WGS Statistics
Organism WGS Record. Vs Total IGHV IGLV IGKV TRAV TRBV TRGV TRDV
Nannospalax galili AXCS00000000.1 (AXCS01) 248 70 9 94 44 18 5 8
Vgene Table
Organism Vgene Locus contig Contig Pos. AA sequence
Nannospalax galili V8 igkv AXCS01006251.1 628 STGDIVLTQSPTSSAVSLGQKATISCKANRSISGLGGTDLMYWYQQKPGQAPKLLIYAASNVAPGVPARFSGTGSGTDFTLTISLVEADDAATYYCQQSKELP
Nannospalax galili V12 ighv AXCS01009022.1 1055 VHSQEKLQQSGAELKKPGASAKVSCKASGYTFTSYYMHWVKQIPGQGLEWMGWIYPDNGNRNHAQKFQGRVSITRDTSSSTAFMELTSLISEDSAIYYCA
Nannospalax galili V29 ighv AXCS01017492.1 17647 VHSQEQLQQSGAELKKPGASVKVSCKASGYTFTSYYMHWVKQRPGQGLEWIGRIIPSNGNTKYAQKFQGRVSMTRDTSSSTAFMELSSLIAEDSAIYYCA
Nannospalax galili V40 igkv AXCS01022225.1 2003 ACGEIIMTQSPCSLAVPAGQRVTINCKSRQSISLGASHFLAWYQQKPGQAPKLLIYGASTRESGVPDRFIGSGSGTDFTLTINSVQAEDLADYYCQHYREFP
Nannospalax galili V41 igkv AXCS01022236.1 8401 ACGEIIMTQSPRSLAVSAGQRATINCKSSQSISDGTYHYLAWYQQKPGQAPKLLIYGASTRESGVPDRFIGSGSGTDFTLTISSVQAEDLADYYCQQHYSSP
Nannospalax galili V45 ighv AXCS01024631.1 4615 VQCEEKLLESGGGLVQPGGSLTLSCAASGFTFSSYAMHWVRQAPGKGLEWVAAISDDGSRKYYLDSVKGRFTISRDNSKNTVSLQMSSLRSEDTATYYCAR
Nannospalax galili V46 ighv AXCS01024631.1 24774 VQCEVQLVESGGGLVQPGGSLTLSCAASGFTFSNYGINWVRQAPGKGLEWVAVIWYDGSQKHYVDSVKGRFTISRDNSKNTLSLQMNSLKVEDTGTYYCSA
Nannospalax galili V47 ighv AXCS01024634.1 4925 VQCEEKLVESGGGLVKPGGSLTLSCAASGFTFSSYAMHWVRQAPGKGLEWVAAIIYDGSGKYYPDSVKGRFTISRDNSKNTVSLQMSSLRSEDTATYYCAR
Nannospalax galili V53 igkv AXCS01027421.1 191 VRCDILMTQSPSLLSTSLGDKVTITCKASQNIASGLSWYQQKPGEAPKLLICGASTLQPGIPSRFSGSGSGTDFTLTISRLEPEDIGTYFCQQGYNTP
Nannospalax galili V57 trbv AXCS01028416.1 365 SFDAVIQTPRHLVKGKGQKVEMSCTPEKGHSFVCWYQQKHNKELNFLISFQSQQVLEQIDMVKERFSAKCHSNSPCNLEIQSSEAGDSALYLCASSQ
Nannospalax galili V74 iglv AXCS01036745.1 33682 SMTSYVLTQSPSVSVNSGQTATVICSGDSLSDRYVHWYQQKQGQAPLLVIYGDTKRPSGIPDRFSGSNSGNGATLTSSRAQAGDEANYYCHTWY
Nannospalax galili V75 iglv AXCS01036745.1 55776 SLSQSVLTQPPSASSSLGKSVQLTCTLSSGFSNYAVGWYQQRPGKSPRFVFLVGPNGIIGSKGDGIPDRYTGAGSWLDRYLNIQNVQEEDEGVYYCGLNHE
Nannospalax galili V76 iglv AXCS01036745.1 65600 SLASYVLTQSPAASVNLGQRATVTCSGDNLSNKYAHWYQQKPDQAPVLVIYSDSKRPSGIPDWFSGSSSGNMATLTISRTQVEDEADYYCQVWD
Nannospalax galili V77 iglv AXCS01036746.1 9069 SLASYVLTQSPAVSVNLGQRATVTCSGDNLSNKYAHWYQQKPGQAPVLVIYSDSKRPSGIPDWFSGSSSGNMATLTISRAQVEDEADYYCNRYGI
Nannospalax galili V79 iglv AXCS01036748.1 16706 SMASYVLTQPPAASVKLGETVRITCSGDKLSENYVYWFQQKPGGAPVQVIYKDSERPSGIPDRFSGSSSGNVATLTISRAQVEDEADYYCNSWD
Nannospalax galili V80 iglv AXCS01036749.1 8461 SLASYVLTQPPALSVNLGQRAIVTCSGDKLSEKYIQWFQQKPGQAPVQVIYKDSERPSGIPDRFSGSSSGNMATLTISRAQVEDEADYYCNRWD
Nannospalax galili V81 iglv AXCS01036749.1 17862 SMASYVLTQPPAASVKLGETVRITCSGDKLSENYVYWFQQKPSGAPVQVIYADSERPSGIPDRFSGSSSGNMATLTISRTQVEDEADYYCQVWD
