIHYSFAAPNTVKGDIPEGYSVSRPSTEDFPLTLESANHSQTSVYFCASSY
Bos taurus V95 trbv AAFC05037160.1 25051 LVDSGVTQTPRYLIKARGQRGTLGCSPVSGHLSVYWYQQALGQGPEFLVEYYRQKVRGEVQLPNRISGKYFSDSHSELNLSSLELTDSAVYLCASSQ
Bos taurus V96 trbv AAFC05037160.1 26875 AVHAGVTQDPRFQVMRTGQNVTLRCSQDLGHNFMSWYRQDLGHGLRLIHYSDGAHTSELGDVPNGYSVSKSNKENFPLTLESANRSQTSVYFCASRY
Bos taurus V97 trbv AAFC05037160.1 29165 LVDSEVTQTPKYLIKSRKQQVTLRCSPESGHRYVSWYQQALGQGPQFLILYYDGKVRTKGNMPDRFSGEQFGDSRSQMNLSSLELTDSAVYLCAGRQ
Bos taurus V98 trbv AAFC05037160.1 31613 AVHAGVSQDPRFQVVKTGQNVTLRCTQDLYHDSMYWYRQDLGLRLRLIRYSSFTDTTYKGDMPDGYSVSRSSTENFPLTLESANRSQTSVYFCASST
Bos taurus V99 trbv AAFC05037160.1 34530 HTGAGAVSQSPRHRVAGRGQTVNLRCDPISGHVSLYWYRQTLGQGPEFLTYFQDEQQLDKSGMPKNRFYAERPEKTYSYLKIQPAEPGDSAVYLCASSP
Bos taurus V100 trbv AAFC05037160.1 51106 PLEAEVTQTPRHLIKTTGQTATLRCSPMSGHSSVSWYQQAQSQGPQLIFEFYETLQRAKGNFSNRFLAKQFPDFSSELNVNSLDQTDSALYLCASSL
Bos taurus V101 trbv AAFC05037160.1 56277 HTRAGVVSQSPGYRVAGRGQTVNFRCDPIPGHQVLYWYRQMLGQGLEYLTYFQGKEEPDKSGMPKNRFSAERPESTYSYLKIQPVEPEDSALYLCASSP
Bos taurus V102 trbv AAFC05037161.1 33777 TTDANLGVTQTPRHEVTEKGQAVTLSCELIKSHTALYWYRQTSVRGLEFLAYFSNQAPIDESGMPKDRFSAKMPNSSFSTLKIQPTDPGDSATYLCASSK
Bos taurus V103 trbv AAFC05037161.1 48610 PTDAGVTQTPRHEVTEKGQAVTLSCEPIKSHAALFWYRQTSVRGLELLIYFNNQAPIDESGMPKDRFSAKMHNASFSTLKIQPTDPGDSATYLCASSK
Bos taurus V104 trbv AAFC05037161.1 51098 YISAEVAQSPSHRVIEKKQAVNLSCDPISGHESLFWYYHAVGKEMKLLIYFLRESMQDDSGMPKGRFTAERMEGTSSMLRVHSAELGDSGVYFCASSR
Bos taurus V105 trbv AAFC05037161.1 53436 HVGAMVVQNPRYLVTGLGKPVTLSCSQNMKHDAMYWYQQKPSQAPKLLLYYYDKQITKEKNTSENFQSSRPNTSFCSLDIRSAGLGDSAVYLCASSR
Bos taurus V106 trbv AAFC05037161.1 58163 FLEAEVTQTPGHLVQGKGLEVKMYCVPKKGHIYVFWYQQILTKEFKFLISFQNDKVLDDKEMPKRFSAECPSNSPCSLKIQSTEPQDSALYFCASSD
Bos taurus V107 trbv AAFC05037161.1 71276 TVAGGVTQTPKYLLKKEGGAVTLECEQDFDYDSMYWYRQDPGLGLRQIFFSRVVNNVQKEDIAKGYSASREKKPFFPLTVTSAQKNQTALYLCAASR
Bos taurus V108 trbv AAFC05037161.1 74772 GSGLGALVSQQPRRAVSKSGASVTIECRALDFQASSMFWYRQFPKRGLVLMATSNEGTDATYEQGYNKDKFPISQPDRTFSSLMVTSVDPTDSGLYFCSAR
Bos taurus V109 trbv AAFC05037162.1 4563 SMDPEVIQSPGHLLTGKGQKAKMNCVPIRGHINVYWYRKKPEGAFEFLAYLKNQDIVEDTEVFQQLFLAPWPQNSPCSLEFNSTKAADSALYFCASSQ
Bos taurus V110 trbv AAFC05037162.1 11502 TVAGGVTQTPKYLLKKEGGAVTLECEQDFDYDSMYWYQQDPGLGLRQIFFSRVVNNVQKEDIAKGYSASREKKPFFPLTVTSAQKNQTALYLCAASR
Bos taurus V111 trbv AAFC05037162.1 15004 GSGLGALVSQQPRRAVSKSGASVTIECRALDFQATTVFWYRQFLKRGLVLMATSNEGTDATYEQGYTKDKFPISHPDLTFSSLTVTRVDPADSSLYFCGAR
Bos taurus V112 trbv AAFC05037163.1 4757 SMDTEVTQSPGHLVKGKDQKAKMDCVPIKGHVHVYWYHKKPEGAFEFLVYLWNGKVTEDTAMFKQRFSAECPQNSPCSLEINSTEAADSALYFCASSQ
Bos taurus V113 trbv AAFC05037163.1 13540 FMDTEVTQNPSHLLKGKDQRAKMDCVPKKGHSYVYWYRRKLEEALEFLVYLQDEKIIEDTAMFKQRFSVECPQNSPCGLEINSTEAADSALYFCASSQ
Bos taurus V114 trbv AAFC05037163.1 16865 SMDTEVTQSPSHLVKGKGQKAKMDCVPIKGHINVYWYRRKLEEAFEFLVYFQEQDIVEGTEVFKERCSAECPQNSPCSLEINSTEAADSALYFCASSQ
Bos taurus V115 trbv AAFC05037166.1 581 SMDSEVTQSPGHLVKGKDQKAKMDCVPIKGHTSVYWYLKKLESFEFLVYLRNGKITEDTAMFKQRFSAECPQNSPCSLEINSTEAADSALYFCASSQ
Bos taurus V116 trbv AAFC05037169.1 17195 TVAGGVTQTPKYLLKKEGGAVTLECEQDFDYDSMYWYRQDPGLGLRLIFFSRVVNNVQKEDIAKGYSASREKKPFFPLTMTSAQKNQTALYLCAASR
Bos taurus V117 trbv AAFC05037169.1 20696 GSGLGALVSQQPRRAFSKSGASVTIECRALDFQASSMFWYRQFPKRGLVLMATSNVGTNATYEQGYTKDKFPISHPDLTFSSLTVTRVDPADSSLYFCGAR
Bos taurus V118 trbv AAFC05037169.1 27761 SMDTDVTQSPSHLVKGKSRKAKMDCVPIRGHSYVYWFRKKLEETLEFLVYFQKQDIVEDTAMFKQRFSAECRQNSPCSLEINSTEAADSALYFCASSQ
Bos taurus V119 trbv AAFC05037169.1 34472 LTGSVDTEVIQSPGHLVKGKGQKAKMDCVPIKGHINVYWYRKKPEGAFEFLAYLKNQDIVEDTEVFQQRFLAPWPQNSPCSLEINSTKAADSALYFCASSQ
Bos taurus V120 trbv AAFC05037169.1 39675 SMDTEVTQSPSHLVKGKGQKAKMDCVPIKGHINVYWYRRKLEEAFEFLVYFQKQDIVKGTEVFKERFSAECPQNSPCSLEINSTEAADSALYFCASSQ
Bos taurus V121 trbv AAFC05037169.1 50102 GSGLGALVSQQPRRAVSKSGASVTIECRALDFQASTVFWYRQFPKRGLVLMATSNAGSDATYEQGYNKDKIPISHPDRTFSSLMVPRVDPADSSLYFCGAR
Bos taurus V122 trbv AAFC05037171.1 5719 SVDTEVTQSPSHLVNGKDQKAKMDCVPIKGHSYVYWYHKKLEEALEFLVYFQKQDIVEDTAMFKQRFSAECPQNSPCSLEINSTEAADSALYFCASSQ
Bos taurus V123 trbv AAFC05037172.1 3920 SVDTEVIQSPGHLVKGKGQKAKMDCVPIKGHINVYWYRKKPEGAFEFLAYLKNRDIVEDTEVFQQLFLAPWPQNSPCSLEINSTEAADSALYFCASSQ
Bos taurus V124 trbv AAFC05037172.1 8707 SMDTEVIQSPGHLVKGRGQKAKMDCVPIKGHINVYWYRRKLEEALEFLVYFQKQDIVEGTEVFKERFSAECRQNSPCSLEINSTKAADAALYFCASSQ
Bos taurus V125 trbv AAFC05037172.1 17748 SMDTEVTQSPSHLIKGKDQRAKMDCVPKEGHAYVYWYRKKLEEAFEFLVYFQNQDMMENTALFKQRFSAECPQNSPCSLEINSTEAADAALYFCASSQ
Bos taurus V126 trbv AAFC05037172.1 22531 PMDAEIYQIRFLLAEAGQDVTLECKQHLGYSAMYWYRQDPGQGLKLIYYSTVVKDIQRGDLSEGYSVSREKQELFPLTVKSAHTNQTAVYLCSG
Bos taurus V127 trbv AAFC05037172.1 31789 SMDTGVTQTPRNRIANTGKSTVLECSQTKGHESMYWYRQDPGRGLRLIYFSYGIDDINKGDVSDGYNVSRKEEAKFSLYLEPATPNQTAIYFCASNI
Bos taurus V128 trbv AAFC05037172.1 37555 FSDADIYQTPRYCVIGMGKKITLECSQTMGLDNMYWYQQDPGMELQLIHYSYGVNTTEKGERSSRSTVSRLSKEHFPLTLETANSSQTSSYFCASGD
Bos taurus V129 trbv AAFC05037172.1 39264 LKDAAVTQFPRRRILETEKEFTLQCSQKMNHYAMYWYRQDPGFGLRLIYYSTGPDSFKKGDVPEGYHVSRDELEHFPLTLKSASPNQTSVYFCASAE
Bos taurus V130 trbv AAFC05037173.1 4261 PLEADVTQSPRHRITETRTRVTLTCSQNMNHDAMYWYRQDPGLGPKLIYFSRNVGFIENGDIPDGYTASREEKPNFPLTLELASTNQTSLYLCASSE
Bos taurus V131 trbv AAFC05037174.1 5047 LVDAQVTQTPRYLVKRRGEKVVIECIQNMDHERMFWYRQDPALGLRLLHFSIDAGTVEEGDVPHGYSVSRKKKESFPLTLASATTNQTSMYLCASSE
Bos taurus V132 trbv AAFC05037174.1 13756 SVFGALVSQKPSRAIRQRGTSMMIECQVDSQVNFMYWYRQLPGQSLVLMATANQGSKATYESGFTDSKFPIDRPKLEFSTLTVSNASSEDSSSYFCSAG
Bos taurus V133 trbv AAFC05037174.1 16242 SVFGALVSQKPSRAIRQRGTSVMIECRQVDSQLAMMYWYRQLPGQNLVLMATANQGSKATYESGFTDSKFPIDRPKVEFSTLTVNNASSEDSSSYFCSAG
Bos taurus V134 trbv AAFC05037174.1 18716 SVFGALVSQKPSRAIRQRGTSVMIECRQVDSQLTAMYWYRQLPGQSLVLMATANQGSKATYESGFTDNKFPISRPVLAFSTLTVSNASSEDSSSYFCSAG
Bos taurus V135 trbv AAFC05037174.1 21189 SVFGALLSQEPSRAIRQRGTSMTIECQVDSQLTWMYWYRQLPGQSLVLMATANQGSKATYESGFTEDKFPIDRPKLEFSTLTVSNASSEDSSSYFCSAG
Bos taurus V136 trbv AAFC05037175.1 3245 SMDTEVTQIPSHLLKGKDQRAKMDCVPKKGHSYVYWYRRKLEEALEFLVYLQDEKIIEDTAMFKQRFSVECPQNSPCSLEINSTEAADSALYFCASSQ
Bos taurus V137 trbv AAFC05037178.1 116 LVDSGVTQTPRYLIKARGQRGTLGCSPVSRHLSVSWYQQALGQSPEFLIQYYRQEVRGEAQLPDRFSGKQFSDFHSELNLSSLVLRDSAVYLCASSQ
Bos taurus V138 trbv AAFC05038216.1 1853 SMDTEVTQSPSHLVKGKGQKAKMDCVPIKRHSYVHWYHKKLEEALEFLVYFQKQDIVEDTAMFKQRFSAECRQNSPCSLEINSTEAADSALYFCASSQ
Bos taurus V139 ighv AAFC05041845.1 1713 VLSQVQLRESGPSLVKPSQTLSLTCTISGFSLSSYAVGWVRQAPGKALEWVGGISSGGSTCLNPALKSRLSITKDNSKSQVSLSVSSVTTEDTATYYCAK
Bos taurus V141 trbv AAFC05008392.1 983 AVHAGVTQDPRFQVVRRGQSTTLTCAQDLGHNYMYWYRQDLGHGLRLIHYSAGVRSSEPGDVLDRYSVSRSNTENFPLTLKSANRSQTSVYFCASSY
Bos taurus V142 ighv AAFC05011736.1 7492 VLSKVQLQESGPSLVKPSQTLSLTCTTSGFSLTSYGVSWVRQAPGKALEWLGGIDSGGSTGYNPGLKSRLSITRDNSKSQVSLSVSSVTPEDTATYYCAK
Bos taurus V143 ighv AAFC05011737.1 4760 VLSQVQLRESGPSLVKPSQTLSLTCTVSGFSLSSNGVVWVRQAPGKALEWLGGICSGGSTSFNPALKSRLSITKDNSKSQVSLSVSSVTPEDTATYYCAR
Bos taurus V144 trbv AAFC05013476.1 1316 LVDSGVTQTPRYLIKARGQRGTLGCSPVSGHLSVSWYQQALGQSPEFLIQYYRQEVRGEAQLPDRFSGKQFSDFHSELNLSSLELTDSAVYLCASSQ
Bos taurus V145 trdv AAFC05013780.1 1486 SGMAQNVIQDQPNTSGQLGQSVTLNCRYGTAWSYYYMFWYKLLPNGEMIYLISQVFSGQNARNGRYSVNLQKASKSISLTISDLQLEDSAEYFCALWE
Bos taurus V146 trdv AAFC05022633.1 163710 VSLDVILESETKTLTVLLGEPATFRCNVTGGNWKNYQMSWYKRNENNVLTLVYRLSNNSNENVRGGFKGKIDTSKNQYVLNIQKTTIKDVGTYYCGS
Bos taurus V147 trdv AAFC05022633.1 137023 VMSAVVLVPQDQEKTVVVGKSATLSCSMKGATFISKYYIFWYRKTPGNTMTFIYQEWGLYGPGFKDNFRGKIVNLTNQAVLEVLKASERDEGFYYCATD
Bos taurus V148 trdv AAFC05022634.1 17754 SNNVESADVPTVFKKEGESVTVECKFSVSYTYYMMYWYRQPSSGEMIYMINIYSQNKHSREGRYSVEFYKPNQMLKLTISALTLSDSAIYFCAVRE
Bos taurus V149 trav AAFC05022635.1 42700 VSGKNGVEQSPRYLSAQEGDLVTINCNYLEGMTTLHWLQQNPGGGIISLLILSLEMKRKGRVSATINSRERYSSLNITASQPTDSAIYFCAVE
Bos taurus V150 trdv AAFC05022635.1 10854 SNNVESADVPTVFKKEGESVTVECKFSVSYTYYMMYWYRQPSSGEMIYMINIHSQNKHSREGRYSVEFYKPNQMLKLTISALTLSDSAIYFCAVRE
Bos taurus V151 trdv AAFC05022640.1 117093 FIMAQKVTQNQSEISVLEQEYVALNCAYEANSYTYYLFWYKQPPSGEIIFLIHQDSYNELNTTKDQYFLNFQKATSSISLTISDSQLEDSTVYFCVLR
Bos taurus V152 trav AAFC05022640.1 107959 MNGQQIKHFPEFLLLQEGENFTTYCNSSSILSSLQWYKQSPGGSPVVLMILAKGGEVKTEQRLTGQFGETKQHSSLHLTAAQLSDAGTYFCA
Bos taurus V153 trdv AAFC05022640.1 101629 SGVAQKVTQDQSDVSSQVGQSVTLNCRYETSLSTYRLYWYKQLPSGQMTYVIRQGSEATNARKDRYSVNFKKADKSISLTISALQLEDSAKYFCALHD
Bos taurus V154 trav AAFC05022640.1 87501 TVIDAKTTQPSSMDCAEGEDANLPCNHSIIGGKDYIHWYRQNPNQSPQYVIHGLRGTVNRSMASLTIASDRKSSTLVLPQVTLRDAAVYYCILRE
Bos taurus V155 trdv AAFC05022640.1 61416 SSVAQRVTQDQPEIASQVGEVVTLSCQYETIQSRYNIYWYKQLPSGEIIYLIGQGSSSQNARYGRYSVNFQRSHKSISLTISEVQLEDSAKYFCALWE
Bos taurus V156 trav AAFC05022640.1 55369 VSSLLTVEQRPPLLWVQEGESTNFTCSFPSSSFYALHWYRWEPAKSLKNLFVISVNGDEKKQGRVRVTLNTKEGYSSMYIRGSQPEDSATYLCA
Bos taurus V157 trav AAFC05022640.1 36832 IMVDAEITQLSSMDCAEGEDVNLPCNHSTIDPLDYIHWYQQNPNQSPQYVIHGLRDTVNSSMASLNIASDRTSSTLVLPQVTLRDTTLYYCILKG
Bos taurus V158 trav AAFC05022640.1 12656 KSTQQLEQNPQFLHIQEGGNVTMHCNSSGTFTFFQWYREKPEQGPVLLMTLTKPKEVKEKKRIRAQFGEAKKDSSLLITAAQPGDAGTYLCAG
Bos taurus V159 trav AAFC05022640.1 2763 LRVQMKVEQSPGVLTLQEGRNSSLICNYSTSIRGVQWFQQNPDGRLISLFYIASGMQQKGRLKSTINSKERYSQLYIRDSQPGDSATYFCAVE
Bos taurus V160 trdv AAFC05022641.1 12663 SSVAQQVTQVQTAISSQVGQTVTLNCRYEVSWTTDYYYIFWYKQLPRGEMTLLIRQYSEVGNARNGRYSVNFQKADKSISLIISALQLEDSAKYFCALWE
Bos taurus V161 trdv AAFC05022642.1 22388 SGVAQKVIQDQPDTSSQLGQSVTLNCRYATAWSYMFWYKLLPNGEMIYLIGQVFSGQNARNGRYSVNLQKASKSISLTISDLQLEDSADYFCALWE
Bos taurus V162 trav AAFC05022642.1 10422 VRGVDVEQSPPALTPQEGASSTLWCNFSTSSDSVRWYLQKPGGSHLIYTPLGTRQGGRLNATTVLKERRSSLHVSSLRTTDSGTYFCAVQHCTPQ
Bos taurus V163 trdv AAFC05022643.1 48153 SGVAQKVTQDQPAISTQVGQSVTLNCRYETSWSYYNLFWYKQLPSGQMTYLIQQYSEHGNARNGRYSVNFQKADKSISLIISSLQLEDSAKYFCALC
Bos taurus V164 trav AAFC05022643.1 40948 TVIDAKTTQPSSMDCAEGEDVNLPCNHSTICGNVYIHWYRQNPNQSPLYVIHGLRGTVNSSMASLTIASDRKSSTLVLPQVTLRDAAVYYCVLRE
Bos taurus V165 trdv AAFC05022643.1 31282 SGVAQTVIQDQPDTSSQLGQSVTLNCRYATTGSYYYSYYYYWYKLLPSGEMIYLIGQVSSGQNARNGRYSVNFQKARKSISLTISDLQLEDSAKYFCALWE
Bos taurus V166 trav AAFC05022643.1 19631 VRGVDVEQSPPALTPQEGASSTLWCNFSTSADSVWWYLQKPWGRHLIYIPSGTRQGGRLNATTVLKERRSSLHISFLRTTDSGTYFCAVQHCAPR
Bos taurus V167 trdv AAFC05022643.1 8174 SSVAQQVTQVQTAVSSQVGQTVTLNCRYEVSWTTGYYNIFWYKQLPRGEMTFLIRQYSEVGNARNGRYSVNFQKADKSISLIISSLQLEDSAKYFCALWE
Bos taurus V169 trav AAFC05022644.1 4138 RTNGDSVNQTEGPVTVSEGALLTLNCTYQTASLVPYLFWYVQHLNKAPKLLLKGLTADKKVEHEGFQATLVKSDSSFHLQKQAVQASDSAVYYCALS
Bos taurus V170 trdv AAFC05022645.1 21775 SGMAQTVIQDQPDISSQLGQSVTLNCRYATTWSSYHYMFWYKLLPNGEMIYLIGHSGQNERHGRYSVNFQKARKSISLTISDLQLEDSAKYFCALWE
Bos taurus V171 trav AAFC05022645.1 10115 VTAVDVEQSPPALTPQEGDSSTLWCTFSTLADSVRWYLQKPRGHLIHLIYVPSGTRQEGRLNATTVLKERRSSLHISSLRTTDSGTYFCAVQHCAPQ
Bos taurus V172 trav AAFC05022649.1 130058 PSVAQTVTQPQPQESVQETGTVTLDCTYSTRDTGDYYLFWYKQPPSGEMVYIIHQYAFEQQNATNDHYSVNFQKEAKSFSLRISDSQLEDAAVYFCAYSG
Bos taurus V173 trav AAFC05022649.1 127177 PSVAQTVTQPQPQESVQETGTVTLDCTYSTSESGYYLFWYKQPPSGEMVFIIRQYAYEQQNATNDRYSVNFQKEAKSFSLRISDSQLEDAALYFCAYSG
Bos taurus V174 trav AAFC05022649.1 119106 PSVAQTVTQPQPQESVQETGTVTLDCTYSTSESGYYLFWYKQPPSGEMVFIIRQNAYEQQNATNDRYSVNFQKEAKSFSLKISDSQLEDAAMYFCAYSG
Bos taurus V175 trav AAFC05022649.1 106538 LNTELKVEQSPLSLITREGQTGINCDHSVTTSDTFLWYRQDQKSLESLFLLMSNRAVRKKGGLTASFDTKACRSPLHITASHPGLSATYFCAVD
Bos taurus V176 trdv AAFC05022649.1 91250 SGVAQKVTQDQPVIISQVGKVATLNCQYETSRNVHVYCIFWYKQLPSGEMTYLIRQYSEDGNERDGRYSVNFQKASKSISLTISFLKPEHSAKYFCALWE
Bos taurus V177 trav AAFC05022649.1 75676 VQGLDVEQSPPALSLQEGASHVLRCNFSASVNNVQWYLQNPSGHLIHLFNIPSGTKQNGRLNATTIPKERRSSLHISSSQTTDSGTYFCAVQHSAPQ
Bos taurus V178 trav AAFC05022649.1 52634 NVFDAKTTQPSSMDYPEGEDVTLPCNHSTISGNEYIHWYRQSPSQSPEYVIHGIRGTVNSSTASLTISSDRKSSTLVLPQVTLRDTAVYYCVLRE
Bos taurus V179 trdv AAFC05022649.1 31941 SGVSQKVTQGQSNVSSQVGKSVTLNCRYETSWGTYYLYWYKQLPSGQMTYVIRQGSLVTNAKKDRYSVNFKKADKSISLTISALQLEDSAKYFCALRD
Bos taurus V180 trdv AAFC05022649.1 11782 SGVAQKVTQDQSDVSSQVGQSVTLNCRYETNWNAYYLFWYKQLPSGQMTYVIRQGSLVTNAKKDRYSVNFKKADKSISLTISALQLQDSAKYFCALCE
Bos taurus V181 trav AAFC05022650.1 42968 VKSDDHVMQSPPSLIVHEGSNATLSCSYKVTNFQSLHWYKQEEKVPTFLFALISTGIEKKSGRLVGTLDRKELLSTLHITVTELGDSATYLCAVE
Bos taurus V182 trav AAFC05022650.1 36002 LRRADWIRSQESEVSGEEGKTVSLFCNYYTSSKSFISLLWYRQYPNQAPEYILYRQWGSSGKGYASFATERFYSDNTANTTNLYIKKVVPADTALYLCALE
Bos taurus V183 trav AAFC05022650.1 3495 PSVAQMVSQPQPEESVQEADTVTLDCTYSTRDTDYYLFWYKQPPSGQMVYIIHQYAFEQQNANNDRYSVNFQKEAKAFSLKISDSQLEDAAVYFCAYSG
Bos taurus V184 trav AAFC05022661.1 14641 LRVQMKVEQSPGVLTLQEGRNSSLICNYSISMTSVQWFQQNPDGRLISLFYIASGMQQKGRLKSTINSKERYSQLYIRDSQPGDSATYFCAVE
Bos taurus V185 trdv AAFC05022661.1 5124 SSMADKVTEAQTTVTARERETVTIGCTYETSRTYYTLFWYRQFPGGRMEFLIHQDSNNANARRDRYSVNFQKGKKIISLTISSLYLADSAKYFCVLWE
Bos taurus V186 trav AAFC05022664.1 47686 TVTDAKTTQPSSMDYPEGQDVTLPCNHSTIGRNEYIYWYQQNPNQSPQYVIHGLRGTVNSSTASLTIASDRKSSTLVLPQVTLRDTAVYYCVLRE
Bos taurus V187 trav AAFC05022664.1 32231 VSSLLTVEQRPPLLWVQEGDSTNFTCSFPSSSFYALHWYRWEPAKTPKNLFVISVNGDEKKQGRMRVTLNTKEGYSSMYIRGSQPEDSATYLCA
Bos taurus V188 trav AAFC05022664.1 25575 MNGQQIKHFPEFLLLQEGENFITYCNSSSTFYNLQWYKQRPGGSPVFLMILAKSGEVKTEQRLTGRFGETKQHSSLHLTAAQLLDAGTYFCM
Bos taurus V189 trav AAFC05022664.1 14589 TVINAKTTQPGSMDCAEGEDVTLPCNHSTIGGNEYIHWYRQNPNQSPQYVIHGLRGTVNSSMASLTIASDRKSSTLVLPQVTLRDTAVYYCILRE
Bos taurus V190 trav AAFC05022664.1 5721 GTGAQLVTQPDGHINVSEGNHVELRCNYSYGGSIYLFWYVQYPNQGLQFLLKYLSGPTRVKGIKGFEAEFKKDENSFHLMKASAHWSDSAKYFCALC
Bos taurus V191 trav AAFC05022666.1 225156 QSRGDSVSQTDGQVTLLEGATLTVNCTYSATGYPTLLWYVQYPGEGPELLLKATKANDKETNKGFEAAYNTKTTSFHLEKAPVQESDSGVYYCALS
Bos taurus V193 trav AAFC05022666.1 210812 SIIAQKVTQDQPQVLGQEKEAVTLDCKYDTSDSRYSLFWYKQPSSGGMILLIRQDSSNQQNATEGRYSLNFQKARKSITLVISASQLEHSAVYFCALRE
Bos taurus V194 trav AAFC05022666.1 197499 VSGKNQVEQNPPSLVVLEGENCTFQCNYTVSPFKLRWYTQDTGRGLVSLITMTYSDNKKSNGQYTATVDATAKHSSLHLTAAQLSDPAFYLCVVG
Bos taurus V195 trav AAFC05022666.1 182922 VSSQQNTVEQSPVSLPVPEGATTSLSCTYSNSASQYFTWYRQYPGKGPEFLLQVYANNNKEEGKFAAQSNKTNKHVSLRIRDSEPSDSATYLCAV
Bos taurus V196 trav AAFC05022666.1 159988 GTNGDSVNQTEGPVTVSEGALLTLNCTYQTASSAPYLFWYIQHLNKAPQLLLKGSMSEQNPKSKGFEATLVKRDSSFHLQKQAVQASDSAVYHCALR
Bos taurus V197 trav AAFC05022666.1 148127 GTNGDSVNQTEGPVTVSEGALMTLNCTYQTADFAAYLFWYIQHLNKAPQLLLKGLTADKKVEHEGFEATLVKRDSSFHLQKKAVQASDSAVYYCALS
Bos taurus V198 trav AAFC05022666.1 129316 LSGEDQVEQSPQSLRTQEGDSLSLNCSYTASSFRGLRWYRQDPGKGPELLFLLHSVGDEKQKERLRATLLKKGSSLHIEAPKPEDSATYLCAVQ
Bos taurus V199 trav AAFC05022666.1 120999 VSSKQNVSQSPEALNVREGDSVVLNCSYTDSALFFLQWFRQDPGKGLTSLLSIQANQKEQASGRITVSLDKSSRHSTLYIATSQHSDSTTYLCAV
Bos taurus V200 trav AAFC05022666.1 114826 MNGQQIKHFPEFLLLQEGENFTTYCNSSSTFYSLQWYKQRPGGSPVLLMILAKRGEVKTQWRWTGQLGESKQHSFLRLTAAQLSDAGTYFCA
Bos taurus V201 trdv AAFC05022666.1 108511 SGVAQKVTQDQPDVSSQVGQSVTLNCLYETSWTTYDLYWYKQLPSGQMTYVIYQGSSATNAKEDRYSVNFKKADKSISLTISALQLEDSAKYFCALCE
Bos taurus V202 trav AAFC05022666.1 90984 MNGQQIKHFPEFLILQEGENFTTYCNSSSILRSFQWYKQSPGGSPVLLMILVKGGEVKTQRRWTGRLGESKQHSSLHLAAAQLSDAGTYFCM
Bos taurus V203 trdv AAFC05022666.1 84363 SGVAQKVTQDQSDVSSQVGQSVTLNCRYETNWDVYYLFWYKQLPSGQMTYVIRQGSLVTNAKEDRYSVNFKKADKSISLTISALQLEDSAKYFCALCE
Bos taurus V204 trav AAFC05022666.1 74926 TVINAKTTQPSCMDCAEGEDVNLPCNHSTIGGNEYIHWYQQNPNQNTQYVIHGLRGTVNSNMASLHIASDRKSSTLVLPQVTLRDTAVYYCILRE
Bos taurus V205 trdv AAFC05022666.1 58103 SSVAQKVTQYQPDTTSQVWNIVILNCRYETSWNVYIYWIFWYKQLPSREMTYLIHQYSENGNERDGHHSVNFQKAHKFISLTISPLKLEHSGKYFCALWE
Bos taurus V206 trdv AAFC05022666.1 9131 SGVAQSVTQDQPDIVSEVGKAVTLNCRYETSWDMFRYYIFWYKQIPSGQMTYLIRQYSDDGNARDGRYSVNFQKAHKSISLTISALELEDSAKYFCLLLD
Bos taurus V207 trav AAFC05022668.1 210773 LSGEDQVEQSPQILRIQEGDSLSLNCSYSSFRGLQWYRQDPGKGPELLFLLYSVGDEKQKERLRATLLKKGSSLHIEAPKPEDSATYLCAVQTQCSP
Bos taurus V208 trav AAFC05022668.1 202748 VSSKQDVSQSPEVLNVREGDSMVLNCSYTDSALYFLQWFRQDPGKGLTSLLSVQANQKEQASGRITVSLDKSSRHGALYIATSQHSDSTTYLCAV
Bos taurus V209 trav AAFC05022668.1 199281 GAGAQSVTQPDDHIAVSEGARLELKCNYSSSVSPYLFWYMQYPNQGLQLLLKYMPGDNVVSGIKGFEAEFRNSETSFHLRKIPAHWKDSAKYFCALS
Bos taurus V210 trav AAFC05022668.1 187428 QVKQSPQPSTVQEGEISILSCSYEKSAFDYFPWYWQYPGKGPAFFIAIRSVVNEMKDGRLTVFLNKSTKQLSLHIATSQPGYSATYFCAASTQSSP
Bos taurus V211 trdv AAFC05022668.1 180944 SGVAQKVTQDQPYVTSQIGQSVILNCRYEVSLSRYTHYLYWYKQLPSGEMTFLIRQESSGPNARNGRYSVNFQKAQNSISLTISALQLEDSAKYFCAVWE
Bos taurus V212 trav AAFC05022668.1 168775 VNGQQISQIPKFLPLQEGENFTTYCNSSSILSSLQWYKQRPGGSPVLLMILAKGGKVKTEQRLTGRLGETRKHGSLHLAAAQLSDVGTYFCA
Bos taurus V213 trav AAFC05022668.1 158435 TVVDAKTTQPNSMDCAEGENVNLPCNHSTIGGDEYIHWYRQNPSQSPQYVIHGLRGTVNSSMASLTIASDRKSSTLVLPQVTLRDTAVYYCVLRE
Bos taurus V214 trdv AAFC05022668.1 149846 SGVAQKVTQDQPDITSQVGQSVTLNCQYEVNWYRISYSIFWYKQLLSGQMTYLIRQYSEDGNARDGRYSVNFQKADNSISLTIPALQLEDTAKYFCA
Bos taurus V215 trdv AAFC05022668.1 129953 SGVAQNVTQDQPVIISQAGKVATLNCRYEISRNVHDYWIFWYKQLPSGEMTYVIHQYSEDRNERKGCYAVNFQKARKSISLTLSFFKLEHSVKYFCALWE
Bos taurus V216 trav AAFC05022668.1 112223 VQGLDVEQSPPALSLQEGASHMLRCNFSASVSNVQWYLQNPSGRLIHLFNIPSGTKQDGRLNATTIPKERRSSLHISSSQTTDSGTYFCAVQHSAPQ
Bos taurus V217 trdv AAFC05022668.1 98484 IQDQAGISSQVGESVTLNCRYETSQSNNILQVVIVTTSYNIFWFKQLPSGKMIFLTRDGHYSINFERSRKSSSLTISNLQLEDSAKYFCALWE
Bos taurus V218 trav AAFC05022668.1 87166 NVFDAKTTQPSSMDYPEGEDVTLPCSHSTISGNEYIHWYQQSPNQSPQYVIHGLRGTVNSSMASLTISSDRKSSTLVLPQVTLRDTAVYYCILRE
Bos taurus V219 trav AAFC05022668.1 80483 MNGQQIKHFPEFLLLQEGENFTTYCNSSSTFYSLQWYKQRSGGSPVLLMILAKDGEVKTQRRWTGRLGESKQHSSLHLTAAQLSDAGTYFCAE
Bos taurus V220 trdv AAFC05022668.1 74229 SGVAQKVTQDQSDVSSQVGQSVTLNCRYETSLNTYYLYWYKQLPSGQMTYVIRQGSEVTNAKEDRYSVNFKKADKSISLTISALQLEDSAKYFCALRD
Bos taurus V221 trav AAFC05022668.1 64004 TVIDAKTTQPSSMDCAEGEDVNLSCNHSTVGGKDYIHWYRQNRNQSPQYVIHGLRGTVNRSMASLTIASDRKSSTLVLPQVTLRDAAVYYCVLRE
Bos taurus V222 trav AAFC05022668.1 60986 VRGVDVEQSPPALSLQEGASYTLWCNFSTSSQSVNWYLQNPGGRIIHLFYIPSGTKQDGRLNATTVPKEGRSSLHISSSQTTDSGTYFCAVQHSAPQ
Bos taurus V223 trav AAFC05022668.1 56487 LNGQQIKHFPEFLLLQEGENFTTYCNSSSTFYSLQWCKQRPGGSPVLLMILAKGGEVKTQQRRTGQLGESKQHSPLHLAAAQLSDAGTYFCAE
Bos taurus V224 trav AAFC05022668.1 39486 TVIDAKTTQPSCVDCAEGEDVNLPCNHFTIGGNEYMHWYWQNPNQNTQYVTGLRATVNSSMASLTIASDRKSSTLVLPQVTLRDAAVYYCVLRE
Bos taurus V225 trav AAFC05022668.1 28558 MNGQQIKHFPKFLLLQEGENFTTYCNSSSTFYSLQWYKQRPGGSPVLLTVLAKGGEVKTQRRWTGRLGESKQHSSLHLTAAQLSDAGTYFCAE
Bos taurus V226 trdv AAFC05022668.1 22048 SGVAQKVTQDQSDVSSQVGQSVTLNCRYETSSSTYYLYWYKQLPSGQMTYVIRQGSEVTNARKDRYSVNFKKADKSISLTISALKLQDSAKYFCALSD
Bos taurus V227 trav AAFC05022668.1 11072 VRGVDVEQSPPALSVREGASYTLQCNFSTFPQSVNWHFQNPEGRIIHLFYIPSGTKQDGRLNATTVPKEGSSSLHISSSQATDSGTYFCAVQHSAPQ
Bos taurus V228 trdv AAFC05022678.1 28732 SGVAQKVIQDQPYITSQIGQSVILKCQYELSHSGYTHYFFWYKQLPSGEMTFLIRQESLGPNARNGRYFVNLQKAQNSISLTISALQLEDSAKYFCAVRE
Bos taurus V229 trav AAFC05022678.1 14644 TVVDAKTTQPNSMDCAEGENVNLPCNHSIIHGEDYIHWYRQNPSQSPQYVIHGLRGTVNNSMASLHIASDRKSSTLVLLQVTLRDTAVYYCTLRE
Bos taurus V230 trav AAFC05022678.1 11617 VRGVDVEQSPPALSLQEGASYTILCNFSISPQSVIWYLQNSGGCIIQLFYIPSGTKQDGRLNATTVPKEGRSSLHISSSQTTDSGTYFCAVQHSAPQ
Bos taurus V231 trdv AAFC05022678.1 5042 SGVAQNVTQDQPDINRQVGQSVTLNCQYEVSWNMISYYIFWYKQLPSGQMTYLIRQYSEDGNARDGRYSVNFQKADNSISLTISALQLEDTGKYFCALCE
Bos taurus V232 trav AAFC05022679.1 20029 GTNGDSVNQTEGPVTVSEGALMTLNCIYQTADSAPFLFWYIQHLNKAPQFLLKGSTSDQKPKSKGFQATLVKRDSSFHLQKQAVQASDSAVYYCALS
Bos taurus V233 trav AAFC05022679.1 3614 GTNGDSVNQTEGPVTLSEGPLLTLNCTYQTTYSDSYHFWYVHHLNKAPQLLLKGSMTNQRPEHEGFQATLVNSDSSFHLQKRAVQASDLAVYYCALN
Bos taurus V234 trav AAFC05022679.1 1133 SIMAQKVTQNQSEISVLEKEDVTLNCAYEANSYTYYLFWYKQPPSGEIIFLIHQDSYNELNTTKDQYFLNFQKATSSISLTISGSQLEDSAVYFCALR
Bos taurus V235 trav AAFC05022680.1 30731 GTRAQTVTQPESHTSVSKGAPVQVKCNYSYSGSPVLFWYVQYPRQRLQLLLKHTSRESIQGFTAELSQTEASFHLKKPSAQEEDSAVYYCALV
Bos taurus V236 trav AAFC05022680.1 23756 VNNQQGKQKLQTLSIQEGENVTMNCSYKSITLTALQWYRQDSRRGFVHLILMRSNERQKHSGRLHFTLDNSIKSSSLSIMASQTEDTATYLCAP
Bos taurus V237 trav AAFC05022680.1 12466 GTSGDSVTQTEGVVTLPEKTALTLKCTYQSSYSGFLFWCVQYQNKELELLLKSSLNQKVTSRGFEATHISSDSSFHLQKSSVQTSDSAVYYCALS
Bos taurus V238 trav AAFC05022680.1 7937 RTSGDSVNQTEGPMTVSEGALLTLNCTYQTASLVPYLFWYVQHLNKAPKLLLKGLTADKKEEHEGFQATLVKSDSSFHLQKQAVQASDSAVYYCALS
Bos taurus V239 trav AAFC05022680.1 2248 GTNGDSVNQTEGPVTVSEGALLTLNCTYQTANSAPYLFWYVQHLNKAPQLLLKGLTADKKVEHEGFQATPIKRDSSFHLQKQAVQASDSAVYYCALS
Bos taurus V240 trav AAFC05022682.1 14340 VSLGNKVEQSPTLSVQEGNSSVITCTYTDGNSEYFPWYKQESGKGLQFLIGIYSNKAKEEDQRLTVLLNKTAKHLSLHIATTEAGDSAVYFCAAS
Bos taurus V241 trav AAFC05022683.1 48593 GVRGVKVEQNPSVLSLQEGANSTLRCNFSDMVNNVQWFQQNPRGSLTRLFFIASGMKKNERMSSTVNSKERYSTLHITASKLEDAATYLCAVE
Bos taurus V242 trav AAFC05022683.1 23276 VSGKNQVEQSPPSLVVLEGENCTFQCNFTVSPFNNLRWYTQDTGRGLVSLITMTYSDNKKSNGRYTATVDATAKHSSLHITAAQLSDPAFYICVVG
Bos taurus V243 trav AAFC05022683.1 11274 VSSQQNTVEQSPASLPVPEGEAASLGCTYSDSASQYFIWYRQYPGKGPEFLLQVYANKDKEEGKFTAQSNKTSKHVSLRIRDSEPSDSATYLCAV
Bos taurus V244 trdv AAFC05022694.1 1528 SSVAQRVTQDQLEIASQVGEVVTLSCRYETIQSRYNIYWYKQLPSGEMIYLIGQGSSSQNARYGRYSVNFQRSHKSISLMISVLQLEDSAKYFCALWE