Nannospalax galili V84 trbv AXCS01037699.1 2101 LVDTKVTQTPRNLVKRKGEKVLLECVQDMDHERMYWYRQDPGLGLRLIYISYDANDNSEGDIPDGYNVLRKQRESFSLILESASTNQTAVYLCASAL
Nannospalax galili V85 trbv AXCS01037699.1 7764 SVFSVSLYQNPKRDICQSGASLTIQCRVDTQVTLMFWYRQLQGQSLKLIATANQGSEATYENGFTKEKFPISRPNLTFSTLTVSNVRPEDSSFYFCSSD
Nannospalax galili V86 ighv AXCS01037875.1 1322 AHAQVKLEQSGAELKQPGQSVKISCKASGYKFTKYGMHWVKQPAGKGLQNMGWINTNTGNPTYAEDFKGCFVFSIDASISTAYLQINSLKAEDMAVYYCM
Nannospalax galili V100 ighv AXCS01042100.1 1043 VHSRVQLQQSGPDLKKPGTSVKLSCKTSGYTFTSYTIHWVKQKPGQGLEWIGWIYPGNDNTGYAQKFKGRVSMTSDTSSRTAFMELSSLISEDSAVYYCA
Nannospalax galili V102 igkv AXCS01043804.1 10461 SSGDIVKTQTPLSLPIAPGESASISCRSSQSLLHSDGNTYLEWYLQKPGQAPQLLIYEVSNRYSGVPDRFSGIGSGTDFTLKISRVEPEDVGVYYCMQGLQFP
Nannospalax galili V103 igkv AXCS01043807.1 26564 STGDIVMTQTPLSLPVAPGESVSISCKSSQSLLHSNGYTYLSWLLQKPGQSPQLLIYGASNRDSGVPDRFTGSGSGTDFTLKISRVEPDDIGIYYCVQAIYVP
Nannospalax galili V105 igkv AXCS01043812.1 8287 TRCDIQMTQSPSSLSASLGDRVTITCHASQDIHRYLAWHQQKPGEAPKVLINAAVDLQVGIPSRFSGSGSGTGYTLTISSLESEDVGTYYCQQYSYYP
Nannospalax galili V106 igkv AXCS01043817.1 57 SSGDVVMTQTPLSLSVAPGESVSISCRSSQSLLHSNGYTYLYWFLQKPGQSPWRLIYTVSNRGSGVPDRFSGSGSGTDFTLKISRVDSEDFGIYYCMQA
Nannospalax galili V108 trav AXCS01044498.1 3345 VSRGEKVEQLPSTLSVQEGDSNEINCTYSDSGSDYFPWYKQEPGKGPKLIIVIHSNSERKQNQRFTVSLDNKAKHFSLHIAATQPGDAALYFCAAS
Nannospalax galili V133 ighv AXCS01056825.1 11371 VQCEVQLVESGGGLVQPGGFLTLSCASSGFTFSNYWMYWFRQAPGKGLEWVARISGGGIQNYANSVKGRFTISRDNSKNTASLQMSSLRSEDTATYYCAR
Nannospalax galili V134 ighv AXCS01056825.1 21205 VQCEEKLLESGGGLVQPGGSLRLSCAASGFTFSNYWMYWFRQAPGKGLEWVAEISHDGSGKYYLDSVKGRFTISRDNSKNTVSLQMSSLRSEDTATYYCAR
Nannospalax galili V136 igkv AXCS01057079.1 614 SSGEIVLTQSPASLATSQGERVIITCSASSSIGTSRLHWYQQKAGFSPNLLIYGISTLASGVPAHFSGSGSGTSYSLTISSVEAKDAARYYCQQGSSSP
Nannospalax galili V148 igkv AXCS01063357.1 1017 ACGDIIMTQSPRSLAVSAGQRATINCKSSQSISAGTYHYLAWYQQKPGQAPQLLIYLASKRASGVSDRFIGSGSGTDFTLTISSVQAEDLAYYYCQQHYSSP
Nannospalax galili V153 trav AXCS01065478.1 8905 KTHGDSVTQIRGQISIPEGSPLTINCTYSTTVIAFPALLWYIQYPGEGPQLLLKALRDEERGSSKGFEATYSKGTTSFHLQKDAVHVSDSAVYYCAMS
Nannospalax galili V157 trav AXCS01067557.1 3906 GVSSLQKVEQHPESLQVPEGATASLNCTFSDSALLYFWAYKQHSGKDLELFYIFSNGDKEEGRFRAHLRKASRPVSLHIRGSQPSDSAVYLCAA
Nannospalax galili V158 iglv AXCS01068412.1 1468 TTGEGVKIQSPGSLYFSPGETSTLTCRAGQCVGSYLSWYQQKLGQVPRLLIFGASIRAGHVPAHFSGSGSDRDFTLTINNLEPEDVADYYCHPMIGWS
Nannospalax galili V187 trav AXCS01082648.1 5733 SSMSQKVTQAHFEISVVEKEAANLDCVYETSEPSYSLLWYKQAPSGEMVFLVRQDSFKKDNASEGRYSLNFQKSGSSIKLTITATEVEDSAVYFCALRG
Nannospalax galili V188 trav AXCS01082648.1 12178 RSNGDSVAQTEGLVTLTEGLPVILNCTYQTTFAASFLSWYVQYPSEGLQLLLKTATENQRTENRGFHATLVKSSNSFHLHKSSLQLSDSALYYCAVS