Bos taurus V245 trdv AAFC05022698.1 44701 SGVAQKVIQDQPYITSQIEQSVILKCRYELSQSGYTHYFFWYKQLPSGEMTFLIRQESLGPNARNGRYSVNLQKAQNSISLTISALQLGDSAKYFCAVRE
Bos taurus V246 trav AAFC05022698.1 8114 DSRGQSVTQPNDPVFVSEGTSLELKCNYSYGATPYLFWYVQYPRQRPQLLLKYFSGNTVVQGIRGFVAEFKSSDFSFNLRKFSAHWSDSAEYFCALS
Bos taurus V247 trav AAFC05022699.1 2587 GINGDSVNQTEGPVTLSEGALLTLNCTYQTKYSDFYLFWYVQHLNKAPQLLLKGLTADKKVEHEGFQATLVKTDSSFHLRKQAVQASDSAVYYCALS
Bos taurus V248 trdv AAFC05022699.1 405 SIMAQKVTQNQSEISVLEKEDVTLNCAYEANSYTYYLFWYKQPPSGEIIFLIHQDSYNELNRTKDQYFLNFQKATSSISLTISDSQLKDSTLYFCALS
Bos taurus V249 trav AAFC05022700.1 43984 RTNGDSVNQTEGPVTVSEGALLTLNCTYQTASLAPYLFWYVQHLNKAPQLLLKGLTADRKVEHEGFQATHVKRDSSFHLQKQAVQASDSAVYYCALS
Bos taurus V250 trav AAFC05022700.1 36696 RTNGDSVNQTEGPVTVSEGAPMTLNCTYQATYSTYYLFWYVQRLNKAPQRLLMGLTADKKVEHEGFQATLVKSDSSFHLQKQAVQASDSAVYYCALS
Bos taurus V251 trav AAFC05022700.1 29973 GINGDSVNQTEGPVTVSEGALLTLNCTYQTTYSGSYHFWYVQHLNKAPQLLLKGSMTNQRPEHEGFQATLVRSDSSFHLQKRAVQASDSAMYYCALS
Bos taurus V252 trav AAFC05022700.1 19455 LSGEDQVEQSPQTLRIQEGDSLSLNCSYSSFRGLQWYRQDPGKGPELLFLLYSVGDEKQKERLRATLLKKGSSLHIEAPKPEDSATYLCAVQTQCSP
Bos taurus V253 trav AAFC05022700.1 15968 VSTKQDVSQSPEALNVREGDSVVLNCSYTDSALYFLQWFWQDPGKGLTSLLSIQANQKEQASGRITVSLDKSSRHSALYIATSQHSDSTTYLCAV
Bos taurus V254 trav AAFC05022700.1 7568 GAGAQSVTQPDDHIAVSEGARLELKCNYSSSVSPYLFWYIQYPNQGLQLLLKYVSGDNLVSGIKGFEAEFRNSETSFHLRKIPAHWKDSAKYFCALS
Bos taurus V255 trav AAFC05022700.1 3131 VRGMDVAQSPPALSLQEGASSILQCNFSTFADSVQWYLQNPRGRLIHLFYVPSGTKRDGRLNATTVPTERRSSLHISSSPTTDSGTYFCAVQHSAPQ
Bos taurus V256 trav AAFC05022702.1 73985 QTHGNSVTQMDGHVSRSEGTSVTINCTYSTSGYPNLFWYVQYPGEGPQLLLKAMKANDKGTNKGFEATYNTETTSFHVEKDSGQESDSAVYYCAWR
Bos taurus V257 trav AAFC05022702.1 69304 VSLGNKVEQSPTLSVQEGNSSVITCTYTDGNSAYFPWYKQEPGKGPQFLIAIRSNKGKEEDQRLTVLLNKTIKRLSLHIATTEAGDSAVYFCAAS
Bos taurus V258 trav AAFC05022702.1 62471 VSSQYTLDQSPSFLSIQERTHDDLNCTYQKKTFYHLVWFEQEPGKGLVSLSLIQSSQKEEADKNFKELLGKEKVYSVLHISASHPGDSAIYFCALRR
Bos taurus V259 trav AAFC05022702.1 49859 ASTQQNTVEQSPASLPVPEGAAASLGCTYSDSTSRYFTWYRQYPGKGPEFLLQVYANNNKEEGKFTAQSNKTSKHVSLRIRDSEPSDSATYLCAV
Bos taurus V260 trav AAFC05022702.1 33039 GTSGDSVTQTEGVVTLPEKASLTLKCTYQSSYSGFLLWYVQYQNKELELLLKSSLNQKVTSRGFEATHISSDSSFHLQKSSVQTSDSAVYYCALS
Bos taurus V261 trav AAFC05022702.1 28871 GTNGDSVNQTKGPVTVSEGALMTLNCTYQTADFDPYLFWYIQHLNKAPQLLLKGSISDQNPKSKGFQATLVRSDSSFHLQKRAVQTSDSAVYYCALS
Bos taurus V262 trav AAFC05022702.1 6850 GTNGDSVNQTEGPVTVSEGALLTLNCTYQATYSTYYLFWYVQHLNKAPQLLLKGSMTDQKPKSEGFQATLDRSGSSFHLQKRAVQASDSAVYYCALS
Bos taurus V263 trav AAFC05022703.1 74038 GVRGVKVEQNPSVLSLQEGANSTLRCNFSDMVNNVQWFQQNPRGSLTRLFFIASGMKKNERMSSTVNSKERYSTLHITASQLEDAATYLCAVE
Bos taurus V264 trav AAFC05022703.1 69659 VSLGNEVEQSPSTLSVQEGNSSVITCTYTDTASDYFPWYKQEPGKGPQLLIAIRSNMGEKKDQGLTVLLNKTTKHLSLHIATIQPGDSAVYFCAAR
Bos taurus V265 trav AAFC05022703.1 65963 SIIAQKVTQDQPQVLGQEKEAVTLDCKYDTSDSRYSLVWYKQPSSGGMILLIRQDSSNQQNATEGRYSLNFQKARQSVTLVISASQLEDSAVYFCALRD
Bos taurus V266 trav AAFC05022703.1 51326 MSGKNQVEQSPPSLVVLEGENCTFQRNYTVSPFNLRWYTQDTGRGLVSLITMTYSDNKKSNGRYTATVDATAKHNSLHLTAAQLSNPAFYICVVG
Bos taurus V267 trav AAFC05022703.1 39981 VSSQQNTVEQSPASLPVPEGAAASLGCTYSDSNSLYFTWYRQYPGKGPEFLLQVYANNNKEEGKFTAQSNKTNKHVSLHIRDSEPSDSATYLCAV
Bos taurus V268 trav AAFC05022703.1 18991 GTNGDSVNQTEGPVTVSEGALLTLNCTYQTADFDPYIFWYIQHLNKAPQLLLKGSMSDQNPKSKGFQATLVKSDSSFHLQKQAVQASDSAVYYCALS
Bos taurus V269 trav AAFC05022704.1 43191 TLSLAKTSQPIFIDSYEGQEVNISCNHTTIATSEYIFWYRQFPNQGPQFIIQGYKTNVENEVASLLIPPDRKFSTLSLPQASLRDTAVYYCIVRD
Bos taurus V270 trav AAFC05022704.1 32075 KSRGQKVEQNPSFQSVQEGDNCVINCTYTDSASTYFFWYKQEPGKGLQLLIHTLSNVDKKEGQGLIVLLNKKNKHLSLNITATNPGDSATYFCATR
Bos taurus V271 trav AAFC05022779.1 11152 VSLGNKVEQSPTLRVQEGNSTFITCTYTDGNSNYFPWYKQEPGKGPQLLIAIRSNKAKEEDQRLTVLLNKTAKHLSLHIATTEGGDSAVYFCAAS
Bos taurus V272 trdv AAFC05022780.1 7292 SSVAQQVTQVQTVVSSQVGQTVTLNCRYEVSWNMDYYYIFWYKQLPRGEMTFLIHQYSGYGNARNGRYSVNFHKAHKYISLIISALQLGDSAEYFCALWK
Bos taurus V273 trav AAFC05022782.1 6797 QTCGDSVRQMDGQVTLLEGATLTVNCTYSATRYPTLFWYVQYPGEGPELLLKAMKANDKGNNKGFEAAYNTEIISFHLEKASVQESDSAVYYCALS
Bos taurus V274 trav AAFC05022782.1 1665 GVRGVKVEQNPSVLSLQEGANSTLRCNFSDMVNNVQWFQQNPRGSLTRLFFIASGMKKNERMSSTVNSKERYSTLHITASKLEDAATYLCAVE
Bos taurus V275 trdv AAFC05022783.1 907 SGMAQNVIQDQPNTSGQLGQSVTLNCRYGTAWSYYYMFWYKLLPNGEMIYLISQVFSGQNARNGRYSVNLQKASKSISLTISDLQLEDSAEYFCALWE
Bos taurus V276 trdv AAFC05022787.1 455 SGVAQKVTQDQPDISSHMGQSVTLNCQYETSWSTYYLFWYKQLPSGQMTYLIQQYSGYGNARNGRYSVNFQKADKSISLIISSLQLEDSAKYFCALWE
Bos taurus V277 trav AAFC05022788.1 6105 GTGAQLVTQPDGHINVSEGNHVELRCNYSYGGSIYLFWYVQYPNQGLQFLLKYLPGPTRVKGIKGFEADFKKDENSFHLMKASAHWSDSAKYFCALC
Bos taurus V278 trav AAFC05022791.1 54204 TVTDAKTTQPSSMDYPEGQDVTLSCNHSTIGRNEYICWYQQNPNQSPQYVVHGLRGTVIRSTASLTIASDRKSSTLVLPQVTLRDTAVYYCVPRE
Bos taurus V279 trdv AAFC05022791.1 42853 SSVAQRVAQDQPDISSQVGEVVTLRCQYETRLSSFRIFWYKQLPSGEMIYLIGQVSSSQKARDGRYTTDLQISRKSISLTISDLQLEDSAKYFCAVWE
Bos taurus V280 trav AAFC05022791.1 23169 VSSLLTVEQHPSLLWVQEGKSTNFTCSFPSSSFYALHWYRWEPAKTTKNLFVISVNGDEKKQGRVRVTLNTKEGYSSMYIRGSQPEDSATYLCA
Bos taurus V281 trav AAFC05022791.1 16345 MNGQQIKHFPEFLLLQEGENFTTYCNSSSFLSSSQWYKQRSGSSPVLLMILAKGGEVKTEQRLTGQLGETKQHSSLHLTAAQLSDAGTYFCT
Bos taurus V282 trdv AAFC05022791.1 10359 SGVAQKVTQDQPDISSQVGQSVTLNCRYETSSGVYYLFWYKQLPSGQMTYLIQQYSEHGNARNDRYSVNFQKADKSISLIISSLQLEDSAKYFCVLRE
Bos taurus V283 trav AAFC05022791.1 1689 TVIDAKTTQPGSMDCAEGEDVNLPCSHSTIGGEDYIHWYWQNPNQSPQYVIHGLRGTVSSSMASLHIASDRKSSTLVLPQVTLRDTTVYYCILRE
Bos taurus V284 trdv AAFC05022793.1 113827 SGVAQKVIQDQPYITSQIGQSVILKCQYELSHSGYTHYFFWYKQLPSGEMTFLIRQESLGPNARNGRYSVNLQKAQNSISLTISALQLEDSAKYFCAVRE
Bos taurus V285 trav AAFC05022793.1 106683 VNGQQISQIPQFLPLQEGENFTTYCNSSSTVYRLQWYKQRPGGSPVLLMILAKDGEVKTEQRLTGRLGETRKHGSLHLVAAQLSDVGTYFCA
Bos taurus V286 trav AAFC05022793.1 93458 TVVDAKTTQPNSMDCAEGENVNLPCNHSTIRGDEYIHWYQQNHNQSPQYVIHGLRGTVNSSMASLTIASDRKSSTLVLPQVTLRDTAVYYCILRE
Bos taurus V287 trav AAFC05022793.1 90392 VQGVDVEQSPPALSLQEGASYTLQCNFSTSSQSVIWYLQNSGGHLIQLFYIPSGTKQDGRLMATTVPKERHSSLHISSSQTTDSGTYFCAVQHSAPQ
Bos taurus V288 trav AAFC05022793.1 74267 MNGQQIKHFREFLLLQEGENFTTYCNSSSTFYSLQWYKQRPGGSPVLLMILAKGGEVKTQRRWTGRLGESKQHSFLHLTAAQLSDAGTYFCAE
Bos taurus V289 trdv AAFC05022793.1 67934 SGVAQKVTQDQSDVSSQVGQSVTLNCRYETSWSAYYLYWYKQLPSGQMTYVIRQGSEVTNARKDRYSVNFKKADKSISLTISALQLEDSAKYFCALRD
Bos taurus V290 trav AAFC05022793.1 59313 TVINAKSTQPSSMDCAEGEDINLPCNHSTIGGDDYIHWYRQNPNQSPQYVIHGLRGTVNSSEASLTISSDRKSSTLVLPQVTLRDTAVYYCVLRE
Bos taurus V291 trav AAFC05022793.1 56302 VQGVDMEQSPPALSLQEGASYTLQCNFSTFPQSVSWYLQNPGGCIIHLFYIPSGTKKDGRLNATTVPKEGRSSLHISSSQTTDSGTYFCAVQHSAPQ
Bos taurus V292 trdv AAFC05022793.1 27741 SGVAQSVTQDQPDILSEVGKAVTLNCRYETSWYMLSYYIFWYKQLPSGQMTYLIRQYSDDGNARDGRYSVNFQKAQKSINLTISALELEDSAMYFCVLRA
Bos taurus V293 trav AAFC05022794.1 13282 RTNGDSVNQTEGPVTVSEGALLTLNCTYQTTYSDPYVFWYVQHLNKAPQLLLKGWMKDQSPVHEGFQATLVKSDSSFHLQKQAVQASDSAVYYCALS
Bos taurus V294 trav AAFC05022797.1 30321 VNSQQGEQNLQTLSIQEDENVTMNCSHKSITLTALQWYRQDSRRGFVHLILMHSNERQKHSGRLHFTLDNSIKSSSLSIMASQAEDTATYLCAP
Bos taurus V295 trav AAFC05022797.1 18976 GTRGDSVTQTEGVVTLPEKASLTLKCTYQSSYSGFLFWYVQYQNRELEMLLQSSLGNQKVTNRGFEATHISRDSSFHLQKSSVQTSDSALYYCALS
Bos taurus V296 trav AAFC05022797.1 13499 STNGDSVNQTEGPVTVSEGALMTLNCTYQATYSNSYLFWYIQHLNKAPQLLLKGLTADKKVEHEGFQATPVKRDSSFHLQKRAVQASDSAVYYCALS
Bos taurus V297 trav AAFC05022797.1 7922 GTNGDLVNQTEGPVTVSEGALLTLNCTYQTTYSDLYVFWYVQHLNKAPQLLLKGSMRDQKPKSEGFQATLVRTDSSFHLQKQAVQASDSAVYYCALS
Bos taurus V298 trav AAFC05022798.1 17157 SSIAQKVTQDQPPMSVQEKETVTLNCTYDTSGTTYSPFWYKQHSSGVMAFLIPQDSYNKPNATEGHYSLNFQKASKFITLTISASQLGDSAVYFCTLSE
Bos taurus V300 trav AAFC05022800.1 28481 VSLGNEVEQRPSTLSVQEGNSSVITCTYTDTASDYFPWYKQGPGKGPQLLIAIHSNMGEKKDQRLTVLLNKNTKHLSLHIATIQPGDSAVYFCAAR
Bos taurus V301 trdv AAFC05022800.1 24754 SIIAQKVTQDQPQVLGQEKEAVTLDCKYDTSDSRYSLFWYKQPSSGGMILLIRQDSSNQQNATEGRYSLNFQKARQSVTLVISASQLEDSAVYFCALRE
Bos taurus V302 trav AAFC05022800.1 10680 MSGKNQVEQSPPSLVVLEGENCTFQSNYTVRPFNNLRWYTQDTGRGLVSLITMTYSDNKKSNGRYTATLVVTSKHSSLHLTAAQLSNPAFYICVVG
Bos taurus V303 trdv AAFC05022803.1 20024 SSVAQIVTQDQPYISSPVGEIVTLSCRYETTQSSYNIFWYKQLPSGEIIYLIGLGSSRQNARYGRYSVNFKTSRKSISLTISDLELEDSAKYFCALWE
Bos taurus V304 trdv AAFC05022803.1 7375 SGVAQKVTQDQPEISSQVGKSATMNCQYETSWNSYNIFWYKQLPSGEMIYLIGQNSYSPNARDGRYSINFQKSHKAISLIISALKLEDSAKYFCALWE
Bos taurus V305 trav AAFC05022820.1 15666 TLSLAKTSQPIFIDSYEGQEVNISCNHTTIATSDNIFWYRQFPNQGPQFIIQGYKTNVENEVASLLIPPDRKFSTLSLPRASLRDTAVYYCIVG
Bos taurus V306 trdv AAFC05022821.1 39509 SGVAQSVTQDQPDILSEVGKAVTLNCRYETSWDMFHYYIFWYTQLPSGQMTYLIRQYSDAGNARDGRYSVNFQKAQKSISLTISALELEDSAMYFCVLR
Bos taurus V307 trav AAFC05022821.1 14401 TVTDAKNAQPSSMDYPEGQDVTLSCNHSTIGRNEYIYWYQQNPNQSPQYVIHGLRGTVNSSTASLTIASDRKSSTLVLPQGTLRDTAVYYCVLRE
Bos taurus V308 trav AAFC05022822.1 10423 GTNGDSVNQKEGPVTVSEGALLTLNCTYQTTYSDLYVFWYVQHLNKAPQLLLKGWMKDQSPVREGFQATLVSTDSSFHSQKWAVETSDSAVYYCALS
Bos taurus V309 trav AAFC05022830.1 13838 GTNGDSVNQTEGPVTVSEGALLTLNCTYQTAYLAPYLFWYVQHLNKAPKLLLKGLTADKKVEHEGFQATPVKRDSSFHLQKQAVQASDSAVYYCALS
Bos taurus V310 trav AAFC05022830.1 7098 GTNGDSVNQTEGPVTVSEGALLTLNCTYQTADSAPFLFWYLQHLNKAPQFLLKGSMSDQNPKSKGFQATLVKRDSSFHLQKQAVQASDSAVYYCALS
Bos taurus V311 trav AAFC05022833.1 26520 VSSQYTLDQSPSFLSIQERTHADLNCTYQKKTFYNFVWFKQEPGKGLVSLSLIQSSQKEEADKNFKELLGKEKVYSVLHISASHPGDSATYFCALHRSALQ
Bos taurus V312 trav AAFC05022833.1 13885 VSSQQNTVEQSPASLPVPEGAATSLSCTYSDSNSQYFTWYRQYPGKGPEFLLYVYANNNKEEGKFTAQSNKTNKHVSLRIRDSEPSDSATYLCAV
Bos taurus V313 trav AAFC05022835.1 5819 QTHGNSVTQMDGHVSRSEGTSVTINCTYSTSGYPNLFWYVQYPGEGPQLLLKAMNANDKGTNKGFEATYNTETTSFHLEKASVQESDSAVYYCALR
Bos taurus V314 trav AAFC05022835.1 1165 VSFGNKVEQSPTLSVQEGNSSVITCTYTDGNSAYFPWYKQEPGKGPQFLIAIRSNKGKEEDQRLTVLLNKTTKRLSLHITTTEAGDSAVYFCAAS
Bos taurus V315 trav AAFC05022836.1 11269 VIGVDVEQSPAALTAQEGASSTLWCNFSTSSDSVQWYLQKPGGRLIHLIYIPSGTRKEGRLNATTVLKERRSSLHVSSLRTTDSGTYFCAVQHCAPQ
Bos taurus V316 trdv AAFC05022837.1 1469 SGVAQNVIQDQPDTSGQLGQSVTLNCRYGTIWSYMFWYKLLPNGEMIYLISQASSGQNARNGRYSVNFQKARKSISLTISDLQLEDSAEYFCALWE
Bos taurus V318 trav AAFC05022838.1 288980 GLRAQSVTQPEAEVPVAEGDPVTVKCTYSVSGSPYLFWYAQYRNQSLQFLLKYIGGDSLVKGNYGFEAEFNKSQTSFHLKKPSVQGSDSALYFCAVR
Bos taurus V319 trav AAFC05022838.1 271809 GLRAQSVTQPEAEVSVAEGDPVTVKCTYTVSGSPYLFWYVQHRNQSLQFLLKYIGGDSLVKGNYGFEAEFNKSQTSFHLKKPSVVGSDSTLYFCAVS
Bos taurus V320 trav AAFC05022838.1 249832 GLRAQSVTQPEAEVPVSEGDPVTVKCTYSVSGSPYLFWYVQHHNQGLQFLLKYIGGDSLVKGNYGFEAECNKSQTSFHLKKPSVVGSDSALYFCAVR