Nannospalax galili V189 trav AXCS01082649.1 6579 RSNGDSVAQTEGLVTLTEGLPVILNCTYQTTFAASFLSWYVQYPSEGLQLLLKTATENQRTENRGFHATLVKSSRSFHLQKSSLQLSDSALYYCAVS
Nannospalax galili V190 trav AXCS01082653.1 17178 DAGAQSVTQPDAHVTVSEAAALELRCTYSYGGTPYLFWYVQYPSQSPQLLLKYFSGDSLVQGVKGFQAEFKKTNSSFHLRKASVHWSDSAMYFCALS
Nannospalax galili V191 trav AXCS01082653.1 31469 RIHGDSVTQTEGKVTLSEEDFLTINCTYSASGYPTLFWYVQYPGEGPQLLFRASKANEKGTKKGFEATYVKDASSFHLHKASVQESDSAVYYCALS
Nannospalax galili V192 trav AXCS01082654.1 2062 ASISQKVTQAQTAISIMEKKNVTLDCVYEIRDTNYYLFWYKQTLSGEMVFLVRQDSYKKENATEGRYSLNFQKSASYIGLTITATWVQDAAVYFCALGE
Nannospalax galili V193 trav AXCS01082654.1 23401 VSRGEKVEQLPSTLSVWEGDSSEINCTYSDSASSYFPWYKQEPGKGPQLIIDIRSNSERKQNQRLTVSLDKKAKHFSLHIAATQPGDAALYFCAAS
Nannospalax galili V194 trav AXCS01082655.1 4191 RTHGDSVTQMEGQLTLSKGDFLTINCTYSTSTYPTLFWYVQYPGEPLQLLLRVTKASEKGKNKGFEATYDREASSFHLHKASVQESDSAVYYCALV
Nannospalax galili V195 trav AXCS01082655.1 10102 VSSQQKVEQHPESLGVLEGATASLNCTFSDSSSQYFFWYKQHSGERPEFLMSIFSSGDKEEGRFRAHLDKASRHLSLHIRGSQPSDSAVYLCAV
Nannospalax galili V196 trav AXCS01082655.1 19327 ASMSQKVTQAQTEICIMEKKNVTLDCVYETRETTYYLFWYKQTPSREMVFLVRQDSYNEENATEGRYSLNFQKSASYIGLTITATWVQDAAVYFCALRE
Nannospalax galili V197 trav AXCS01082659.1 2077 VSRGEKVEQLPSTLSVWEGDSSEINCTYSDSASDYFHWYKQEPGKGPQLIIDIRSNSERKQNKRLTVLLNKKAKHFSLHIAAHQPGDTAFYFCAAS
Nannospalax galili V198 trav AXCS01082661.1 6046 VSQGEKVVQSPSALSVQEGDSSEINCTYSDSGLDYFPWYKQEPGKGPQLIIDIRSNSERKQNQRLTVSLDKKAKHFSLHIVATQPGDTALYFCAAS
Nannospalax galili V199 igkv AXCS01083132.1 3095 YICEGVMTQTPLSLSVAPGESASISCRSSQSLVDSDGDTFLNWYQQKPGQAPRLLIYEVSKRENGVKQRFSGSGSGTDFTLEISKVRPEDFGVYYCMQY
Nannospalax galili V200 igkv AXCS01083142.1 7465 SSGDVVLTQTPTSLLVVPGESASISCRSSRSLLHSNGNTYLSWFIQKPGQSPRHLIYIISNRNSGVPDRFSGTGSGTDFTLKISRVEPEDFGVYYCYQG
Nannospalax galili V259 trdv AXCS01107824.1 9207 KNILCVTLTQSSPDQTVASGSEVTVLCTYDVEFANPDLYWYRRRPDQTFQFILYRDNTRFHDADFVQGRFYVKHSVTHQTFHLVISSVKTEDSATYYCALL
Nannospalax galili V267 ighv AXCS01110486.1 110 VQCEVRLVESGGGLVPPGGSLTLSCAASGFTFSNYGMHWVRQAPGKGLEWVAGIWYDGSGKYYPDSVKGRFAISRDNSKNTVSLQMNSLRSEDTATYYCAR
Nannospalax galili V275 igkv AXCS01113463.1 675 TKCDIQLTQSPSSLSTSVGDTVTITCRASQGISNYLQWYQQKKGEAPKLLIYYGKRLQSGVPSRFSGQYSGTDFTLTISNIETEDVADYFCQQGYSYP
Nannospalax galili V291 igkv AXCS01121044.1 3296 ARYDIQTIQAPSALSASLGNRDTITCRASEDIRKWLSWYQKKPGKSPELLIYGASNLVTGIPSRFSGSGSGTEYYATISGQESEGDSTYYCLQTCSNP
Nannospalax galili V294 igkv AXCS01122391.1 22821 STGDIVLTQSPASSAVSLGQKATISCKASQSVNYYGVVNLMHWYQQKPGQPPKLLVYGASKIASGVPARFSGSGSGTDFTLTINPVEADDGATYYCQQGKEFP