Bos taurus V321 trav AAFC05022838.1 231019 GLRAQSVTQPEAEVRVAEGDPVTVKCTYSVSRSPYLFWYVQHHNLGLQFLLKYIGGDTLVKGNYGFEAEFNKSQTSFHLKKPSVLGSDSALYFCAVS
Bos taurus V322 trav AAFC05022838.1 209037 GLRAQSVTQPEAEVCVAERDPVTVKCTYSVSWSPYLFWYVQHRNQGLQFVLKYIGGDRLVKGNYGFEAEFNKSQTSFHLKKPSVLGSDSALYFCAVS
Bos taurus V323 trav AAFC05022838.1 181507 GLRAQSVTQPEAEVPVAEGDPVTVKCTYSVSGSPYLFWYVQHRNLGLQFLLKYISGDTLVKGNYGFEAEFNKSQTSFHLKKPSVVGSDSALYFCAVR
Bos taurus V324 trav AAFC05022838.1 157747 GLRAQSVTQPEAEVPVAEGDPVTVKCTYSVSGSPYLFWYVQHRNQGLQFLLKYIGGDRLVKGNYGFEAEFNKSQTSFHLKKPSVLGSDSALYFCAVS
Bos taurus V325 trav AAFC05022838.1 129912 GTNGDSVNQTEGPVTLSEGALLTLNCTYQTTYSDSYHFWYVHHLNKAPQLLLKGSMTNQRPEHEGFQATLVNSDSSFHLQKWAVQASDSAVYYCALN
Bos taurus V326 trav AAFC05022838.1 127719 SLMAQKVTQNQSEISVLEKEDVTLNCAYEANSYTYYLFWYKQPSSGEMIFLIHQESYNELNTTKGQYFLDFHKATSSISLTISDSQLEDSAVYFCALR
Bos taurus V327 trav AAFC05022838.1 119445 LSGEDQVEQSPQTLRIQEGDSLSLNCSYSSFRGLQWYRQDLGKGPELLFLLYSVGDEKQKERLRATLLKKGSSLHIEAPKPEDSATYLCAVQTQCSP
Bos taurus V328 trav AAFC05022838.1 102919 GAGAQSVTQPDDHITVSEGARLELKCNHSSSVSLSLFWYVQYPNQGLQLLLKYVSGDNLVSGIKGFEAEFRNSEMSFHLRKIPAHWKDSAKYFCALS
Bos taurus V329 trav AAFC05022838.1 98509 VRGMDVAQSPPALSLQEGASSTLRCNFSTFADSMQWYLQNPGGRLIHLFYVPSGTKRDGRLNATTVPTERHSSLHISSSQTTDSGTYFCAVQHSAPQ
Bos taurus V330 trdv AAFC05022838.1 83079 SGVAQKVTQDQPYVTSQIGQSVILNCWYEVSWSGYTHYLYWYKQLPSEEMTFLIRQESSGPNARNGRYSVNFQKAQNSISLTISALQLEDSAKYFCAVWE
Bos taurus V331 trav AAFC05022838.1 61727 VNGQQISQIPQFLPLQEGENFTTYCNSSSTFYRLQWYKQSPGGIPVFLMILAKDGDVKTQQRLTGRFGETRKHGSLHLAAAQLSDAGTYFCAE
Bos taurus V332 trav AAFC05022838.1 48057 TVVDAKTTQPNSMDCAEGENVNLPCNHSTIGGEDYIHWYRQNPSQSPQYVIHGLRGTVNSSMASLHIASDRKSSTLVLPQVTLRDTAVYYCTLRE
Bos taurus V333 trav AAFC05022838.1 45035 VRGVDVEQSPPALSLQEGASYTILCNFSTSPQSVIWYLQNSGGHIIQLFYIPSGTKQDGRLTATTVPTERRSSLHISSSQTTDSGTYFCAVQHSAPQ
Bos taurus V334 igkv AAFC05024150.1 2127 ASGEAVLYQTPAYIAASLGESISITCRANQSISDYLSWYKQKPGQAPMILIYDADNRYNGVPERFTATQSETEFVFTISQVEADDAAMYYCQQDY
Bos taurus V335 iglv AAFC05028505.1 32197 SWAQAVLTQPSSVSGSLGQRVSITCSGSSSNVGRGNYVNWFQQIPGSAPRTLIYGATSRASGVPDRFSGSRSGNTATLTISSLQAEDEADYFCAAYDSSSNN
Bos taurus V336 iglv AAFC05028505.1 20989 SWAQAVLTQPSSVSGSLGQRVSITCSGSSSNVGTGNYVGWFQQIPGSAPRTLIYGATSRASGVPDRFSGSRSGNTATLTISSLQAEDEADYFCASYQSG
Bos taurus V337 iglv AAFC05028505.1 8278 SWAQAVLTQPSSVSGSLGQRVSITCTGSSSNVGNGYVSWFQQIPGSAPRTLIYGDTSRASGVPDRFSGSRSGNTATLTISSLQAEDEADYFCAAGDSSSSN
Bos taurus V338 iglv AAFC05028506.1 1395 SWAQAVLTQPSSVSGSLGQRVSITCSGSSSNVGTGNYVSWFQQIPGSAPRTLIYGATSRASGVPDRFSGSRSGNTATLTISSLQAEDEADYFCASYQSG
Bos taurus V340 ighv AAFC05030486.1 7159 VLSQVQLQESGPSLVKTSQTLSLTCTASGLSLTRYGIHWVRQAPGKALEWLGDISSGGSTGYNPGLKSRLSITKDNSKSQVSLSLSSLTPEDSATYYCAR
Bos taurus V341 ighv AAFC05031349.1 6626 VLSQVQLRESGPSLVKPSQTLSLTCTASGFSLSDKAVGWVRQAPGKALEWLGGIDTGGSTGYNPGLKSRLSITKDNSKSQVSLSVSSVTTEDSATYYCTT
Bos taurus V345 trgv AAFC05036555.1 209834 IPQEIRVFQRSVMVGHAGGALTMPCQISKSVDYVHWFRQLEGQAPERLLYLALSKRDVQWDSVLRGDKVNAARGTDGKSCTMSLRKLAKSDEGLYYCATWGS
Bos taurus V347 trbv AAFC05037176.1 54756 VRTQTIHQWPSTRVQPAGSPLSLECTVKGTSNPTLYWYRQEAGGSLQQLFYSVSAGQIEPREFQNFKASRPQDGQFTLSSKKLQLNNSGFYFCAWS
Bos taurus V348 trbv AAFC05041509.1 5187 AVHAGVTQDPRFQVVRSGQKPTLRCTQDLNHNYMYWYRQDLGRGLRLIHYSNGPPNTENGDVPEGYSVSRPSTEDFPLTLESANRSQTSVYFCASSY
Bos taurus V349 trbv AAFC05041509.1 1265 LVDSGVTQTPKYLIKSRNQQATLRCSPHSGHFSVYWYQQALGQGPQFLVQYYNQKVRGESHLLDRFSAKQFSDSRSELNLSSLELTDSAMYLCASSE
Bos taurus V350 trav AAFC05041763.1 11613 FRVQMKVEQSPGVLTLQEGRNSSLICNYSISMTSVQWFQQNPDGRLISLFYIASGMQQKGRLKSTINSKERYSQLYIRDSQPGDSATYFCAVE
Bos taurus V351 trdv AAFC05041763.1 1842 SSMADKVTEAQTTVTAREREAVTIGCTYEASRTYYTLFWYRQFPGGRMEFLIHQDSNNANARRDRYSVNFQKGKKIISLTISSLYLADSAKYFCALWE
Bos taurus V83 trgv DAAA02010608.1 8552 IPQEIRVFQRSVMVGHAGGALTMPCQISKSVDYVHWFRQLEGQAPERLLYLALSKRDVQWDSVLRGDKVNAARGTDGKSCTMSLRKLAKSDEGLYYCATWGS
Bos taurus V90 trgv DAAA02011297.1 7164 GLGQLTLVQTEVSVTGTREKSIIMSCKVFSKDFSKDYIHWYRQKPDQGLEQLLFVLDAPALNDLGGKKNKLEARKDKPSSTSTLKISFLEKEDEATYYCAGWLL
Bos taurus V91 trgv DAAA02011297.1 13930 IKMKISQHQLSSTRRPDRTVHISCKLSGVPLENAIMHWYQEKEGEPLKRILYGSANSYKLDKPNSRLEIDNKKNGIFYLIINNVVKSDEATYYCACWD
Bos taurus V92 trgv DAAA02011299.1 11913 GLGLSKVEQAQISLSTEVKKSINIHCKIESTNFESEIVYWYRQKKNQALEHLVYVTSTTTAARNQVDGKNKIEARKDAQMFTSTLTVNFIEKEDVGIYYCAGWS
Bos taurus V96 trbv DAAA02011756.1 177093 TWGTGVFQTPKYLLTQMGTKTSLECEQKLNHDSMYWYKQDSKKLLKAMFSYNNKLLVGNETVPSRFSPESPDKAHLNLHIDSLEPGDSAMYFCASS
Bos taurus V97 trbv DAAA02011756.1 181362 VCADPGITQIPKYLVMGMTDKKSLTCEQHLGHDAMYWYKQSAQKPPELMFIHNYQKLTGNESVPSRFWSECPDSSQCRLDLNALKPQDSAIYLCASSR
Bos taurus V98 trbv DAAA02011759.1 8205 LVDSEVTQTPKYLIKSRKQQATLRCSPNSGHSSVNWYQQALGQGPQFLVQCYRGQVSRGENMPDRFSAKQFSDFRSELNLSSLELTDSAVYLCASSQ
Bos taurus V99 trbv DAAA02011759.1 13056 AVHAGVTQDPRFQVIRSGQKPTLRCTQDLNHNYMYWYRQDLGRGLRLIHYSNGPPNTENGDVPESYSVSRPSTEDFPLTLESANPSQTSVYFCASSY
Bos taurus V100 trbv DAAA02011759.1 16831 LVDSGVTQTPKYLIKSRNQQATLRCSPHSGHFSVYWYQQALGQGLQFLVQYYNQKVRGESHLLDRFSGKQFSDSRSELNLSSLELTDSAMYLCASSE
Bos taurus V101 trbv DAAA02011759.1 22977 LVDSGVTQIPKYLIKSRKQQVILRCSPESGHRSVYWYQQVLGQGPQFLIQYFNTQENEKGNISDRFSGKQFSDSSSELNLTSLELTDSAVYLCASSQ
Bos taurus V102 trbv DAAA02011759.1 32233 AVHPGVTQDPRFQVVRRGQSGTLKCTQDLGHDRMYWYRQDLGHGLRLIHYSAGVHTSEPGDMPDGYSVSRSNTENFPLTLVCANHSQTSVYFCASSY
Bos taurus V103 trbv DAAA02011759.1 34443 LVDSEVTQTPKYLIKSRKQQVILRCSPKSGHTSVYWYQQALGQGLQFLIQYYNRAEYDKGNISDRFSGKQFSDSRSELNLTSLELKDSAVYLCASSQ
Bos taurus V104 trbv DAAA02011759.1 36260 AVHAGVSQDPRFQVVRRGLNTTLTCTQDLSFSYMYWYRQDPGHGLRLIHYSVIPPSTERGAVPEGYSVSRPSTENFPLTLESANRSQTSVYFCTCGY
Bos taurus V105 trbv DAAA02011759.1 40044 AVYAGVTQDPSFQVVRKGLNVTLTCTQDLGHDSMYWYRQDLGHGLRLIHYSDGPPTTVKGDVPEGYSVSRPSKKDFPLTLKSANHSQTSVYFCASSY
Bos taurus V106 trbv DAAA02011759.1 41446 AIHAGVTQDPRFQVVRTGQNATLTCTQDLGHDSVYWYRQDLGHGLRLIYYSAGPPTMVKGDVPDGYSVSRSSKNHFPLTLESANHSQTSVYFCASSY
Bos taurus V107 trbv DAAA02011759.1 44736 AVHAGVSQDPRFQVVRSGQKPTLRCTQDLNHDYMYWYRQDLGRGLRLIYYSNGPPYTENGDVPEGYSVSRPSTEDFPLTLESANPSQTSVYFCASSY
Bos taurus V108 trbv DAAA02011759.1 48510 GLVDSGVTQTPKYLIKSRKQQAILRCSPVSGHLSVYWYQQALGHGPQFLVQYYNQKVRGEAHLLDRFSGKQFSDSRSELNLSSLELTDSAVYLCASSE
Bos taurus V109 trbv DAAA02011759.1 52400 VVHAGVTQDPRFQVVRRGQSMTLTCTQDLGHNYMYWYRQDLGHGLRLIYYSAGPPTTEKGDVLNGYRVSRSSKENFPLTLESANHSQISVYFCASSYFMVLH
Bos taurus V110 trbv DAAA02011759.1 54679 LVDSGVNQTPKYLIKSRKQQVTLRCSPESGHRYVSWYQQTLVQGPQFLIQYFNRQQNEKGNISDRFSGKQFSDSSSELNLTSLELTNSAVYLCASSQ
Bos taurus V111 trbv DAAA02011759.1 58844 LVDSEVTQIPKFLTKSRKQQVTLRCSPESGHRSVYWFQQALGQGPQFLVQYFDGEVYQRGSMSDRFSVQQLGDSRSELNLTPLELTDSAVYLCASSP
Bos taurus V112 trbv DAAA02011759.1 62695 LVDSGVTQTPKYLIKSREQQVILRCSPESGHRSVYWYQQALGQGPQFLVQYYNGKENEKGNMPDRFSGKQFSDFHSELNLSSLELTDSAAYLCASSQ
Bos taurus V113 trbv DAAA02011759.1 67131 LVDSEVTQTPMYLIKSRKQQGILRCSPESGHRPVYWYQQVLGQGLQFLIQYYNRAEYEKGNISDRVSGKQFSDSSSELNLTSLELTDSAVYLCASSQ
Bos taurus V114 trbv DAAA02011759.1 68944 AVHAGVSQDPRFQVVRRGLNTTLTCTQDLSFSYMYWYRQDSGHRLRLIHYSVIPPSTERGAMPEGYRVSRPSTENFPLTLESANHSQTSVYFCTCGY
Bos taurus V115 trbv DAAA02011759.1 71318 AVHAGVTPDPRFQVVRTGQSATLRCTQDLNHDYMYWYRQDPGHGLRLIHYSDGTPTTEKGDVPEGYRVSRPSTNDFLLTLKSANHSQTSVYFCASSYSMV
Bos taurus V116 trbv DAAA02011759.1 73733 LVDSGVTQTPRYLIKARGQRGTLGCSPVSGHLSVYWYQQALGQGPEFLVQYYSQEVRGEAQLPDRFSGKQFSDFHSELNLSSVELTDSAVYLCASSQ
Bos taurus V117 trbv DAAA02011759.1 78624 LVDSGVTQTPKYLIKSRKQQVTLRCSPESGHLSVSWYQQALGQSPEFLVQYYDGEMYQKGNISDRVSGKQFSDAASELSLTPLDLTDSAVYLCASSQ
Bos taurus V118 trbv DAAA02011759.1 84673 VCADPGITQIPKYLVMGMTDKKSLTCEQHLGHNAMYWYKQSAQKPPELMFIHNYQELAGNENVPSRFWPECPDSSQCRLDLNALKPQDSAVYLCASSR
Bos taurus V119 trbv DAAA02011760.1 922 AVHAGVSKDPIFHVVRRGQSATLTCTQDLNFSYMYWYRQDPGNGLRLIHYSVIPPSMEKGPVPEGYRFSRPSTENFPLTLESANCSLTSVYFCTCGY
Bos taurus V120 trbv DAAA02011760.1 4556 AVHAGVTQDPRFQVLRTGQKATLTCTQDLGHNCMYWYRQDLGQGLRLIHYSVAAPNTVKGDIPEGYSVSRPSTKAFPLTLESANHSQTSVYFCASSY
Bos taurus V121 trbv DAAA02011760.1 6783 LVDSGVTQTPRHLIKARGQRGTLGCSPVFGHLSVYWYQQALGQGPEFLVEYYRQEVRGEAQLLDGFSGKQFSDFHSELNLSLLELTDSAAYLCASSQ
Bos taurus V122 trbv DAAA02011760.1 16026 AVHAGVTQDPRFQVVRTGQNATLKCTQDLNHDYMYWYRQDLGHGLRLIHYSAGVRSSEPGDVPDGYSVSRSSKENFALTLESANQSQTSVYFCTSSY
Bos taurus V123 trbv DAAA02011760.1 22819 AVHAGVTQDPRFQVVRTGQKATLTCTQDLGHDCMYWYRQDLGHRLRLIHYSFAAPNTVKGDIPEGYSVSRPSTEDFPLTLESANHSQTSVYFCASSY
Bos taurus V124 trbv DAAA02011760.1 25051 LVDSGVTQTPRYLIKARGQRGTLGCSPVSGHLSVYWYQQALGQGPEFLVEYYRQKVRGEVQLPNRISGKYFSDSHSELNLSSLELTDSAVYLCASSQ
Bos taurus V125 trbv DAAA02011760.1 26875 AVHAGVTQDPRFQVMRTGQNVTLRCSQDLGHNFMSWYRQDLGHGLRLIHYSDGAHTSELGDVPNGYSVSKSNKENFPLTLESANRSQTSVYFCASRY
Bos taurus V126 trbv DAAA02011760.1 29165 LVDSEVTQTPKYLIKSRKQQVTLRCSPESGHRYVSWYQQALGQGPQFLILYYDGKVRTKGNMPDRFSGEQFGDSRSQMNLSSLELTDSAVYLCAGRQ
Bos taurus V127 trbv DAAA02011760.1 31613 AVHAGVSQDPRFQVVKTGQNVTLRCTQDLYHDSMYWYRQDLGLRLRLIRYSSFTDTTYKGDMPDGYSVSRSSTENFPLTLESANRSQTSVYFCASST
Bos taurus V128 trbv DAAA02011760.1 34530 HTGAGAVSQSPRHRVAGRGQTVNLRCDPISGHVSLYWYRQTLGQGPEFLTYFQDEQQLDKSGMPKNRFYAERPEKTYSYLKIQPAEPGDSAVYLCASSP
Bos taurus V129 trbv DAAA02011762.1 8584 PLEAEVTQTPRHLIKTTGQTATLRCSPMSGHSSVSWYQQAQSQGPQLIFEFYETLQRAKGNFSNRFLAKQFPDFSSELNVNSLDQTDSALYLCASSL
Bos taurus V130 trbv DAAA02011762.1 13755 HTRAGVVSQSPGYRVAGRGQTVNFRCDPIPGHQVLYWYRQMLGQGLEYLTYFQGKEEPDKSGMPKNRFSAERPESTYSYLKIQPVEPEDSALYLCASSP
Bos taurus V131 trbv DAAA02011764.1 18326 TTDANLGVTQTPRHEVTEKGQAVTLSCELIKSHTALYWYRQTSVRGLEFLAYFSNQAPIDESGMPKDRFSAKMPNSSFSTLKIQPTDPGDSATYLCASSK
Bos taurus V132 trbv DAAA02011765.1 12570 PTDAGVTQTPRHEVTEKGQAVTLSCEPIKSHAALFWYRQTSVRGLELLIYFNNQAPIDESGMPKDRFSAKMHNASFSTLKIQPTDPGDSATYLCASSK
Bos taurus V133 trbv DAAA02011765.1 15058 YISAEVAQSPSHRVIEKKQAVNLSCDPISGHESLFWYYHAVGKEMKLLIYFLRESMQDDSGMPKGRFTAERMEGTSSMLRVHSAELGDSGVYFCASSR
Bos taurus V134 trbv DAAA02011765.1 17396 HVGAMVVQNPRYLVTGLGKPVTLSCSQNMKHDAMYWYQQKPSQAPKLLLYYYDKQITKEKNTSENFQSSRPNTSFCSLDIRSAGLGDSAVYLCASSR
Bos taurus V135 trbv DAAA02011765.1 22123 FLEAEVTQTPGHLVQGKGLEVKMYCVPKKGHIYVFWYQQILTKEFKFLISFQNDKVLDDKEMPKRFSAECPSNSPCSLKIQSTEPQDSALYFCASSD
Bos taurus V136 trbv DAAA02011765.1 35236 TVAGGVTQTPKYLLKKEGGAVTLECEQDFDYDSMYWYRQDPGLGLRQIFFSRVVNNVQKEDIAKGYSASREKKPFFPLTVTSAQKNQTALYLCAASR
Bos taurus V137 trbv DAAA02011765.1 38732 GSGLGALVSQQPRRAVSKSGASVTIECRALDFQASSMFWYRQFPKRGLVLMATSNEGTDATYEQGYNKDKFPISQPDRTFSSLMVTSVDPTDSGLYFCSAR
Bos taurus V138 trbv DAAA02011767.1 4757 SMDTEVTQSPGHLVKGKDQKAKMDCVPIKGHVHVYWYHKKPEGAFEFLVYLWNGKVTEDTAMFKQRFSAECPQNSPCSLEINSTEAADSALYFCASSQ
Bos taurus V139 trbv DAAA02011767.1 13540 FMDTEVTQNPSHLLKGKDQRAKMDCVPKKGHSYVYWYRRKLEEALEFLVYLQDEKIIEDTAMFKQRFSVECPQNSPCGLEINSTEAADSALYFCASSQ
Bos taurus V140 trbv DAAA02011767.1 16865 SMDTEVTQSPSHLVKGKGQKAKMDCVPIKGHINVYWYRRKLEEAFEFLVYFQEQDIVEGTEVFKERCSAECPQNSPCSLEINSTEAADSALYFCASSQ
Bos taurus V141 trbv DAAA02011770.1 581 SMDSEVTQSPGHLVKGKDQKAKMDCVPIKGHTSVYWYLKKLESFEFLVYLRNGKITEDTAMFKQRFSAECPQNSPCSLEINSTEAADSALYFCASSQ
Bos taurus V142 trbv DAAA02011776.1 4599 SVDTEVTQSPSHLVNGKDQKAKMDCVPIKGHSYVYWYHKKLEEALEFLVYFQKQDIVEDTAMFKQRFSAECPQNSPCSLEINSTEAADSALYFCASSQ
Bos taurus V143 trbv DAAA02011782.1 3245 SMDTEVTQIPSHLLKGKDQRAKMDCVPKKGHSYVYWYRRKLEEALEFLVYLQDEKIIEDTAMFKQRFSVECPQNSPCSLEINSTEAADSALYFCASSQ
Bos taurus V144 trbv DAAA02011785.1 9179 VRTQTIHQWPSTRVQPAGSPLSLECTVKGTSNPTLYWYRQEAGGSLQQLFYSVSAGQIEPREFQNFKASRPQDGQFTLSSKKLQLNNSGFYFCAWS
Bos taurus V145 trbv DAAA02011790.1 116 LVDSGVTQTPRYLIKARGQRGTLGCSPVSRHLSVSWYQQALGQSPEFLIQYYRQEVRGEAQLPDRFSGKQFSDFHSELNLSSLVLRDSAVYLCASSQ
Bos taurus V162 trbv DAAA02013395.1 821 AVHAGVTQDPRFQVVRRGQSTTLTCAQDLGHNYMYWYRQDLGHGLRLIHYSAGVRSSEPGDVLDRYSVSRSNTENFPLTLKSANRSQTSVYFCASSY
Bos taurus V234 trbv DAAA02023267.1 1783 SMDTEVTQSPSHLVKGKGQKAKMDCVPIKRHSYVHWYHKKLEEALEFLVYFQKQDIVEDTAMFKQRFSAECRQNSPCSLEINSTEAADSALYFCASSQ
Bos taurus V259 trbv DAAA02027316.1 347 LTGSVDTEVIQSPGHLVKGKGQKAKMDCVPIKGHINVYWYRKKPEGAFEFLAYLKNQDIVEDTEVFQQRFLAPWPQNSPCSLEINSTKAADSALYFCASSQ
Bos taurus V269 trdv DAAA02028054.1 26204 VSLDVILESETKTLTVLLGEPATFRCNVTGGNWKNYQMSWYKRNENNVLTLVYRLSNNSNENVRGGFKGKIDTSKNQYVLNIQKTTIKDVGTYYCGS
Bos taurus V270 trdv DAAA02028054.1 52891 VMSAVVLVPQDQEKTVVVGKSATLSCSMKGATFISKYYIFWYRKTPGNTMTFIYQEWGLYGPGFKDNFRGKIVNLTNQAVLEVLKASERDEGFYYCATD
Bos taurus V271 trdv DAAA02028055.1 1877 SNNVESADVPTVFKKEGESVTVECKFSVSYTYYMMYWYRQPSSGEMIYMINIYSQNKHSREGRYSVEFYKPNQMLKLTISALTLSDSAIYFCAVRE
Bos taurus V272 trdv DAAA02028056.1 12721 SNNVESADVPTVFKKEGESVTVECKFSVSYTYYMMYWYRQPSSGEMIYMINIHSQNKHSREGRYSVEFYKPNQMLKLTISALTLSDSAIYFCAVRE
Bos taurus V273 trav DAAA02028057.1 17550 VSGKNGVEQSPRYLSAQEGDLVTINCNYLEGMTTLHWLQQNPGGGIISLLILSLEMKRKGRVSATINSRERYSSLNITASQPTDSAIYFCAVE
Bos taurus V274 trdv DAAA02028064.1 4786 SSVAQRVTQDQPEIASQVGEVVTLSCQYETIQSRYNIYWYKQLPSGEIIYLIGQGSSSQNARYGRYSVNFQRSHKSISLTISEVQLEDSAKYFCALWE
Bos taurus V275 trav DAAA02028064.1 10833 VSSLLTVEQRPPLLWVQEGESTNFTCSFPSSSFYALHWYRWEPAKSLKNLFVISVNGDEKKQGRVRVTLNTKEGYSSMYIRGSQPEDSATYLCA
Bos taurus V276 trav DAAA02028065.1 1368 TVIDAKTTQPSSMDCAEGEDANLPCNHSIIGGKDYIHWYRQNPNQSPQYVIHGLRGTVNRSMASLTIASDRKSSTLVLPQVTLRDAAVYYCILRE
Bos taurus V277 trdv DAAA02028069.1 11142 SGVAQKVIQDQPDTSSQLGQSVTLNCRYATAWSYMFWYKLLPNGEMIYLIGQVFSGQNARNGRYSVNLQKASKSISLTISDLQLEDSADYFCALWE
Bos taurus V278 trav DAAA02028069.1 23108 VRGVDVEQSPPALTPQEGASSTLWCNFSTSSDSVRWYLQKPGGSHLIYTPLGTRQGGRLNATTVLKERRSSLHVSSLRTTDSGTYFCAVQHCTPQ
Bos taurus V279 trdv DAAA02028070.1 11824 SGVAQKVTQDQPAISTQVGQSVTLNCRYETSWSYYNLFWYKQLPSGQMTYLIQQYSEHGNARNGRYSVNFQKADKSISLIISSLQLEDSAKYFCALC
Bos taurus V280 trav DAAA02028070.1 19029 TVIDAKTTQPSSMDCAEGEDVNLPCNHSTICGNVYIHWYRQNPNQSPLYVIHGLRGTVNSSMASLTIASDRKSSTLVLPQVTLRDAAVYYCVLRE
Bos taurus V281 trdv DAAA02028070.1 28695 SGVAQTVIQDQPDTSSQLGQSVTLNCRYATTGSYYYSYYYYWYKLLPSGEMIYLIGQVSSGQNARNGRYSVNFQKARKSISLTISDLQLEDSAKYFCALWE
Bos taurus V282 trav DAAA02028070.1 40346 VRGVDVEQSPPALTPQEGASSTLWCNFSTSADSVWWYLQKPWGRHLIYIPSGTRQGGRLNATTVLKERRSSLHISFLRTTDSGTYFCAVQHCAPR
Bos taurus V283 trdv DAAA02028070.1 51803 SSVAQQVTQVQTAVSSQVGQTVTLNCRYEVSWTTGYYNIFWYKQLPRGEMTFLIRQYSEVGNARNGRYSVNFQKADKSISLIISSLQLEDSAKYFCALWE
Bos taurus V284 trav DAAA02028090.1 12166 VKSDDHVMQSPPSLIVHEGSNATLSCSYKVTNFQSLHWYKQEEKVPTFLFALISTGIEKKSGRLVGTLDRKELLSTLHITVTELGDSATYLCAVE
Bos taurus V285 trav DAAA02028090.1 19132 LRRADWIRSQESEVSGEEGKTVSLFCNYYTSSKSFISLLWYRQYPNQAPEYILYRQWGSSGKGYASFATERFYSDNTANTTNLYIKKVVPADTALYLCALE
Bos taurus V286 trav DAAA02028090.1 51639 PSVAQMVSQPQPEESVQEADTVTLDCTYSTRDTDYYLFWYKQPPSGQMVYIIHQYAFEQQNANNDRYSVNFQKEAKAFSLKISDSQLEDAAVYFCAYSG
Bos taurus V287 trav DAAA02028114.1 22483 QSRGDSVSQTDGQVTLLEGATLTVNCTYSATGYPTLLWYVQYPGEGPELLLKATKANDKETNKGFEAAYNTKTTSFHLEKAPVQESDSGVYYCALS
Bos taurus V289 trav DAAA02028114.1 36827 SIIAQKVTQDQPQVLGQEKEAVTLDCKYDTSDSRYSLFWYKQPSSGGMILLIRQDSSNQQNATEGRYSLNFQKARKSITLVISASQLEHSAVYFCALRE
Bos taurus V290 trav DAAA02028114.1 50140 VSGKNQVEQNPPSLVVLEGENCTFQCNYTVSPFKLRWYTQDTGRGLVSLITMTYSDNKKSNGQYTATVDATAKHSSLHLTAAQLSDPAFYLCVVG
Bos taurus V291 trav DAAA02028114.1 64717 VSSQQNTVEQSPVSLPVPEGATTSLSCTYSNSASQYFTWYRQYPGKGPEFLLQVYANNNKEEGKFAAQSNKTNKHVSLRIRDSEPSDSATYLCAV
Bos taurus V292 trav DAAA02028114.1 87651 GTNGDSVNQTEGPVTVSEGALLTLNCTYQTASSAPYLFWYIQHLNKAPQLLLKGSMSEQNPKSKGFEATLVKRDSSFHLQKQAVQASDSAVYHCALR
Bos taurus V293 trav DAAA02028114.1 99512 GTNGDSVNQTEGPVTVSEGALMTLNCTYQTADFAAYLFWYIQHLNKAPQLLLKGLTADKKVEHEGFEATLVKRDSSFHLQKKAVQASDSAVYYCALS
Bos taurus V294 trav DAAA02028114.1 118323 LSGEDQVEQSPQSLRTQEGDSLSLNCSYTASSFRGLRWYRQDPGKGPELLFLLHSVGDEKQKERLRATLLKKGSSLHIEAPKPEDSATYLCAVQ
Bos taurus V295 trav DAAA02028114.1 126640 VSSKQNVSQSPEALNVREGDSVVLNCSYTDSALFFLQWFRQDPGKGLTSLLSIQANQKEQASGRITVSLDKSSRHSTLYIATSQHSDSTTYLCAV
Bos taurus V296 trav DAAA02028114.1 132813 MNGQQIKHFPEFLLLQEGENFTTYCNSSSTFYSLQWYKQRPGGSPVLLMILAKRGEVKTQWRWTGQLGESKQHSFLRLTAAQLSDAGTYFCA
Bos taurus V297 trdv DAAA02028114.1 139128 SGVAQKVTQDQPDVSSQVGQSVTLNCLYETSWTTYDLYWYKQLPSGQMTYVIYQGSSATNAKEDRYSVNFKKADKSISLTISALQLEDSAKYFCALCE
Bos taurus V298 trav DAAA02028114.1 156655 MNGQQIKHFPEFLILQEGENFTTYCNSSSILRSFQWYKQSPGGSPVLLMILVKGGEVKTQRRWTGRLGESKQHSSLHLAAAQLSDAGTYFCM
Bos taurus V299 trdv DAAA02028114.1 163276 SGVAQKVTQDQSDVSSQVGQSVTLNCRYETNWDVYYLFWYKQLPSGQMTYVIRQGSLVTNAKEDRYSVNFKKADKSISLTISALQLEDSAKYFCALCE
Bos taurus V300 trav DAAA02028114.1 172713 TVINAKTTQPSCMDCAEGEDVNLPCNHSTIGGNEYIHWYQQNPNQNTQYVIHGLRGTVNSNMASLHIASDRKSSTLVLPQVTLRDTAVYYCILRE
Bos taurus V301 trdv DAAA02028114.1 189536 SSVAQKVTQYQPDTTSQVWNIVILNCRYETSWNVYIYWIFWYKQLPSREMTYLIHQYSENGNERDGHHSVNFQKAHKFISLTISPLKLEHSGKYFCALWE
Bos taurus V302 trdv DAAA02028129.1 2573 SGVAQKVIQDQPYITSQIGQSVILKCQYELSHSGYTHYFFWYKQLPSGEMTFLIRQESLGPNARNGRYFVNLQKAQNSISLTISALQLEDSAKYFCAVRE
Bos taurus V303 trav DAAA02028129.1 16661 TVVDAKTTQPNSMDCAEGENVNLPCNHSIIHGEDYIHWYRQNPSQSPQYVIHGLRGTVNNSMASLHIASDRKSSTLVLLQVTLRDTAVYYCTLRE
Bos taurus V304 trav DAAA02028129.1 19688 VRGVDVEQSPPALSLQEGASYTILCNFSISPQSVIWYLQNSGGCIIQLFYIPSGTKQDGRLNATTVPKEGRSSLHISSSQTTDSGTYFCAVQHSAPQ
Bos taurus V305 trdv DAAA02028129.1 26263 SGVAQNVTQDQPDINRQVGQSVTLNCQYEVSWNMISYYIFWYKQLPSGQMTYLIRQYSEDGNARDGRYSVNFQKADNSISLTISALQLEDTGKYFCALCE
Bos taurus V306 trav DAAA02028136.1 1372 GVRGVKVEQNPSVLSLQEGANSTLRCNFSDMVNNVQWFQQNPRGSLTRLFFIASGMKKNERMSSTVNSKERYSTLHITASKLEDAATYLCAVE
Bos taurus V307 trav DAAA02028136.1 26689 VSGKNQVEQSPPSLVVLEGENCTFQCNFTVSPFNNLRWYTQDTGRGLVSLITMTYSDNKKSNGRYTATVDATAKHSSLHITAAQLSDPAFYICVVG
Bos taurus V308 trav DAAA02028136.1 38691 VSSQQNTVEQSPASLPVPEGEAASLGCTYSDSASQYFIWYRQYPGKGPEFLLQVYANKDKEEGKFTAQSNKTSKHVSLRIRDSEPSDSATYLCAV
Bos taurus V309 trav DAAA02028138.1 5662 LSDEDQVEQSPQTLRIQEGDSLSLNCSYSSFRRLQWYRQDPGKGPELLFLLYSVGDEKQKKRLKATLLKKGSSMHIEAPKHEDSATYHCAVQTQCSP
Bos taurus V310 trav DAAA02028139.1 8266 NVCDAKTTQPSSMDYPEGEDVTLPCNHSTISGTEYIHWYRQNPSQSPQYIIHGFRDTVNSSMASLTIASDRKSSTLVLPQVTLRDTAVYYCVLKE
Bos taurus V311 trdv DAAA02028139.1 24630 SGVAQKVTQDQPDISSEAGEAVTLNCRYETSWSSYNTFWYKLFASGEMTFLIGQGSYSLNARDGCYSINFQKSRKAISLTISDLQLEDSAKYFCTLWE
Bos taurus V312 trav DAAA02028139.1 30848 VSRLLTVEQHPLLLWVQEGESTNFTCTFPSSSFYALHWYRWKPAKGPKNLIVISVNGDEKKQGRVRVTLNTKEGYSSMYLRRSQPEDSATYLCA
Bos taurus V313 trdv DAAA02028139.1 41319 SGVAQKVTQDQSDVSSQVGQSVTLNCRYETSWSYYYLYWYKQLPSGQMTYVIRQGSEVTNARKDRYSVNFKKADKSISLTISALKLEDSAKYFCALSD
Bos taurus V314 trdv DAAA02028143.1 5818 SGVAQKVTQDRPEISSQVGESATMNCQYESNWNSYNIFWYKQLPSGEMIYLIGQNSYSSNARDGRYSISFQRSRKAISLIISALNLEDSAKYFCALWE
Bos taurus V315 trav DAAA02028143.1 18101 INGQQIKHFPEFLLLQEGENFTTYCNSSSILSSLQWYKQRPGGTPVLLMILAKGGEVKMQQRLTDRLGETRQHSSLYLAAAQPSDAGTYFCA
Bos taurus V316 trdv DAAA02028143.1 24217 CGVAQKVTQDQPDISSQVGQSVTLNCQYETSWRYYYLFWYKQLPSGQMTYLIQQYSEYSNARNGRYSVNFQKADKSISLIISSLQLEDSAKYFCTLSE
Bos taurus V317 trav DAAA02028143.1 30980 TVINAKTTQPGSMDCAEGEDVNLPCNHSTIGGNDYIHWYRQNPNQTPQYVIHGLRGTVNSSMASLTVASDRKSSTLVLPQVTLRDTAVYYCVLRE
Bos taurus V318 trdv DAAA02028144.1 3890 SGVAQNVIQDQPNTSGHLGQSVTLNCRYGTTWSYYYMFWYKLLPNGEMIYLISQASSGQNARNGRYSVNFQKARKSISLTITDLQLEDSAEYFCALWE
Bos taurus V319 trav DAAA02028144.1 16031 VRGVDVEQSPPALTPQEGDSSTLWCIFSTLADSVRWYLQKPGGRLIHLIYIPSGTRQEGRLNVTAVPKERRSSLHISSLRTTDSGTYFCAVQHCATR
Bos taurus V320 trav DAAA02028151.1 2101 GVRGVKVEQSPSVLSLQEGANSTLRCNFSDTVNSVQWFQQNTRGSLTRLFFIASGTKKNERMSSTVNSKERYSTLHITASQLEDSATYLCVVE
Bos taurus V321 trav DAAA02028161.1 1973 GVRGVKVEQNPSVLSLQEGANSTLRCNFSDMVNNVQWFQQNPRGSLTRLFFIASGMKKNERMSSTVNSKERYSTLHITASQLEDAATYLCAVE
Bos taurus V322 trav DAAA02028161.1 6352 VSLGNEVEQSPSTLSVQEGNSSVITCTYTDTASDYFPWYKQEPGKGPQLLIAIRSNMGEKKDQGLTVLLNKTTKHLSLHIATIQPGDSAVYFCAAR
Bos taurus V323 trav DAAA02028161.1 10048 SIIAQKVTQDQPQVLGQEKEAVTLDCKYDTSDSRYSLVWYKQPSSGGMILLIRQDSSNQQNATEGRYSLNFQKARQSVTLVISASQLEDSAVYFCALRD
Bos taurus V324 trav DAAA02028161.1 24685 MSGKNQVEQSPPSLVVLEGENCTFQRNYTVSPFNLRWYTQDTGRGLVSLITMTYSDNKKSNGRYTATVDATAKHNSLHLTAAQLSNPAFYICVVG
Bos taurus V325 trav DAAA02028161.1 36030 VSSQQNTVEQSPASLPVPEGAAASLGCTYSDSNSLYFTWYRQYPGKGPEFLLQVYANNNKEEGKFTAQSNKTNKHVSLHIRDSEPSDSATYLCAV
Bos taurus V326 trav DAAA02028161.1 57020 GTNGDSVNQTEGPVTVSEGALLTLNCTYQTADFDPYIFWYIQHLNKAPQLLLKGSMSDQNPKSKGFQATLVKSDSSFHLQKQAVQASDSAVYYCALS
Bos taurus V327 trav DAAA02028248.1 7415 GTGAQLVTQPDGHINVSEGNHVELRCNYSYGGSIYLFWYVQYPNQGLQFLLKYLPGPTRVKGIKGFEADFKKDENSFHLMKASAHWSDSAKYFCALC
Bos taurus V328 trav DAAA02028251.1 3067 TVTDAKTTQPSSMDYPEGQDVTLSCNHSTIGRNEYICWYQQNPNQSPQYVVHGLRGTVIRSTASLTIASDRKSSTLVLPQVTLRDTAVYYCVPRE
Bos taurus V329 trdv DAAA02028251.1 14418 SSVAQRVAQDQPDISSQVGEVVTLRCQYETRLSSFRIFWYKQLPSGEMIYLIGQVSSSQKARDGRYTTDLQISRKSISLTISDLQLEDSAKYFCAVWE
Bos taurus V330 trav DAAA02028251.1 34102 VSSLLTVEQHPSLLWVQEGKSTNFTCSFPSSSFYALHWYRWEPAKTTKNLFVISVNGDEKKQGRVRVTLNTKEGYSSMYIRGSQPEDSATYLCA
Bos taurus V331 trav DAAA02028251.1 40926 MNGQQIKHFPEFLLLQEGENFTTYCNSSSFLSSSQWYKQRSGSSPVLLMILAKGGEVKTEQRLTGQLGETKQHSSLHLTAAQLSDAGTYFCT
Bos taurus V332 trdv DAAA02028251.1 46912 SGVAQKVTQDQPDISSQVGQSVTLNCRYETSSGVYYLFWYKQLPSGQMTYLIQQYSEHGNARNDRYSVNFQKADKSISLIISSLQLEDSAKYFCVLRE
Bos taurus V333 trav DAAA02028251.1 55582 TVIDAKTTQPGSMDCAEGEDVNLPCSHSTIGGEDYIHWYWQNPNQSPQYVIHGLRGTVSSSMASLHIASDRKSSTLVLPQVTLRDTTVYYCILRE
Bos taurus V334 trav DAAA02028253.1 4160 MNGQQIKHFREFLLLQEGENFTTYCNSSSTFYSLQWYKQRPGGSPVLLMILAKGGEVKTQRRWTGRLGESKQHSFLHLTAAQLSDAGTYFCAE