Nannospalax galili V295 igkv AXCS01122400.1 26757 STADIVLTQSPASLALSLGQKATISCKASQSVTAYGSNYMHWYQHKPGQPLKLLIYRASNLESGVPARFSGSGSGTDFTLTINPVEADDAATYYCQQSKELP
Nannospalax galili V299 ighv AXCS01123723.1 1192 VQCEVQLVESGGRLVQPGGSLTLFCAASGFTFSNYGINWVRQAPGKGLEWVAAIIYDGSGKYYPDSVKGRFTISRDNSKNTVSLQMSSLRSEDTATYYCAR
Nannospalax galili V300 ighv AXCS01123724.1 1349 VQCEVQLVESGGGLVQPGGSLRLSCAASGFTFSSYTMHWVRQAPGKGLEWVSYISGSGGTIRYANSVKDRFTISRDNAKNTLYLDMSSLRSEDTAMYFCTT
Nannospalax galili V301 ighv AXCS01123725.1 2138 VQCEEKLVESGGGLVQPGGSLKLSCVASGLSFSGYYMSWVRQAPGKGLEWIARISSGGSSKYTDSVTGRFTISRDNAKNTLYLQMNSLRTEDAATYYCAR
Nannospalax galili V302 ighv AXCS01123726.1 3010 VQCEVQLVESGGGLVLPGGSLRLSCAASGFTFSSYRMHWVRQAPGKGLEWVSYISSSGGTIRYTNSVKDRFTISRDNAQNTLYLDMSSLRSEDTAMYFCTR
Nannospalax galili V303 ighv AXCS01123729.1 1482 VQCEVQLVESGGGLVQPGGSLTLSCVASGFTFSSYGMHWVCQAPGKGLEWTAAISPNSASMYYLESVKGQFTISRDNAKNTLHLQMSGLRSEDTTMYYCAR
Nannospalax galili V304 ighv AXCS01123734.1 1496 VQCEEKLVESGGGLVQPGGSLKLSCVASGFSFSGYYMSWVRQAPGKGLEWVAGISYDGSGKYYPDSVKGRFTISRDNSKNTVSLQMSSLRSEDTATYYCAR
Nannospalax galili V305 ighv AXCS01123735.1 7978 SRKGAGVDRKDKLPGGSLKLSCVASGFTFSGYYMSWVRQAPGKGLEWIARISSGSGSSTYYTDSVKGQFTISRNNAKNTLYLQMSSLRIEDTATYYCAR
Nannospalax galili V306 ighv AXCS01123739.1 957 VQCEEKLVESGGGLVKPGGSLTLSCAASGFTFSDYYMHWVRQAPGKGLEWVAEISYDGSGKYYPDSVKGRFTISRDNSKNTVSLQMSSLRSEDTATYYCAR
Nannospalax galili V307 ighv AXCS01123740.1 1066 VQCKEQLVESGGGLVLPGGSLRLSCVASGFTFSNYGMNWVHQAPGKGLEWVAYINYNGGTIYYANSVKGQFTISRDNAKNTLYLDMSSLRSEDTAMYYCAR
Nannospalax galili V308 ighv AXCS01123741.1 6828 VQCEVQLVESGGGLVLPGGSLRLSCVASGFTFSDYWMHWVRQAPGKGLEWVSYISGSGGTTHYANSVKGRFTVSRDNAKNTLYLDMSSLRSEDTALYYCTR
Nannospalax galili V309 ighv AXCS01123741.1 16350 VQCEEKLLESGGGLVQPGGSLRLSCVASGFTFSNYWMHWVRQAPGKGLEWVSYISSSGGTTHYANSVKGRFTVSRDNAKNTLFLDMSSLRSEDTALYYCVR
Nannospalax galili V310 ighv AXCS01123745.1 10272 VQCEEKLVESGGGLVLPGGSLKLSCVASGFTFSGHDMNWVRQTPGKGLEWIGSITNANSQHHADSVTGRFTISRDNAKNTLYLQMSILKIEDTATYFCTR
Nannospalax galili V319 iglv AXCS01126336.1 13468 SISQPVLTQPPSFSASLGTATRLTCALSSGFVVAGYHISWHQQKPGSSPRFLLRYYSESNKYQGPGVPSRFSGSKDTSTNAGLLLISGLQPEDEADYYCLT
Nannospalax galili V322 igkv AXCS01130012.1 481 AFGDIIMTQSPRSLAVSAGQRATINCKSSQSISAGTYHYLAWYQQKPGQAPQLLIYLASKRASGVSDRFIGSGSGTDFTLTISSVQAEDLAYYYCQQHYSSP
Nannospalax galili V327 igkv AXCS01131202.1 2213 VRCDTLMTQSPSLLSASLGNKVTITCKASENIANLLAWYQQIPGKVPKLLIYGASNLETGIPSRFSGSGFGTDFTLTISRLEPEDIGTYFCQQYINTP
Nannospalax galili V334 igkv AXCS01134815.1 989 SSADVVMTQTPLSLSVVPGASASISCRSSQSIISSTGNTYLSWFLQKPGQSPRLLIYKVSNRDTGVPDRFSGSGSGTDFTLQISRVEPEDSGVYYCMQD
Nannospalax galili V345 trgv AXCS01138727.1 1190 IRGDVLTLQLEHYITKKEGNITFLNCQMKTSILKNNAYIHWNRERLGQPLKRILYISSSENIVDEEGFSEERWEARKWQSDLSSTLRIHHVAEDDTGIYYCACCH