Bos taurus V335 trdv DAAA02028253.1 10493 SGVAQKVTQDQSDVSSQVGQSVTLNCRYETSWSAYYLYWYKQLPSGQMTYVIRQGSEVTNARKDRYSVNFKKADKSISLTISALQLEDSAKYFCALRD
Bos taurus V336 trav DAAA02028253.1 19114 TVINAKSTQPSSMDCAEGEDINLPCNHSTIGGDDYIHWYRQNPNQSPQYVIHGLRGTVNSSEASLTISSDRKSSTLVLPQVTLRDTAVYYCVLRE
Bos taurus V337 trav DAAA02028253.1 22125 VQGVDMEQSPPALSLQEGASYTLQCNFSTFPQSVSWYLQNPGGCIIHLFYIPSGTKKDGRLNATTVPKEGRSSLHISSSQTTDSGTYFCAVQHSAPQ
Bos taurus V338 trdv DAAA02028253.1 50686 SGVAQSVTQDQPDILSEVGKAVTLNCRYETSWYMLSYYIFWYKQLPSGQMTYLIRQYSDDGNARDGRYSVNFQKAQKSINLTISALELEDSAMYFCVLRA
Bos taurus V339 trdv DAAA02028254.1 16348 SGVAQKVIQDQPYITSQIGQSVILKCQYELSHSGYTHYFFWYKQLPSGEMTFLIRQESLGPNARNGRYSVNLQKAQNSISLTISALQLEDSAKYFCAVRE
Bos taurus V340 trav DAAA02028254.1 23492 VNGQQISQIPQFLPLQEGENFTTYCNSSSTVYRLQWYKQRPGGSPVLLMILAKDGEVKTEQRLTGRLGETRKHGSLHLVAAQLSDVGTYFCA
Bos taurus V341 trav DAAA02028254.1 36717 TVVDAKTTQPNSMDCAEGENVNLPCNHSTIRGDEYIHWYQQNHNQSPQYVIHGLRGTVNSSMASLTIASDRKSSTLVLPQVTLRDTAVYYCILRE
Bos taurus V342 trav DAAA02028254.1 39783 VQGVDVEQSPPALSLQEGASYTLQCNFSTSSQSVIWYLQNSGGHLIQLFYIPSGTKQDGRLMATTVPKERHSSLHISSSQTTDSGTYFCAVQHSAPQ
Bos taurus V343 trav DAAA02028256.1 11277 RTNGDSVNQTEGPVTVSEGALLTLNCTYQTTYSDPYVFWYVQHLNKAPQLLLKGWMKDQSPVHEGFQATLVKSDSSFHLQKQAVQASDSAVYYCALS
Bos taurus V344 trav DAAA02028259.1 2871 VNSQQGEQNLQTLSIQEDENVTMNCSHKSITLTALQWYRQDSRRGFVHLILMHSNERQKHSGRLHFTLDNSIKSSSLSIMASQAEDTATYLCAP
Bos taurus V345 trav DAAA02028259.1 14216 GTRGDSVTQTEGVVTLPEKASLTLKCTYQSSYSGFLFWYVQYQNRELEMLLQSSLGNQKVTNRGFEATHISRDSSFHLQKSSVQTSDSALYYCALS
Bos taurus V346 trav DAAA02028259.1 19693 STNGDSVNQTEGPVTVSEGALMTLNCTYQATYSNSYLFWYIQHLNKAPQLLLKGLTADKKVEHEGFQATPVKRDSSFHLQKRAVQASDSAVYYCALS
Bos taurus V347 trav DAAA02028259.1 25270 GTNGDLVNQTEGPVTVSEGALLTLNCTYQTTYSDLYVFWYVQHLNKAPQLLLKGSMRDQKPKSEGFQATLVRTDSSFHLQKQAVQASDSAVYYCALS
Bos taurus V348 trdv DAAA02028265.1 17564 SSVAQIVTQDQPYISSPVGEIVTLSCRYETTQSSYNIFWYKQLPSGEIIYLIGLGSSRQNARYGRYSVNFKTSRKSISLTISDLELEDSAKYFCALWE
Bos taurus V349 trdv DAAA02028265.1 30213 SGVAQKVTQDQPEISSQVGKSATMNCQYETSWNSYNIFWYKQLPSGEMIYLIGQNSYSPNARDGRYSINFQKSHKAISLIISALKLEDSAKYFCALWE
Bos taurus V350 trav DAAA02028278.1 4168 VSLGNKVEQSPTLSVQEGNSTFITCTYTDGNSDYFPWYKQEPGKGPQLLIAIHSNKAKEEDQRLTVLLNKTAKHLSLHIANTEAGDSAVYFCAAS
Bos taurus V351 trdv DAAA02028285.1 15120 SGVAQSVTQDQPDILSEVGKAVTLNCRYETSWDMFHYYIFWYTQLPSGQMTYLIRQYSDAGNARDGRYSVNFQKAQKSISLTISALELEDSAMYFCVLR
Bos taurus V352 trav DAAA02028285.1 40228 TVTDAKNAQPSSMDYPEGQDVTLSCNHSTIGRNEYIYWYQQNPNQSPQYVIHGLRGTVNSSTASLTIASDRKSSTLVLPQGTLRDTAVYYCVLRE
Bos taurus V353 trav DAAA02028291.1 1531 TVINAKTTQPSSMDCAEGEDVNLPCNHSTIGGNDYIHWYWQNPNQSPQYVIHGLRGTVNSSMASLHIASDRKSSTLVLPQVTLRDAAVYYCVLRE
Bos taurus V354 trav DAAA02028302.1 14088 QTHGNSVTQMDGHVSRSEGTSVTINCTYSTSGYPNLFWYVQYPGEGPQLLLKAMNANDKGTNKGFEATYNTETTSFHLEKASVQESDSAVYYCALR
Bos taurus V355 trav DAAA02028302.1 18742 VSFGNKVEQSPTLSVQEGNSSVITCTYTDGNSAYFPWYKQEPGKGPQFLIAIRSNKGKEEDQRLTVLLNKTTKRLSLHITTTEAGDSAVYFCAAS
Bos taurus V356 trdv DAAA02028304.1 1315 SGVAQNVIQDQPDTSGQLGQSVTLNCRYGTIWSYMFWYKLLPNGEMIYLISQASSGQNARNGRYSVNFQKARKSISLTISDLQLEDSAEYFCALWE
Bos taurus V357 trav DAAA02028306.1 1692 VNGQQISQIPQFLPLQEGENFTTYCNSSSTFYRLQWYKQSPGGIPVFLMILAKDGDVKTQQRLTGRFGETRKHGSLHLAAAQLSDAGTYFCAE
Bos taurus V358 trav DAAA02028306.1 15362 TVVDAKTTQPNSMDCAEGENVNLPCNHSTIGGEDYIHWYRQNPSQSPQYVIHGLRGTVNSSMASLHIASDRKSSTLVLPQVTLRDTAVYYCTLRE
Bos taurus V359 trav DAAA02028306.1 18384 VRGVDVEQSPPALSLQEGASYTILCNFSTSPQSVIWYLQNSGGHIIQLFYIPSGTKQDGRLTATTVPTERRSSLHISSSQTTDSGTYFCAVQHSAPQ
Bos taurus V360 trav DAAA02028307.1 5748 GLRAQSVTQPEAEVRVAEGDPVTVKCTYSVSRSPYLFWYVQHHNLGLQFLLKYIGGDTLVKGNYGFEAEFNKSQTSFHLKKPSVLGSDSALYFCAVS
Bos taurus V361 trav DAAA02028307.1 27730 GLRAQSVTQPEAEVCVAERDPVTVKCTYSVSWSPYLFWYVQHRNQGLQFVLKYIGGDRLVKGNYGFEAEFNKSQTSFHLKKPSVLGSDSALYFCAVS
Bos taurus V362 trav DAAA02028307.1 55260 GLRAQSVTQPEAEVPVAEGDPVTVKCTYSVSGSPYLFWYVQHRNLGLQFLLKYISGDTLVKGNYGFEAEFNKSQTSFHLKKPSVVGSDSALYFCAVR
Bos taurus V363 trav DAAA02028307.1 79020 GLRAQSVTQPEAEVPVAEGDPVTVKCTYSVSGSPYLFWYVQHRNQGLQFLLKYIGGDRLVKGNYGFEAEFNKSQTSFHLKKPSVLGSDSALYFCAVS
Bos taurus V364 trav DAAA02028307.1 106855 GTNGDSVNQTEGPVTLSEGALLTLNCTYQTTYSDSYHFWYVHHLNKAPQLLLKGSMTNQRPEHEGFQATLVNSDSSFHLQKWAVQASDSAVYYCALN
Bos taurus V365 trav DAAA02028307.1 109048 SLMAQKVTQNQSEISVLEKEDVTLNCAYEANSYTYYLFWYKQPSSGEMIFLIHQESYNELNTTKGQYFLDFHKATSSISLTISDSQLEDSAVYFCALR
Bos taurus V366 trav DAAA02028307.1 117322 LSGEDQVEQSPQTLRIQEGDSLSLNCSYSSFRGLQWYRQDLGKGPELLFLLYSVGDEKQKERLRATLLKKGSSLHIEAPKPEDSATYLCAVQTQCSP
Bos taurus V367 trav DAAA02028307.1 133848 GAGAQSVTQPDDHITVSEGARLELKCNHSSSVSLSLFWYVQYPNQGLQLLLKYVSGDNLVSGIKGFEAEFRNSEMSFHLRKIPAHWKDSAKYFCALS
Bos taurus V368 trav DAAA02028307.1 138258 VRGMDVAQSPPALSLQEGASSTLRCNFSTFADSMQWYLQNPGGRLIHLFYVPSGTKRDGRLNATTVPTERHSSLHISSSQTTDSGTYFCAVQHSAPQ
Bos taurus V369 trdv DAAA02028307.1 153688 SGVAQKVTQDQPYVTSQIGQSVILNCWYEVSWSGYTHYLYWYKQLPSEEMTFLIRQESSGPNARNGRYSVNFQKAQNSISLTISALQLEDSAKYFCAVWE
Bos taurus V371 trav DAAA02028308.1 84761 GLRAQSVTQPEAEVPVAEGDPVTVKCTYSVSGSPYLFWYAQYRNQSLQFLLKYIGGDSLVKGNYGFEAEFNKSQTSFHLKKPSVQGSDSALYFCAVR
Bos taurus V372 trav DAAA02028308.1 101932 GLRAQSVTQPEAEVSVAEGDPVTVKCTYTVSGSPYLFWYVQHRNQSLQFLLKYIGGDSLVKGNYGFEAEFNKSQTSFHLKKPSVVGSDSTLYFCAVS
Bos taurus V373 trav DAAA02028308.1 123909 GLRAQSVTQPEAEVPVSEGDPVTVKCTYSVSGSPYLFWYVQHHNQGLQFLLKYIGGDSLVKGNYGFEAECNKSQTSFHLKKPSVVGSDSALYFCAVR
Bos taurus V378 trav DAAA02029076.1 10196 QTHGNSVTQMDGQVSRSEGTSVTINCTYSISGYPNLFWYVQYLGEGPELLLKAMKANDKGTNKGFEATYNTETTSFHLEKASVQESDSAVYYCALS
Bos taurus V379 trav DAAA02029076.1 14583 VSLGNKVEQSPTLSVQEGNSSVITCTYTDGNSEYFPWYKQESGKGLQFLIGIYSNKAKEEDQRLTVLLNKTAKHLSLHIATTEAGDSAVYFCAAS
Bos taurus V405 igkv DAAA02031102.1 92714 SSGDIVLTQTPLSLSVFPGETASISCRTSQSLEDSYGDTYLSWHLQKPSQSPQLLIYLVSNRASGVPDRFTGSGSGTDFTFKISRVEAEDAGVYYCQQSIQ
Bos taurus V406 igkv DAAA02031102.1 137481 SSGDVVLTQTPLSLSVIPGETVSISCKSTQSLKYSGKTYLRWLQHKPGQSPQSLIYQVSNRYTGVPDRFTGSGSETDFTLTISSVQAEDAGVYYCVQE
Bos taurus V407 igkv DAAA02031102.1 155780 SSGDVVLTQTPLSLSVIPGETVSISCKSTQSLKYSDGKTYLRWVQHKPGQSPQGVIYQVSNRNTGVPDRFTGSGSETDFTLTISSVQAEDAGVYYCFQGTYEP
Bos taurus V408 igkv DAAA02031102.1 189181 SSGDVVLTQTPLSLSVIPGETVTISCKSTQSLKYSDGKTYLQWFQHKPGQSPRLLIYQISNRYTGVPDRFTGSGSETDFTLTISSVQAEDAGVYYCLQRSYAP
Bos taurus V409 igkv DAAA02031102.1 195572 SIGATMQTQTLRSLSVIPGEMASISCRASQSVQNRYGDNFLHWYVQKPSQSPQLLIYRASNWESWVPDRFTSSGLGTHFILIISRVESEDAGVYYCQQSLQ
Bos taurus V410 igkv DAAA02031102.1 206373 SSGDVVLTQTPLSLSIIPGEMASISCKSSQSLVHSDGKTYLNWIQYKPGQSPQGLIYQVSNRYSGVSDRFTGSGSGTDFTLTISRVQAEDAGVYYCYQGTEDP
Bos taurus V411 igkv DAAA02031102.1 221793 ARCDIQVTQSPSYLSASLGDRVSITCQANQSVSHYLNWYQQKPGEAPKLLIYYATSRYTRVPSRFSGSGSGTDFTLTISSLEADDAANYYCQQDYS
Bos taurus V490 trbv DAAA02041920.1 2252 SMDNEVTQSPSHLVKGKGQKAKMDCVPIKGHINVYWYRRKLEEAFEFLVYFQEQDIVEGTEVFKERCSAECHQNSPCSLEINSTEAVDSALYFCASSQ
Bos taurus V491 trbv DAAA02041920.1 10488 TVAGGVTQTPKYLLKKEGGAVTLECEQDFDYDSMYWYRQDPGLGLRRIFSSRVVNTVQKEDIAKGYSASREKKPFFPLTVTSAQKNQTALYLCAASR
Bos taurus V492 trbv DAAA02041920.1 13997 GSGLGALVSQQPHRAVSKSGASVTIECRALDFQATAVFWYRQFPKRGLVLMATSNVGSDATYEQGYNKDKIPISHPDQTFSSLTVTRVDPADSSLYFCGAR
Bos taurus V519 iglv DAAA02045652.1 53416 SLSQPVLTQPVTVSASLGASARLSCTLSSGYNVSNYSIYWYQQKAGNPLRYLLRFKSDSDKHQGSGVPSRFSGSKDASTNAGLLLISGLQPEDEADYYCAVWHG
Bos taurus V520 iglv DAAA02045652.1 56426 SWAQAVLTQLPSVFRTLGQRVTISCTGSSNNIGGYYVSWYQQLPGKAPRLLTYEISKRPPGVPDRVSGSKSGNSASLTSSVHAEDDTDYYCFSWADGLKV
Bos taurus V521 iglv DAAA02045652.1 59854 SWAQAVLTQPPSVSGSLGQRVTISCTGSSSNIGGGNYVGWYQQIPGSAPKTLIYRSTSRPSGVPDRFSGSRSGNTATLTISSLQAEDEADYYCATYESSSYH
Bos taurus V522 iglv DAAA02045652.1 71444 SWAQAVLTQPSSVSGSLGQRVSITCSGSSSNIGSYNVGWYQQVPGSGLRTIIYGSSSRPSGVPDRFSGSKSGNTATLTISSLQAEDEADYFCVAYDSSSSI
Bos taurus V523 iglv DAAA02045657.1 551 SWAQAVLTQPSSVSGSLGQRVSITCSGSSSNVGTGNYVGWFQQIPGSAPRTLIYGATSRASGVPDRFSGSRSGNTATLTISSLQAEDEADYFCASYQSG
Bos taurus V524 iglv DAAA02045657.1 13262 SWAQAVLTQPSSVSGSLGQRVSITCTGSSSNVGNGYVSWFQQIPGSAPRTLIYGDTSRASGVPDRFSGSRSGNTATLTISSLQAEDEADYFCAAGDSSSSN
Bos taurus V525 iglv DAAA02045659.1 42 SWAQAVLTQPSSVSGSLGQRVSITCSGSSSNVGTGNYVSWFQQIPGSAPRTLIYGATSRASGVPDRFSGSRSGNTATLTISSLQAEDEADYFCASYQSG
Bos taurus V526 iglv DAAA02045667.1 3217 SWAQAVLTQPSSVSGSLGQRVSITCSGSSSNVGYGNYVSWFQQIPGSAPRMLIYGATSRASGVPDRFSGSRSGNTATLTISSLQAEDEADYFCASPDSSSSG
Bos taurus V527 iglv DAAA02045669.1 3849 SWAQDVLTQPSSVSGSLGQKVSITCSGSSSNVGYANYVSWHQQKPGSAPRTLIYGATSRASGVPDQFSGSKSGNTATLTISSLQPEDEADYYCSSYDSSSNI
Bos taurus V528 iglv DAAA02045669.1 22016 SWAQAVLTQPPSVSGSLGQTVTISCTGSSNNIGILGVSWYQQIPGSAPRTLIYNSNKRPSGVPDRFSGTKSGNTGTLTIASLQAEDEADYYCASADLSLTS
Bos taurus V529 iglv DAAA02045669.1 108706 SWAQSGLTQPSSVSGNLGQTVITSCAGTSSYVGSYNGVGWYQQLPGSAPKTLIYNVSKRPSGIPDRFSGSKSGNTATLTVSGLQAEDEADYYCSSYKSGGS
Bos taurus V530 iglv DAAA02045675.1 3653 SWAQSGLTQPSSVSGNLGQTVTISCAGTSSDVGAYNGVGWYQQLPGSAPKTLIYNLNKRSSGIPARFSGSKSGNTATLTISGLQAEDEADYYCSSYKSGGS
Bos taurus V531 iglv DAAA02045675.1 14484 HLASSQLTQPPAVSVSLGQTASITCQGDDLESYYAHWYQQKPSQAPVLVIYESSERPSGIPDRFSGSSSGNTATLTISGAQTEDEADYYCQSYDSSGD
Bos taurus V532 iglv DAAA02045675.1 20890 SVVSYELTQPTSVSVALGQTAKITCSGDLLDEQYTQWYQQKPGQGPVRVIYKDSERPSGISDRFSGSSSGKTATLTISGAQTEDEADYYCQSADSSDN
Bos taurus V533 iglv DAAA02045676.1 9917 SVVSYELTQLTSVSVALGQTAKITCSGELLDEQYTQWYQQKPGQAPKLVIYKDSKRRSGIPDQFSGSSSGKTAILTISGVRAEDEADYYCLSWDSGSYN
Bos taurus V534 iglv DAAA02045676.1 14623 HLASSQLTQPPAVSVSLGQTASITCQGDDLELLSAHWYQQKPGQAPVLVIYADDNLASGIPDRFSGSKSDTTATLTIRGAQAEDEADYYCQSADISG
Bos taurus V535 iglv DAAA02045676.1 18694 AVSSYELTQSPPASMSPGQTARITCGGPSVGGENVEWHQQKPGQARALVTYGDDNRPTGVPDQFSGANSGNMATLTISGARAKDEADYYCQLWDSSSNN
Bos taurus V536 iglv DAAA02045825.1 3168 SWAQAGLTQPASVFRTLGQRVTISCTGSSNNIGGYYVSWYQQLPGKAPRLLTYEISKRPPGVPDRFSGSKSGNSASLTSSVHAEDDTDYYCFSWADGLKV
Bos taurus V537 iglv DAAA02045825.1 6574 SWAQAVLTQPPSVSGSLGQRVTISCTGSSSNIGGGNCVGWYQQIPGSAPKTLIYRSTSRPSGVPDRFSGSRSGNTATLTISSLQAEDEADYYCATYESSSYH
Bos taurus V589 ighv DAAA02051733.1 8628 VLSQVQLQESGPSLVKTSQTLSLTCTASGLSLTRYGIHWVRQAPGKALEWLGDISSGGSTGYNPGLKSRLSITKDNSKSQVSLSLSSLTPEDSATYYCAR
Bos taurus V596 ighv DAAA02053398.1 11455 VLSQVQLRESGPSLVKPSQTLSLTCTVSGFSLSDNSVGWVRQAPGKALEWLGVIYSGGSTGYNPALKSRLSITKDNSKSQVSLSLSSVTTEDTATYYCAR
Bos taurus V597 ighv DAAA02053402.1 5189 VLSQVQLRESGPSLVKPSQTLSLTCTVSGFSLSSNGVGWVRQAPGKALEWVGGIDNDGDTYYNPALKSRLSITKDNSKSQVSLSVSSVTPEDTATYYCAK
Bos taurus V685 ighv DAAA02066681.1 1713 VLSQVQLRESGPSLVKPSQTLSLTCTISGFSLSSYAVGWVRQAPGKALEWVGGISSGGSTCLNPALKSRLSITKDNSKSQVSLSVSSVTTEDTATYYCAK
Bos taurus V794 trgv DAAA02010628.1 5244 IQQEIRVFQRSVMVGHAGGAITLPCQISRSVDYVHWFRQLEGQAPERLLYLALSKRDVQWDSVLRGDKVNAARGADGKSYTMSLRKLAKSDEGLYYCATWGS
Bos taurus V802 trgv DAAA02011303.1 68865 MQVSSNMEEDKLSVMRATGSSVVMDCDLTGSYIHWYKFQDGAVPRRLLHYIVSNSKVVLDSGISEGKYHVYKGTGKSYTFVISNLQESDSGTYYCAVWE
Bos taurus V803 trgv DAAA02011303.1 58666 TQVSSNMEEDKLSVMRATGSSIVIDCDLTGSYIHWYKFQEGAVPRRLLYYDVSNSKAVLDSGISEGKYHAYKGTGKSYTFVISNLQESDSGTYYCAVWE
Bos taurus V804 trgv DAAA02011303.1 52929 TQVSSNMEEDKLSVMRATGSSVVIDCDLTGSYIHWYKFQEGAVPRRLLYYDVYYSKVELDSGISERKYRVYKGKILISNLQESDSGTYYCAVWE
Bos taurus V805 trgv DAAA02011303.1 38821 TQVSSNTEGEKMSITKATGSGSSVEIICDLITQTLKYIHWYKYQEGTAPRRLLYYDISYSKVVLESGVSEGKYKVYKEKSYTFAILNLQESDSGMYYCAAWE
Bos taurus V810 trbv DAAA02011757.1 5511 LVDSGVTQTPKYLIKSRKQQATLRCSPNSGHSSVNWYQQALGQGPQFLVQCYRGQVSRGENMPDRFSAKQFSDLRSELNLSSLELTDSAVYLCASSQ
Bos taurus V811 trbv DAAA02011766.1 18696 SMDPEVIQSPGHLLTGKGQKAKMNCVPIRGHINVYWYRKKPEGAFEFLAYLKNQDIVEDTEVFQQLFLAPWPQNSPCSLEFNSTKAADSALYFCASSQ
Bos taurus V812 trbv DAAA02011766.1 11757 TVAGGVTQTPKYLLKKEGGAVTLECEQDFDYDSMYWYQQDPGLGLRQIFFSRVVNNVQKEDIAKGYSASREKKPFFPLTVTSAQKNQTALYLCAASR
Bos taurus V813 trbv DAAA02011766.1 8255 GSGLGALVSQQPRRAVSKSGASVTIECRALDFQATTVFWYRQFLKRGLVLMATSNEGTDATYEQGYTKDKFPISHPDLTFSSLTVTRVDPADSSLYFCGAR
Bos taurus V815 trbv DAAA02011773.1 60640 TVAGGVTQTPKYLLKKEGGAVTLECEQDFDYDSMYWYRQDPGLGLRLIFFSRVVNNVQKEDIAKGYSASREKKPFFPLTMTSAQKNQTALYLCAASR
Bos taurus V816 trbv DAAA02011773.1 57139 GSGLGALVSQQPRRAFSKSGASVTIECRALDFQASSMFWYRQFPKRGLVLMATSNVGTNATYEQGYTKDKFPISHPDLTFSSLTVTRVDPADSSLYFCGAR
Bos taurus V817 trbv DAAA02011773.1 50074 SMDTDVTQSPSHLVKGKSRKAKMDCVPIRGHSYVYWFRKKLEETLEFLVYFQKQDIVEDTAMFKQRFSAECRQNSPCSLEINSTEAADSALYFCASSQ
Bos taurus V818 trbv DAAA02011773.1 43363 LTGSVDTEVIQSPGHLVKGKGQKAKMDCVPIKGHINVYWYRKKPEGAFEFLAYLKNQDIVEDTEVFQQRFLAPWPQNSPCSLEINSTKAADSALYFCASSQ
Bos taurus V819 trbv DAAA02011773.1 38160 SMDTEVTQSPSHLVKGKGQKAKMDCVPIKGHINVYWYRRKLEEAFEFLVYFQKQDIVKGTEVFKERFSAECPQNSPCSLEINSTEAADSALYFCASSQ
Bos taurus V820 trbv DAAA02011773.1 27733 GSGLGALVSQQPRRAVSKSGASVTIECRALDFQASTVFWYRQFPKRGLVLMATSNAGSDATYEQGYNKDKIPISHPDRTFSSLMVPRVDPADSSLYFCGAR
Bos taurus V821 trbv DAAA02011778.1 26335 SVDTEVIQSPGHLVKGKGQKAKMDCVPIKGHINVYWYRKKPEGAFEFLAYLKNRDIVEDTEVFQQLFLAPWPQNSPCSLEINSTEAADSALYFCASSQ
Bos taurus V822 trbv DAAA02011778.1 21548 SMDTEVIQSPGHLVKGRGQKAKMDCVPIKGHINVYWYRRKLEEALEFLVYFQKQDIVEGTEVFKERFSAECRQNSPCSLEINSTKAADAALYFCASSQ
Bos taurus V823 trbv DAAA02011778.1 12507 SMDTEVTQSPSHLIKGKDQRAKMDCVPKEGHAYVYWYRKKLEEAFEFLVYFQNQDMMENTALFKQRFSAECPQNSPCSLEINSTEAADAALYFCASSQ
Bos taurus V824 trbv DAAA02011778.1 7724 PMDAEIYQIRFLLAEAGQDVTLECKQHLGYSAMYWYRQDPGQGLKLIYYSTVVKDIQRGDLSEGYSVSREKQELFPLTVKSAHTNQTAVYLCSG
Bos taurus V825 trbv DAAA02011779.1 10026 SMDTGVTQTPRNRIANTGKSTVLECSQTKGHESMYWYRQDPGRGLRLIYFSYGIDDINKGDVSDGYNVSRKEEAKFSLYLEPATPNQTAIYFCASNI
Bos taurus V826 trbv DAAA02011779.1 4260 FSDADIYQTPRYCVIGMGKKITLECSQTMGLDNMYWYQQDPGMELQLIHYSYGVNTTEKGERSSRSTVSRLSKEHFPLTLETANSSQTSSYFCASGD
Bos taurus V827 trbv DAAA02011779.1 2551 LKDAAVTQFPRRRILETEKEFTLQCSQKMNHYAMYWYRQDPGFGLRLIYYSTGPDSFKKGDVPEGYHVSRDELEHFPLTLKSASPNQTSVYFCASAE
Bos taurus V828 trbv DAAA02011780.1 341 PLEADVTQSPRHRITETRTRVTLTCSQNMNHDAMYWYRQDPGLGPKLIYFSRNVGFIENGDIPDGYTASREEKPNFPLTLELASTNQTSLYLCASSE
Bos taurus V829 trbv DAAA02011781.1 20576 LVDAQVTQTPRYLVKRRGEKVVIECIQNMDHERMFWYRQDPALGLRLLHFSIDAGTVEEGDVPHGYSVSRKKKESFPLTLASATTNQTSMYLCASSE
Bos taurus V830 trbv DAAA02011781.1 11867 SVFGALVSQKPSRAIRQRGTSMMIECQVDSQVNFMYWYRQLPGQSLVLMATANQGSKATYESGFTDSKFPIDRPKLEFSTLTVSNASSEDSSSYFCSAG
Bos taurus V831 trbv DAAA02011781.1 9381 SVFGALVSQKPSRAIRQRGTSVMIECRQVDSQLAMMYWYRQLPGQNLVLMATANQGSKATYESGFTDSKFPIDRPKVEFSTLTVNNASSEDSSSYFCSAG
Bos taurus V832 trbv DAAA02011781.1 6907 SVFGALVSQKPSRAIRQRGTSVMIECRQVDSQLTAMYWYRQLPGQSLVLMATANQGSKATYESGFTDNKFPISRPVLAFSTLTVSNASSEDSSSYFCSAG
Bos taurus V833 trbv DAAA02011781.1 4434 SVFGALLSQEPSRAIRQRGTSMTIECQVDSQLTWMYWYRQLPGQSLVLMATANQGSKATYESGFTEDKFPIDRPKLEFSTLTVSNASSEDSSSYFCSAG
Bos taurus V884 ighv DAAA02019443.1 7492 VLSKVQLQESGPSLVKPSQTLSLTCTTSGFSLTSYGVSWVRQAPGKALEWLGGIDSGGSTGYNPGLKSRLSITRDNSKSQVSLSVSSVTPEDTATYYCAK
Bos taurus V885 ighv DAAA02019444.1 4760 VLSQVQLRESGPSLVKPSQTLSLTCTVSGFSLSSNGVVWVRQAPGKALEWLGGICSGGSTSFNPALKSRLSITKDNSKSQVSLSVSSVTPEDTATYYCAR
Bos taurus V910 trbv DAAA02026089.1 1316 LVDSGVTQTPRYLIKARGQRGTLGCSPVSGHLSVSWYQQALGQSPEFLIQYYRQEVRGEAQLPDRFSGKQFSDFHSELNLSSLELTDSAVYLCASSQ
Bos taurus V915 trdv DAAA02026655.1 1486 SGMAQNVIQDQPNTSGQLGQSVTLNCRYGTAWSYYYMFWYKLLPNGEMIYLISQVFSGQNARNGRYSVNLQKASKSISLTISDLQLEDSAEYFCALWE
Bos taurus V924 trdv DAAA02028053.1 108038 KGVLCNQVTQSSPEQRVASGSEVTLLCTFQTTYSDPDLYWYRKRPDGVFQFVLYRDNTRSYDADFARGRFTVLHSMSQKTFHLVISSVRPEDTATYYCALRL
Bos taurus V925 trav DAAA02028060.1 5688 PSVAQTVTQPQPQESVQETGTVTLDCTYSTRDTDYLFWYKQPPSGEMVFIIRQNAYEQQNATNDRYSVNFQKEAKAFSLKISDSQLEDAAVYFCAYSG
Bos taurus V926 trav DAAA02028062.1 12656 KSTQQLEQNPQFLHIQEGGNVTMHCNSSGTFTFFQWYREKPEQGPVLLMTLTKPKEVKEKKRIRAQFGEAKKDSSLLITAAQPGDAGTYLCAG
Bos taurus V927 trav DAAA02028062.1 2763 LRVQMKVEQSPGVLTLQEGRNSSLICNYSTSIRGVQWFQQNPDGRLISLFYIASGMQQKGRLKSTINSKERYSQLYIRDSQPGDSATYFCAVE
Bos taurus V928 trav DAAA02028063.1 5412 IMVDAEITQLSSMDCAEGEDVNLPCNHSTIDPLDYIHWYQQNPNQSPQYVIHGLRDTVNSSMASLNIASDRTSSTLVLPQVTLRDTTLYYCILKG
Bos taurus V929 trdv DAAA02028067.1 22893 FIMAQKVTQNQSEISVLEQEYVALNCAYEANSYTYYLFWYKQPPSGEIIFLIHQDSYNELNTTKDQYFLNFQKATSSISLTISDSQLEDSTVYFCVLR
Bos taurus V930 trav DAAA02028067.1 13759 MNGQQIKHFPEFLLLQEGENFTTYCNSSSILSSLQWYKQSPGGSPVVLMILAKGGEVKTEQRLTGQFGETKQHSSLHLTAAQLSDAGTYFCA
Bos taurus V931 trdv DAAA02028067.1 7429 SGVAQKVTQDQSDVSSQVGQSVTLNCRYETSLSTYRLYWYKQLPSGQMTYVIRQGSEATNARKDRYSVNFKKADKSISLTISALQLEDSAKYFCALHD
Bos taurus V932 trdv DAAA02028068.1 12663 SSVAQQVTQVQTAISSQVGQTVTLNCRYEVSWTTDYYYIFWYKQLPRGEMTLLIRQYSEVGNARNGRYSVNFQKADKSISLIISALQLEDSAKYFCALWE
Bos taurus V933 trav DAAA02028071.1 4138 RTNGDSVNQTEGPVTVSEGALLTLNCTYQTASLVPYLFWYVQHLNKAPKLLLKGLTADKKVEHEGFQATLVKSDSSFHLQKQAVQASDSAVYYCALS
Bos taurus V935 trav DAAA02028074.1 9377 VTAVDVEQSPPALTPQEGDSSTLWCTFSTLADSVRWYLQKPRGHLIHLIYVPSGTRQEGRLNATTVLKERRSSLHISSLRTTDSGTYFCAVQHCAPQ
Bos taurus V936 trdv DAAA02028075.1 2054 SGMAQTVIQDQPDISSQLGQSVTLNCRYATTWSSYHYMFWYKLLPNGEMIYLIGHSGQNERHGRYSVNFQKARKSISLTISDLQLEDSAKYFCALWE
Bos taurus V937 trdv DAAA02028085.1 22382 SGVSQKVTQGQSNVSSQVGKSVTLNCRYETSWGTYYLYWYKQLPSGQMTYVIRQGSLVTNAKKDRYSVNFKKADKSISLTISALQLEDSAKYFCALRD
Bos taurus V938 trdv DAAA02028085.1 2223 SGVAQKVTQDQSDVSSQVGQSVTLNCRYETNWNAYYLFWYKQLPSGQMTYVIRQGSLVTNAKKDRYSVNFKKADKSISLTISALQLQDSAKYFCALCE
Bos taurus V939 trav DAAA02028087.1 3766 NVFDAKTTQPSSMDYPEGEDVTLPCNHSTISGNEYIHWYRQSPSQSPEYVIHGIRGTVNSSTASLTISSDRKSSTLVLPQVTLRDTAVYYCVLRE
Bos taurus V940 trav DAAA02028089.1 57640 PSVAQTVTQPQPQESVQETGTVTLDCTYSTRDTGDYYLFWYKQPPSGEMVYIIHQYAFEQQNATNDHYSVNFQKEAKSFSLRISDSQLEDAAVYFCAYSG
Bos taurus V941 trav DAAA02028089.1 54759 PSVAQTVTQPQPQESVQETGTVTLDCTYSTSESGYYLFWYKQPPSGEMVFIIRQYAYEQQNATNDRYSVNFQKEAKSFSLRISDSQLEDAALYFCAYSG
Bos taurus V942 trav DAAA02028089.1 46688 PSVAQTVTQPQPQESVQETGTVTLDCTYSTSESGYYLFWYKQPPSGEMVFIIRQNAYEQQNATNDRYSVNFQKEAKSFSLKISDSQLEDAAMYFCAYSG
Bos taurus V943 trav DAAA02028089.1 34120 LNTELKVEQSPLSLITREGQTGINCDHSVTTSDTFLWYRQDQKSLESLFLLMSNRAVRKKGGLTASFDTKACRSPLHITASHPGLSATYFCAVD
Bos taurus V944 trdv DAAA02028089.1 18832 SGVAQKVTQDQPVIISQVGKVATLNCQYETSRNVHVYCIFWYKQLPSGEMTYLIRQYSEDGNERDGRYSVNFQKASKSISLTISFLKPEHSAKYFCALWE
Bos taurus V945 trav DAAA02028089.1 3258 VQGLDVEQSPPALSLQEGASHVLRCNFSASVNNVQWYLQNPSGHLIHLFNIPSGTKQNGRLNATTIPKERRSSLHISSSQTTDSGTYFCAVQHSAPQ
Bos taurus V946 trav DAAA02028101.1 14641 LRVQMKVEQSPGVLTLQEGRNSSLICNYSISMTSVQWFQQNPDGRLISLFYIASGMQQKGRLKSTINSKERYSQLYIRDSQPGDSATYFCAVE
Bos taurus V947 trdv DAAA02028101.1 5124 SSMADKVTEAQTTVTARERETVTIGCTYETSRTYYTLFWYRQFPGGRMEFLIHQDSNNANARRDRYSVNFQKGKKIISLTISSLYLADSAKYFCVLWE
Bos taurus V948 trav DAAA02028106.1 5721 GTGAQLVTQPDGHINVSEGNHVELRCNYSYGGSIYLFWYVQYPNQGLQFLLKYLSGPTRVKGIKGFEAEFKKDENSFHLMKASAHWSDSAKYFCALC
Bos taurus V949 trav DAAA02028107.1 19470 VSSLLTVEQRPPLLWVQEGDSTNFTCSFPSSSFYALHWYRWEPAKTPKNLFVISVNGDEKKQGRMRVTLNTKEGYSSMYIRGSQPEDSATYLCA
Bos taurus V950 trav DAAA02028107.1 12814 MNGQQIKHFPEFLLLQEGENFITYCNSSSTFYNLQWYKQRPGGSPVFLMILAKSGEVKTEQRLTGRFGETKQHSSLHLTAAQLLDAGTYFCM
Bos taurus V951 trav DAAA02028107.1 1828 TVINAKTTQPGSMDCAEGEDVTLPCNHSTIGGNEYIHWYRQNPNQSPQYVIHGLRGTVNSSMASLTIASDRKSSTLVLPQVTLRDTAVYYCILRE
Bos taurus V952 trav DAAA02028108.1 9900 TVTDAKTTQPSSMDYPEGQDVTLPCNHSTIGRNEYIYWYQQNPNQSPQYVIHGLRGTVNSSTASLTIASDRKSSTLVLPQVTLRDTAVYYCVLRE
Bos taurus V953 trdv DAAA02028110.1 9131 SGVAQSVTQDQPDIVSEVGKAVTLNCRYETSWDMFRYYIFWYKQIPSGQMTYLIRQYSDDGNARDGRYSVNFQKAHKSISLTISALELEDSAKYFCLLLD
Bos taurus V954 trav DAAA02028116.1 210773 LSGEDQVEQSPQILRIQEGDSLSLNCSYSSFRGLQWYRQDPGKGPELLFLLYSVGDEKQKERLRATLLKKGSSLHIEAPKPEDSATYLCAVQTQCSP
Bos taurus V955 trav DAAA02028116.1 202748 VSSKQDVSQSPEVLNVREGDSMVLNCSYTDSALYFLQWFRQDPGKGLTSLLSVQANQKEQASGRITVSLDKSSRHGALYIATSQHSDSTTYLCAV
Bos taurus V956 trav DAAA02028116.1 199281 GAGAQSVTQPDDHIAVSEGARLELKCNYSSSVSPYLFWYMQYPNQGLQLLLKYMPGDNVVSGIKGFEAEFRNSETSFHLRKIPAHWKDSAKYFCALS
Bos taurus V957 trav DAAA02028116.1 187428 QVKQSPQPSTVQEGEISILSCSYEKSAFDYFPWYWQYPGKGPAFFIAIRSVVNEMKDGRLTVFLNKSTKQLSLHIATSQPGYSATYFCAASTQSSP
Bos taurus V958 trdv DAAA02028116.1 180944 SGVAQKVTQDQPYVTSQIGQSVILNCRYEVSLSRYTHYLYWYKQLPSGEMTFLIRQESSGPNARNGRYSVNFQKAQNSISLTISALQLEDSAKYFCAVWE
Bos taurus V959 trav DAAA02028116.1 168775 VNGQQISQIPKFLPLQEGENFTTYCNSSSILSSLQWYKQRPGGSPVLLMILAKGGKVKTEQRLTGRLGETRKHGSLHLAAAQLSDVGTYFCA
Bos taurus V960 trav DAAA02028116.1 158435 TVVDAKTTQPNSMDCAEGENVNLPCNHSTIGGDEYIHWYRQNPSQSPQYVIHGLRGTVNSSMASLTIASDRKSSTLVLPQVTLRDTAVYYCVLRE
Bos taurus V961 trdv DAAA02028116.1 149846 SGVAQKVTQDQPDITSQVGQSVTLNCQYEVNWYRISYSIFWYKQLLSGQMTYLIRQYSEDGNARDGRYSVNFQKADNSISLTIPALQLEDTAKYFCA
Bos taurus V962 trdv DAAA02028116.1 129953 SGVAQNVTQDQPVIISQAGKVATLNCRYEISRNVHDYWIFWYKQLPSGEMTYVIHQYSEDRNERKGCYAVNFQKARKSISLTLSFFKLEHSVKYFCALWE
Bos taurus V963 trav DAAA02028116.1 112223 VQGLDVEQSPPALSLQEGASHMLRCNFSASVSNVQWYLQNPSGRLIHLFNIPSGTKQDGRLNATTIPKERRSSLHISSSQTTDSGTYFCAVQHSAPQ
Bos taurus V964 trdv DAAA02028116.1 98484 IQDQAGISSQVGESVTLNCRYETSQSNNILQVVIVTTSYNIFWFKQLPSGKMIFLTRDGHYSINFERSRKSSSLTISNLQLEDSAKYFCALWE
Bos taurus V965 trav DAAA02028116.1 87166 NVFDAKTTQPSSMDYPEGEDVTLPCSHSTISGNEYIHWYQQSPNQSPQYVIHGLRGTVNSSMASLTISSDRKSSTLVLPQVTLRDTAVYYCILRE