Nannospalax galili V346 trgv AXCS01138739.1 17573 SQVSSNLEDRVISITRTTGLPVIMPCAIDKGKEYIHWYKVQEGKDPQHLLYYNIPKSNIEVDSKLRPGKYHVYKATEKSCNFVLSNVEESDSGVYYCATWD
Nannospalax galili V347 trgv AXCS01138739.1 31603 GHGELEQPEISVSRVTDQSAQISCHVSLPDFTKVDIHWYRQKPNQHLEHLTYVRTDYNQRPLEGKNKKIEARKNLQTSTSTLHVNFLKKEDEATYYCAFWL
Nannospalax galili V351 igkv AXCS01141474.1 77 ACGDIIMTQSPRSLAVSVEQRVTINCKSSQSILFGFNHYLAWYQQKPGQAPKLLIYNASIWESGVADCFIGGGSGTDFTLTISSVQAEDLAVYHCQHYREFP
Nannospalax galili V362 igkv AXCS01147054.1 828 SNGDIVLTQSPASSAVSLGQKATISCKASQSVNFIGINMMHWYQQKPGQPPKLLIYAASNVASGVPDRFSGSGSGTDFTLTINPVEADDDANYYCLQSKEHP
Nannospalax galili V371 trgv AXCS01149880.1 1931 SQASSEERLKSITRQKGSSIVITCDIDKEKRYIHWYRVQEGNAPQYLLNFDFLTSTVAVDSGLSPKKYHAYKGSEKSCNFVLRDVEENDSGVYYCAVWL
Nannospalax galili V392 igkv AXCS01161994.1 1454 VRCDILMTQSPSLLSASLGDKVTITCKASQNIASRLSWYQQKPGEAPKLLICGASTLQSGIPSRFSDSGFGTDFTLTINRLEPEDIGTYFCQQGYSAP
Nannospalax galili V401 igkv AXCS01167670.1 879 SSGEIVLTQSPASLAASQGERVIITCSASSSVITSRLHWYQQKAGFSPKLLIYGTLTLASGVPTRFSGSGSGTSYSLTISSIEAEDAATYFCQQGNSFP
Nannospalax galili V417 igkv AXCS01172963.1 11769 VRCDILMTQSPSLLSVSLGDRVTINCKASENINSWLAWYQQKPGEAPKLLIYLASKLKTGIPSRFSGSGSGTDFTLTISSVEPEDIATYYCHQYTSTL
Nannospalax galili V418 igkv AXCS01172977.1 28977 AKCDILMSQSPSSLSASLGETVVITCQASQDISKYLSWYQQKPGKAPKRLIYYASNLENGVPSRFSGSGSGTQYSLTISSLQSEDMGTYFCLQYDKLL
Nannospalax galili V419 igkv AXCS01172977.1 44504 AKCDIQVTQSPSSLSGNLGESVTIICQASQDISTYLAWHQQKPGKAPQSLIYGASYLQNGVPTRFRGSGSGTQLSLTISSLQSEDIGTYYCLQYDKLP
Nannospalax galili V420 igkv AXCS01172977.1 55851 AKCDIQVTQSPSSLSGSLEESVTITCQASQDISKYLAWYQQKPEKAPKLLIYRASYLENGVPSRFSGSGSGTQYSLTISSLQSEDMGTYFCLQYDKLP
Nannospalax galili V431 trav AXCS01179148.1 2500 VSQGEKVVQSPSALSVQEEDSSEINCTYSDSGSDYFPWYKQEPGKGPKLIIVIRSNSERKQNQRLTVSLDKKAKHFSLHIAATQPGDAALYFCAAS
Nannospalax galili V452 igkv AXCS01184271.1 1559 VRCDILMTQSPSLLSASLGDKVTITCKASQNIASGLSWYQQKPGEAPKLLIYHASTLKPGIPSRFSGSGSGTDFTLTISRLEPEDIATYFCQQGYNAP
Nannospalax galili V460 igkv AXCS01188132.1 739 VRCYIVMTQSPSLLSASLRDRVTIKCKTSHYIGSWLYWYQQKPGENPKILIFDASSLATGIPSRFRGSGSGTDFTLTISSLESEDIASYYCLQHYDTP
Nannospalax galili V492 igkv AXCS01202695.1 912 SSGEIVLTQSPASLATSQGERVIITCSAISSVGTSRLHWYPQKTGFSPNLLIYGTSALAAGGSALFSGSVSGTSYSLTISSMEAEDAATYYCQQGHNLP
Nannospalax galili V502 ighv AXCS01210537.1 191 VHSRVQLQQSGPDLKKPGTSVKLSCKTSGYTFTSYTIHWVKQKPGQGLEWIGWIYPGNDNTGYAQKFKGRVSMTSDTSSRTAFMELSSLISEDSAVYYCA
Nannospalax galili V503 trbv AXCS01210924.1 1160 PGEPRIIQTPKHLVTAVGNERILSCKQYLGHNAMYWYRQGSKKSLELMFSYNYKKLVENQTVSSRFTPDNSETSHLKLQVAALKPEDSATYLCASSQ
Nannospalax galili V504 trbv AXCS01210924.1 15731 PLETTVVQTPKYLVTQVGKKASLECKQNLGHNAMYWYKQDSKRLLKIMFNYSNKDLILNETVPSRFSPQTSGKDHLNLEVTSVAPEDSAVYFCASSQ
Nannospalax galili V505 trbv AXCS01210926.1 20302 PVNAGVIQIPNSLLWKAGQNATIRCTQDMNLDTMFWYRQDPGLGLRLIYYSLYTGNNEKGDIPEGYKVSRPSTEIFSLILESASPSQTSVYFCAISY
Nannospalax galili V506 trbv AXCS01210928.1 1845 SADTGVIQSPRHIIKAKGGRSILKCYPISGHTSVFWYQQAVGQGPEFLIQHYETTEQNKGNIPHRFSVQQFSDYHSEMNMTALQLGDSAVYLCASSL
Nannospalax galili V507 trbv AXCS01210930.1 737 HMEAAVTQRPRKKVTETGKKVTLDCHQTYNHDNMFWYRQDPGHGLRLIHYSYGTDNIEKGDIPDGYSASRSSKKEFSLILESASLSQTSVYFCASSD
Nannospalax galili V508 trbv AXCS01210930.1 9687 VSEAGVSQSPRHEIVQEREVVEFQCDPIPGHIVLYWYQQTPGQGLKLLVYFQNDAVMDDSQLNKDRFSAERPKGNNSTLKIQSVERGDSATYLCASSL
Nannospalax galili V509 trbv AXCS01210931.1 1144 PTYAGVTQTPRHKVAEKGQNVSLKCEPILGHDTVYWYRQTLVKGVEFLIYFRNRDPMDDKGMPNNRFSAQVSENPKVSTLTIQSTEPQDAAVYLCASSL
Nannospalax galili V510 trbv AXCS01210931.1 7158 LVDAGVMQNPRYQVVRAGKPVTLSCSQNLNHDCMYWYQQKPSQAPKNLLYYYNKNLYRDPDTVDNFQASQPNTSFCFLDIRSADLGDSAMYLCASSK
Nannospalax galili V511 trbv AXCS01210932.1 17300 TTDGSITQTPKFLIREQGQKLTLKCEQNFNHDSMYWYRQDPGQGLRLIYYSQITDDVQKGDLSEGYDASREKKSVFPLTVRSAQKNHTAIYLCASSL
Nannospalax galili V513 trbv AXCS01210932.1 37439 SMDTEVIQSPRHMVKGKGQKAKIKCVPMTGHSYVYWYHKKLGEELKFLVYFQNADIIDKTEMINNQISAECSPNSRCTIEIQSTDLADSAVYFCASSQ
Nannospalax galili V514 trbv AXCS01210932.1 48822 SFDAQIIQIPRYLVKGKGQRTNLSCSPEQGHTLVYWYQQRQNKKLKLLINFQGQHILDQTNMVKERFSAEWPSNLPSSLEIQSSETGDSALYLCASSQ
Nannospalax galili V515 trbv AXCS01210932.1 50732 YLDAKVTQTPRHLVKEKGQKAEMRCNPIKGHTAIYWYQQNQKKELTFLVYFQNHQLLDQIDTVKNRFLAEWSSNSSCNLEIQSSEAGDSAVYLCASSQ
Nannospalax galili V516 trbv AXCS01210933.1 370 SFDAKVTQTPRHLVKEKGQKAKMSCGPERGHTAIYWYQQNQDKEIKFLVYFRSQEMLDQIDGFKERFSAECPSDSPCSLEIKTSEAGDSAVYLCASSQ
Nannospalax galili V517 trbv AXCS01210939.1 165 SFDAVIQTPRHLVKGKGQKVEMSCTPEKGHSFVCWYQQKHNKELNFLISFQSQQVLEQIDMVKERFSAKCHSNSPCNLEIQSSEAGDSALYLCASSQ
Nannospalax galili V523 igkv AXCS01214050.1 128 SSGEIVLTQSPASLATSQGERVIITCSASSRVITSRLHWYQQKAGFSPNLLIYGTLTLASGIPAHFSGSGSGTSYSLTISSMEAKDAATYYCQQGNSFP
Nannospalax galili V526 igkv AXCS01214497.1 225 SCGDVVMTQTPLSLSVAPGESASISCRSSQSLVDSDGDTFLNWYQQKPGQAPRLLIYEVSKRENGVKQRFSGSGSGTDFTLEISKVRPEDFGVYYCMQA
Nannospalax galili V534 igkv AXCS01220644.1 3182 SRGDVVMTQTPLSLSVAPGESASISCRSSQSLLHSDGNTYLYWYQQKPGQSPRFLIYGVPDRFSGSGSGTDFTLKISRVEPEDSGIYFCLQRTHYP
Nannospalax galili V572 igkv AXCS01309734.1 44 FTEDTVLTQVPASLTVSSGQRAAISCKASQSAESFSLSCMHWYQQKPGQSLNVLTYLASSMILGVLSRFSVSESETDFILTINPPEADDAATYYCQQSKDFP
Nannospalax galili V578 igkv AXCS01000943.1 2344 AKCDIQMTQSPSTQSASLGGRVTITCQASENIYRNIAWYQQKQGKAPKLLIYGASSLQTGVPSRFSGSGSGTDYTLTISSLESEDIATYYCQQYSEYP
Nannospalax galili V580 ighv AXCS01003139.1 8593 IQCGVKIVDSGGGLVQPGGSLRLSCATSGFTFSDYYVNWVRQAPGKGLEWVAQIRNKANSYATYYAASVTGRFTISRDDSQSSASLQMSSLKTEDTATYYCTG