Bos taurus V966 trav DAAA02028116.1 80483 MNGQQIKHFPEFLLLQEGENFTTYCNSSSTFYSLQWYKQRSGGSPVLLMILAKDGEVKTQRRWTGRLGESKQHSSLHLTAAQLSDAGTYFCAE
Bos taurus V967 trdv DAAA02028116.1 74229 SGVAQKVTQDQSDVSSQVGQSVTLNCRYETSLNTYYLYWYKQLPSGQMTYVIRQGSEVTNAKEDRYSVNFKKADKSISLTISALQLEDSAKYFCALRD
Bos taurus V968 trav DAAA02028116.1 64004 TVIDAKTTQPSSMDCAEGEDVNLSCNHSTVGGKDYIHWYRQNRNQSPQYVIHGLRGTVNRSMASLTIASDRKSSTLVLPQVTLRDAAVYYCVLRE
Bos taurus V969 trav DAAA02028116.1 60986 VRGVDVEQSPPALSLQEGASYTLWCNFSTSSQSVNWYLQNPGGRIIHLFYIPSGTKQDGRLNATTVPKEGRSSLHISSSQTTDSGTYFCAVQHSAPQ
Bos taurus V970 trav DAAA02028116.1 56487 LNGQQIKHFPEFLLLQEGENFTTYCNSSSTFYSLQWCKQRPGGSPVLLMILAKGGEVKTQQRRTGQLGESKQHSPLHLAAAQLSDAGTYFCAE
Bos taurus V971 trav DAAA02028116.1 39486 TVIDAKTTQPSCVDCAEGEDVNLPCNHFTIGGNEYMHWYWQNPNQNTQYVTGLRATVNSSMASLTIASDRKSSTLVLPQVTLRDAAVYYCVLRE
Bos taurus V972 trav DAAA02028116.1 28558 MNGQQIKHFPKFLLLQEGENFTTYCNSSSTFYSLQWYKQRPGGSPVLLTVLAKGGEVKTQRRWTGRLGESKQHSSLHLTAAQLSDAGTYFCAE
Bos taurus V973 trdv DAAA02028116.1 22048 SGVAQKVTQDQSDVSSQVGQSVTLNCRYETSSSTYYLYWYKQLPSGQMTYVIRQGSEVTNARKDRYSVNFKKADKSISLTISALKLQDSAKYFCALSD
Bos taurus V974 trav DAAA02028116.1 11072 VRGVDVEQSPPALSVREGASYTLQCNFSTFPQSVNWHFQNPEGRIIHLFYIPSGTKQDGRLNATTVPKEGSSSLHISSSQATDSGTYFCAVQHSAPQ
Bos taurus V975 trav DAAA02028130.1 20029 GTNGDSVNQTEGPVTVSEGALMTLNCIYQTADSAPFLFWYIQHLNKAPQFLLKGSTSDQKPKSKGFQATLVKRDSSFHLQKQAVQASDSAVYYCALS
Bos taurus V976 trav DAAA02028130.1 3614 GTNGDSVNQTEGPVTLSEGPLLTLNCTYQTTYSDSYHFWYVHHLNKAPQLLLKGSMTNQRPEHEGFQATLVNSDSSFHLQKRAVQASDLAVYYCALN
Bos taurus V977 trav DAAA02028130.1 1133 SIMAQKVTQNQSEISVLEKEDVTLNCAYEANSYTYYLFWYKQPPSGEIIFLIHQDSYNELNTTKDQYFLNFQKATSSISLTISGSQLEDSAVYFCALR
Bos taurus V978 trav DAAA02028131.1 23756 VNNQQGKQKLQTLSIQEGENVTMNCSYKSITLTALQWYRQDSRRGFVHLILMRSNERQKHSGRLHFTLDNSIKSSSLSIMASQTEDTATYLCAP
Bos taurus V979 trav DAAA02028131.1 12466 GTSGDSVTQTEGVVTLPEKTALTLKCTYQSSYSGFLFWCVQYQNKELELLLKSSLNQKVTSRGFEATHISSDSSFHLQKSSVQTSDSAVYYCALS
Bos taurus V980 trav DAAA02028131.1 7937 RTSGDSVNQTEGPMTVSEGALLTLNCTYQTASLVPYLFWYVQHLNKAPKLLLKGLTADKKEEHEGFQATLVKSDSSFHLQKQAVQASDSAVYYCALS
Bos taurus V981 trav DAAA02028131.1 2248 GTNGDSVNQTEGPVTVSEGALLTLNCTYQTANSAPYLFWYVQHLNKAPQLLLKGLTADKKVEHEGFQATPIKRDSSFHLQKQAVQASDSAVYYCALS
Bos taurus V982 trav DAAA02028132.1 2304 GTRAQTVTQPESHTSVSKGAPVQVKCNYSYSGSPVLFWYVQYPRQRLQLLLKHTSRESIQGFTAELSQTEASFHLKKPSAQEEDSAVYYCALV
Bos taurus V983 trav DAAA02028134.1 14340 VSLGNKVEQSPTLSVQEGNSSVITCTYTDGNSEYFPWYKQESGKGLQFLIGIYSNKAKEEDQRLTVLLNKTAKHLSLHIATTEAGDSAVYFCAAS
Bos taurus V984 trdv DAAA02028149.1 1528 SSVAQRVTQDQLEIASQVGEVVTLSCRYETIQSRYNIYWYKQLPSGEMIYLIGQGSSSQNARYGRYSVNFQRSHKSISLMISVLQLEDSAKYFCALWE
Bos taurus V985 trav DAAA02028153.1 8114 DSRGQSVTQPNDPVFVSEGTSLELKCNYSYGATPYLFWYVQYPRQRPQLLLKYFSGNTVVQGIRGFVAEFKSSDFSFNLRKFSAHWSDSAEYFCALS
Bos taurus V986 trdv DAAA02028154.1 20020 SGVAQKVIQDQPYITSQIEQSVILKCRYELSQSGYTHYFFWYKQLPSGEMTFLIRQESLGPNARNGRYSVNLQKAQNSISLTISALQLGDSAKYFCAVRE
Bos taurus V987 trav DAAA02028155.1 2587 GINGDSVNQTEGPVTLSEGALLTLNCTYQTKYSDFYLFWYVQHLNKAPQLLLKGLTADKKVEHEGFQATLVKTDSSFHLRKQAVQASDSAVYYCALS
Bos taurus V988 trdv DAAA02028155.1 405 SIMAQKVTQNQSEISVLEKEDVTLNCAYEANSYTYYLFWYKQPPSGEIIFLIHQDSYNELNRTKDQYFLNFQKATSSISLTISDSQLKDSTLYFCALS
Bos taurus V989 trav DAAA02028156.1 43984 RTNGDSVNQTEGPVTVSEGALLTLNCTYQTASLAPYLFWYVQHLNKAPQLLLKGLTADRKVEHEGFQATHVKRDSSFHLQKQAVQASDSAVYYCALS
Bos taurus V990 trav DAAA02028156.1 36696 RTNGDSVNQTEGPVTVSEGAPMTLNCTYQATYSTYYLFWYVQRLNKAPQRLLMGLTADKKVEHEGFQATLVKSDSSFHLQKQAVQASDSAVYYCALS
Bos taurus V991 trav DAAA02028156.1 29973 GINGDSVNQTEGPVTVSEGALLTLNCTYQTTYSGSYHFWYVQHLNKAPQLLLKGSMTNQRPEHEGFQATLVRSDSSFHLQKRAVQASDSAMYYCALS
Bos taurus V992 trav DAAA02028156.1 19455 LSGEDQVEQSPQTLRIQEGDSLSLNCSYSSFRGLQWYRQDPGKGPELLFLLYSVGDEKQKERLRATLLKKGSSLHIEAPKPEDSATYLCAVQTQCSP
Bos taurus V993 trav DAAA02028156.1 15968 VSTKQDVSQSPEALNVREGDSVVLNCSYTDSALYFLQWFWQDPGKGLTSLLSIQANQKEQASGRITVSLDKSSRHSALYIATSQHSDSTTYLCAV
Bos taurus V994 trav DAAA02028156.1 7568 GAGAQSVTQPDDHIAVSEGARLELKCNYSSSVSPYLFWYIQYPNQGLQLLLKYVSGDNLVSGIKGFEAEFRNSETSFHLRKIPAHWKDSAKYFCALS
Bos taurus V995 trav DAAA02028156.1 3131 VRGMDVAQSPPALSLQEGASSILQCNFSTFADSVQWYLQNPRGRLIHLFYVPSGTKRDGRLNATTVPTERRSSLHISSSPTTDSGTYFCAVQHSAPQ
Bos taurus V996 trav DAAA02028158.1 73985 QTHGNSVTQMDGHVSRSEGTSVTINCTYSTSGYPNLFWYVQYPGEGPQLLLKAMKANDKGTNKGFEATYNTETTSFHVEKDSGQESDSAVYYCAWR
Bos taurus V997 trav DAAA02028158.1 69304 VSLGNKVEQSPTLSVQEGNSSVITCTYTDGNSAYFPWYKQEPGKGPQFLIAIRSNKGKEEDQRLTVLLNKTIKRLSLHIATTEAGDSAVYFCAAS
Bos taurus V998 trav DAAA02028158.1 62471 VSSQYTLDQSPSFLSIQERTHDDLNCTYQKKTFYHLVWFEQEPGKGLVSLSLIQSSQKEEADKNFKELLGKEKVYSVLHISASHPGDSAIYFCALRR
Bos taurus V999 trav DAAA02028158.1 49859 ASTQQNTVEQSPASLPVPEGAAASLGCTYSDSTSRYFTWYRQYPGKGPEFLLQVYANNNKEEGKFTAQSNKTSKHVSLRIRDSEPSDSATYLCAV
Bos taurus V1000 trav DAAA02028158.1 33039 GTSGDSVTQTEGVVTLPEKASLTLKCTYQSSYSGFLLWYVQYQNKELELLLKSSLNQKVTSRGFEATHISSDSSFHLQKSSVQTSDSAVYYCALS
Bos taurus V1001 trav DAAA02028158.1 28871 GTNGDSVNQTKGPVTVSEGALMTLNCTYQTADFDPYLFWYIQHLNKAPQLLLKGSISDQNPKSKGFQATLVRSDSSFHLQKRAVQTSDSAVYYCALS
Bos taurus V1002 trav DAAA02028158.1 6850 GTNGDSVNQTEGPVTVSEGALLTLNCTYQATYSTYYLFWYVQHLNKAPQLLLKGSMTDQKPKSEGFQATLDRSGSSFHLQKRAVQASDSAVYYCALS
Bos taurus V1003 trav DAAA02028163.1 26699 TLSLAKTSQPIFIDSYEGQEVNISCNHTTIATSEYIFWYRQFPNQGPQFIIQGYKTNVENEVASLLIPPDRKFSTLSLPQASLRDTAVYYCIVRD
Bos taurus V1004 trav DAAA02028163.1 15583 KSRGQKVEQNPSFQSVQEGDNCVINCTYTDSASTYFFWYKQEPGKGLQLLIHTLSNVDKKEGQGLIVLLNKKNKHLSLNITATNPGDSATYFCATR
Bos taurus V1005 trav DAAA02028239.1 11152 VSLGNKVEQSPTLRVQEGNSTFITCTYTDGNSNYFPWYKQEPGKGPQLLIAIRSNKAKEEDQRLTVLLNKTAKHLSLHIATTEGGDSAVYFCAAS
Bos taurus V1006 trdv DAAA02028240.1 7292 SSVAQQVTQVQTVVSSQVGQTVTLNCRYEVSWNMDYYYIFWYKQLPRGEMTFLIHQYSGYGNARNGRYSVNFHKAHKYISLIISALQLGDSAEYFCALWK
Bos taurus V1007 trav DAAA02028242.1 6797 QTCGDSVRQMDGQVTLLEGATLTVNCTYSATRYPTLFWYVQYPGEGPELLLKAMKANDKGNNKGFEAAYNTEIISFHLEKASVQESDSAVYYCALS
Bos taurus V1008 trav DAAA02028242.1 1665 GVRGVKVEQNPSVLSLQEGANSTLRCNFSDMVNNVQWFQQNPRGSLTRLFFIASGMKKNERMSSTVNSKERYSTLHITASKLEDAATYLCAVE
Bos taurus V1009 trdv DAAA02028243.1 907 SGMAQNVIQDQPNTSGQLGQSVTLNCRYGTAWSYYYMFWYKLLPNGEMIYLISQVFSGQNARNGRYSVNLQKASKSISLTISDLQLEDSAEYFCALWE
Bos taurus V1010 trdv DAAA02028247.1 455 SGVAQKVTQDQPDISSHMGQSVTLNCQYETSWSTYYLFWYKQLPSGQMTYLIQQYSGYGNARNGRYSVNFQKADKSISLIISSLQLEDSAKYFCALWE
Bos taurus V1011 trav DAAA02028260.1 17157 SSIAQKVTQDQPPMSVQEKETVTLNCTYDTSGTTYSPFWYKQHSSGVMAFLIPQDSYNKPNATEGHYSLNFQKASKFITLTISASQLGDSAVYFCTLSE
Bos taurus V1013 trav DAAA02028262.1 28481 VSLGNEVEQRPSTLSVQEGNSSVITCTYTDTASDYFPWYKQGPGKGPQLLIAIHSNMGEKKDQRLTVLLNKNTKHLSLHIATIQPGDSAVYFCAAR
Bos taurus V1014 trdv DAAA02028262.1 24754 SIIAQKVTQDQPQVLGQEKEAVTLDCKYDTSDSRYSLFWYKQPSSGGMILLIRQDSSNQQNATEGRYSLNFQKARQSVTLVISASQLEDSAVYFCALRE
Bos taurus V1015 trav DAAA02028262.1 10680 MSGKNQVEQSPPSLVVLEGENCTFQSNYTVRPFNNLRWYTQDTGRGLVSLITMTYSDNKKSNGRYTATLVVTSKHSSLHLTAAQLSNPAFYICVVG
Bos taurus V1016 trav DAAA02028283.1 15666 TLSLAKTSQPIFIDSYEGQEVNISCNHTTIATSDNIFWYRQFPNQGPQFIIQGYKTNVENEVASLLIPPDRKFSTLSLPRASLRDTAVYYCIVG
Bos taurus V1017 trav DAAA02028286.1 10423 GTNGDSVNQKEGPVTVSEGALLTLNCTYQTTYSDLYVFWYVQHLNKAPQLLLKGWMKDQSPVREGFQATLVSTDSSFHSQKWAVETSDSAVYYCALS
Bos taurus V1018 trav DAAA02028287.1 23767 GTRAQTVTQPESHTYVSEGAPVQVKCNYSYSGSPVLFWYVQYPRQHLQLLLKHTSRESIQGFTAELSQTEASFHLKKPSAQEEDSAVYYCALG
Bos taurus V1019 trav DAAA02028287.1 4653 GTSGDSVTQTEGVVTLPEKTALTLKCTYQSSYSGFLLWYVQYQNKELELLLKSSLNQKVTSRGFEATHISSDSSFHLQKSSVQTSDSAVYYCALS
Bos taurus V1020 trav DAAA02028288.1 6684 GTSGDSVTQTEGVVTLPEKTSLTLKCTYQSSYSGFLLWYVQYQNKELELLLKSSLGNQKVTSRGFEATHISSDSSFHLQKSSVQTSDSAVYYCALS
Bos taurus V1021 trav DAAA02028288.1 2562 GTNGDSVNQTEGPVTVSEGALLTLNCTYQTASLALYLFWYIQHLNKAPQFLLKGSMSDQNPKSKGFEATLVKRDSSFHLQKQAVQASDSAVYYCALSDAV
Bos taurus V1022 trav DAAA02028289.1 5177 RTNGDSVNQTEGPVTVSEGALLTLNCTYQTASSVPYLFWYVQHLNKAPQLLLKGLTADKKEEHEGFQATLVKSDSSFHLQKQAVQASDSAVYYCALS
Bos taurus V1023 trav DAAA02028292.1 3680 GTNGDSVNQTEGPVTVSEGALLTLNCTYQITYSDPYVFWYVQHLNKAPQLLLKGSMKDQKPKSEGFQATLVRTDSSFHLQKRAVQTSDSAVYYCALS
Bos taurus V1024 trav DAAA02028294.1 38141 SIMAQKVTQNQSEISVLEQEYVTLNCAYEANSYTYYLFWYKQLPSGEIIFLIHQDSYNEMNTTKDQYFLNFQKATSSISLTISDSQLEDSAVYFCALR
Bos taurus V1025 trdv DAAA02028294.1 22647 SGVAQKVTQDQSDVSSHVGQSVTLNCRYETSWTAYYLYWYKQLPSGQMTSVIRQGSEVTNARKDRYSVNFKKADKSISLTISALQLEDSAKYFCALSD
Bos taurus V1026 trav DAAA02028294.1 13413 TVINAKTTQPSSMDCAEGENVNLPCNHSTIGGDDYIYWYQQNPNQSPQYVIHGLRGTVNSSTGSLHIASDRKSSTLVLPQVTLRDTAVYYCVLRE
Bos taurus V1027 trav DAAA02028294.1 10403 VRGVDVEQSPPALSLQEGASYTLQCNFSTFPQSVNWYLQNPGGCIIHLFYIPSGTKKDGRLHATAVPKEGRGSLHISSSQTTDSGTYFCAVQHSAPQ
Bos taurus V1028 trav DAAA02028296.1 13838 GTNGDSVNQTEGPVTVSEGALLTLNCTYQTAYLAPYLFWYVQHLNKAPKLLLKGLTADKKVEHEGFQATPVKRDSSFHLQKQAVQASDSAVYYCALS
Bos taurus V1029 trav DAAA02028296.1 7098 GTNGDSVNQTEGPVTVSEGALLTLNCTYQTADSAPFLFWYLQHLNKAPQFLLKGSMSDQNPKSKGFQATLVKRDSSFHLQKQAVQASDSAVYYCALS
Bos taurus V1030 trav DAAA02028300.1 14358 VSSQYTLDQSPSFLSIQERTHADLNCTYQKKTFYNFVWFKQEPGKGLVSLSLIQSSQKEEADKNFKELLGKEKVYSVLHISASHPGDSATYFCALHRSALQ
Bos taurus V1031 trav DAAA02028300.1 1723 VSSQQNTVEQSPASLPVPEGAATSLSCTYSDSNSQYFTWYRQYPGKGPEFLLYVYANNNKEEGKFTAQSNKTNKHVSLRIRDSEPSDSATYLCAV
Bos taurus V1032 trav DAAA02028303.1 9383 VIGVDVEQSPAALTAQEGASSTLWCNFSTSSDSVQWYLQKPGGRLIHLIYIPSGTRKEGRLNATTVLKERRSSLHVSSLRTTDSGTYFCAVQHCAPQ
Bos taurus V1065 igkv DAAA02031104.1 2127 ASGEAVLYQTPAYIAASLGESISITCRANQSISDYLSWYKQKPGQAPMILIYDADNRYNGVPERFTATQSETEFVFTISQVEADDAAMYYCQQDY
Bos taurus V1160 trdv DAAA02040503.1 80914 AQAQMVQVNDSMYGFIGTDVVLHCSFANPLPGVKITQVTWQKATNGSKQNVAIYNPAMGVSVLAPYRERVEFLRPSFTDGTIRLSRLELEDEGVYICEF
Bos taurus V1199 iglv DAAA02045658.1 7575 SWAQAVLTQPSSVSGSLGQRVSITCSGSSSNVGRGNYVNWFQQIPGSAPRTLIYGATSRASGVPDRFSGSRSGNTATLTISSLQAEDEADYFCAAYDSSSNN
Bos taurus V1259 ighv DAAA02053407.1 6626 VLSQVQLRESGPSLVKPSQTLSLTCTASGFSLSDKAVGWVRQAPGKALEWLGGIDTGGSTGYNPGLKSRLSITKDNSKSQVSLSVSSVTTEDSATYYCTT
Bos taurus V1346 trbv DAAA02066345.1 5187 AVHAGVTQDPRFQVVRSGQKPTLRCTQDLNHNYMYWYRQDLGRGLRLIHYSNGPPNTENGDVPEGYSVSRPSTEDFPLTLESANRSQTSVYFCASSY
Bos taurus V1347 trbv DAAA02066345.1 1265 LVDSGVTQTPKYLIKSRNQQATLRCSPHSGHFSVYWYQQALGQGPQFLVQYYNQKVRGESHLLDRFSAKQFSDSRSELNLSSLELTDSAMYLCASSE
Bos taurus V1348 trav DAAA02066600.1 11613 FRVQMKVEQSPGVLTLQEGRNSSLICNYSISMTSVQWFQQNPDGRLISLFYIASGMQQKGRLKSTINSKERYSQLYIRDSQPGDSATYFCAVE
Bos taurus V1349 trdv DAAA02066600.1 1842 SSMADKVTEAQTTVTAREREAVTIGCTYEASRTYYTLFWYRQFPGGRMEFLIHQDSNNANARRDRYSVNFQKGKKIISLTISSLYLADSAKYFCALWE