Nannospalax galili V581 ighv AXCS01003139.1 5956 IKCEMKLMESGGGVVQPGGSLRLSCTASGFTFSDYWMNWICQAPGKGLEWLAVIKYDGSEKHYAESVKGRFTISRDNSRNILYLQMSHLRADDTATYYCAKE
Nannospalax galili V582 ighv AXCS01003141.1 14989 VQCEVKLVQSGGGVVQPGGSLKLSCATSGFTFSSYLMSWLRQTPGKGLEWIGNIYPGAGITNYADTIKGRFTISSDNSKNTLYLQMSSLRSEDTATYYCAR
Nannospalax galili V583 ighv AXCS01003142.1 9292 VQCEVKLVQSGGGLVQPGGSLKLSCAMSKFTFSNYWMSWLRQTPGKGLEWIGNIYPGAGITNYADTIKGRFTISSDNSKNTLYLQMSSLRSEDTATYYCAK
Nannospalax galili V584 ighv AXCS01003146.1 32861 QLVEFGGGLVKPGGSLKLSCIASGFTIDGYGMSWVRQAPGKGLEWVASTEYASSDYELELVESTYYADPVKGRFTISRDNEKNTVSLQMSSLRSEDTAMYYCAR
Nannospalax galili V585 ighv AXCS01003147.1 2363 IQCQEQLAESGGGLVKPWGSLKLSCAASGFTFSNWMSWICQTPGKGLERVGQINPNGGSTYYPDSMKGRFTISRDNSKNTLSLQMSSLRSEDTATYYCAR
Nannospalax galili V586 ighv AXCS01003150.1 1356 VLSQVQLQEIGSGLLQPTQTLSLTCTVSGYFISSGGYWWNCVQQQPGKGLEWMSRINNNEETDYSASLRSQINTTADTSKNQFSLRLSSVTAEDTAVYYCMR
Nannospalax galili V587 ighv AXCS01003153.1 4735 IHSQEQLQQSGAELKKPGASVKVSCKASGYTFTSYYMHWVKQRPGQGLEWIGRIIPSNGNTKYAQKFQGRVSMTRDTSSSTAFMELSSLIAEDSAIYYCA
Nannospalax galili V588 ighv AXCS01003153.1 755 VHSQVQLQQSGPDLKKPGTSVKLSCKTSGYTFTSYTIQWVKQKPGQGLEWIGWIYPGNGNTGYAQKFKGRVSMTSDTSSSTAFMELSSLISEDSAVYYCA
Nannospalax galili V589 ighv AXCS01003154.1 4465 VHSQEQLQQSGAELKKPGASVKVSCKASGYTFTSYYMHWVKQRPGQGLECIGQINPGNGNTEYAQKIQGRVSMTRDTLSSTAFMELSSLISEDSAVYYCV
Nannospalax galili V590 ighv AXCS01003155.1 6943 IHSQEQLQQSGAELKKPGASVKVSCKASGYTFTSYYMHWVKQRPGQGLEWMGWIYAGSGNTNYAQKFQGRVSMTRDTSSSTAFMELSSLTSEDSAVYYCA
Nannospalax galili V591 ighv AXCS01003160.1 16862 VLSQITLKESGPGLLQPFQSLKLTCSFSGFSLSTSGIGVGWIRQPPGKALEWLAHIWWDDDKNYSPSLKSRLTISKDTSKNQVFLTLTSVNPEDTATYYCARR
Nannospalax galili V592 ighv AXCS01003161.1 1863 AHAQVKLEQSGAELKQPGQSVKISCKASGYTFTSYGMHWFKQPVGKGLKGMGAINTDTGNPTYAEDFKGRFVFSMDASISTAYLQINSLKAEDTAVYYCM
Nannospalax galili V593 ighv AXCS01003163.1 2081 AHTQVKLEQSGAELKQPGQSVKISCKASGYTFTEYAMNWVKQPAGKVLQDMGWINTDTGNPTYAEDFKGRFVFSMDASISTAYLQINSLKAEDMAVYYCA
Nannospalax galili V594 ighv AXCS01003166.1 9542 VHAQVKLEQSGAELKQPGQSVKISCKASGYTFTNYAMSWLKQPAGKGLQYMAWINTNTGKPTYAEDFKGRFVLSMDASISTAYLQINSLKAEDMAVYYCA
Nannospalax galili V595 ighv AXCS01003166.1 3111 AHAQVKLEQSGAELKQPGQSVKISCKASGYTFTNYGMHWVKQPAGKGLQNMGWINTNTGNPTYAEDFKGRFVFSLDTSISTAYLQINSLKAEDMAVYYCA
Nannospalax galili V596 ighv AXCS01003170.1 2235 AHAQVKLEQSGAELKQPGQSVKISCKASGYTFTSYGMHWFKQPVGKGLKGMGAINTDTGNPTYAEDFKGRFVFSMDASISTAYLQINSLKAEDTAMYYCM
Nannospalax galili V597 ighv AXCS01003175.1 3160 AHTQVKLEQSGAELKQPGQSVKISCKASGYTFTSYGMYWVKQQVGKGLKVMGAINTNTGNPTYAEDFKGHFVFSMDASISTAYLQINSLKAEDTAVYYCA
Nannospalax galili V598 ighv AXCS01003176.1 13615 VYSQAQLQQSGAELKRPGASVKVSCKASGYSFTSYYIQWVKQKPGKGLEWIGRIDPGDGETKYAQKFQGKATLTADTSSNTAFLELSSLTTEDSAVYYCA
Nannospalax galili V599 ighv AXCS01003177.1 14949 VLSQVQLKESGPGLLKPAETLSLTCTVSGDSISSSYWWSWLRQKQGKGLEWMGRIYNDGDTNYNPSLKSRITMTVDTSKNQFSLRLRSVSTEDTAVYYCAR
Nannospalax galili V600 ighv AXCS01003179.1 360 FQCEVQLVESGGGLVQPGGSLRLSCAASGFTFSSYWMSWICQVPGKGLEWIGEINGNGGTTNYASSLKDRFTFSRDNSKNTLYLQMSNLRSEDTAVYYCSR
Nannospalax galili V622 igkv AXCS01010238.1 2842 VRCDILMTQSPSLLSASLGDKVTITCKASQNIASGLSWYQQKPGEAPKLLIYHASTLKPGIPSRFSGSGSGTDFTLTISRLEPEDIATYFCQQGYNAP
Nannospalax galili V623 igkv AXCS01010242.1 8220 VRCDTLMTQSPSLLSASLGDKVAITCKASQNIASGLSWYQQKPGEAPKLLIYHASTLQPGIPSRFSGSGSGTDFTLTISRLEPEDIATYFCQQGYNVP
Nannospalax galili V628 igkv AXCS01013179.1 312 VRRDILMTQSPSLLSASLGDKVTITCKASENIGTWLAWYHQKPVEAPKLLIYDASTLQTGIPSWFSGSGSGTDFTFTISRLEPEDISTYFCQQGYNAP
Nannospalax galili V634 igkv AXCS01016459.1 1136 TCGDTIMTQSPRSLSVSAGQRATMNCKSSQSITYGTYDYLAWYQQKPGQAPKLLIYLASRRESGVPDRFIGSGSGTDFTLTISSVQAEDLADYYCQQYYSSP
Nannospalax galili V639 trdv AXCS01019504.1 7162 STVAQKVTQVQPATSRQEGEAVTLDCSYETSQTLYHLFWYKQLPGGEMIFLLRQISSSRNEKSGRYSVSFQRSAMSISLTISALQLEDSAKYFCALGE
Nannospalax galili V640 trdv AXCS01019504.1 6091 STVAQKVTQVQPATSRQEGEAVTLDCSYETSQTLYHLFWYKQLPGGEMIFLLRQISSSRNEKSGRYSVSFQRSAMSISLIISALQLEDSAKYFCALWEL
Nannospalax galili V643 ighv AXCS01022059.1 3625 VQCEVQLVESGGRLVQPGGSLTLFCAASGFTFSSYGIHWVRQAPGNGLEWVALVSTIEIIQYYANSVKGRFTISRDNSKNTVSLQMNSLRSEDTATYYCAR
Nannospalax galili V644 ighv AXCS01022064.1 4785 VQCEVQLVESGGGLVKPGGPLKLSCVSSGFPFSGYYMHWIHQAPGKGLEWVSHISSVKDQLTISRDNAKSILYLQMNSLRTEDTATYYCARDTVS
Nannospalax galili V645 ighv AXCS01022066.1 770 VYSQAQLQQSGAELKRPGASVKVSCKASGYSFTSYYIYWVKQKPGKGLEWIGWIDPEDGEIKYAQKFQGKATLTADTSSNTAFLELSSLTTEDSAIYYCA
Nannospalax galili V646 ighv AXCS01022069.1 3058 VHSQVQFHQSGAELKKPGASVKVSCKASGFTITEYYIHWMKQKPGKGLEWIGAIDPEDGDTDYDQKFQGKATLTADPSTTFLELRSLTTEDSATYYCA
Nannospalax galili V647 ighv AXCS01022071.1 1702 VLSQVQLKESGPGLLKPAETLSLTCTVSGDSISSSYWWSWLRQKQGKGLEWMGRIYNDGDTNYNPSLKSRITMTVDTSKNQFSLRLRSVSTEDTAVYYCAR
Nannospalax galili V648 ighv AXCS01022072.1 4519 FQCEVQLVESGGGLVQPGGSLRLSCAASGFTFSSYWMSWICQVPGKGLEWIGEINGNGSTTNYASSLKDRFTFSRDNSKNTLYLQMSNLRSEDTAVYYCSR
Nannospalax galili V649 ighv AXCS01022088.1 1241 IHSQIKLEQSGAELKRPGASVKLSCKASGFTITRTYINWVKQKPGKGLEWIGWIDPENGDTKYDQKFQGKATLTADTSSNTAFMELSSLGSDDSATYYCT
Nannospalax galili V667 ighv AXCS01032035.1 4510 QLVEFGGGLVKPGGSLKLSCIASGFTINGYGMSWVRQAPGKGLEWVASTEYALSDHELELVESTYYADSVKGLFTIFRDNEKNTVSLQMSSLRSEDTAMYYCVR
Nannospalax galili V679 trbv AXCS01037716.1 11604 ARAQTIHQWPATKVQLVGSPLSLKCTIKGKSNPNLYWYRQTTGQALQQLFYSISVGQVESVEPHNLSASRPQDGQFILSSKKLLLSDSGFYLCAWS
Nannospalax galili V695 ighv AXCS01046860.1 3788 VQCEEKLLESGGGLVQPGGSLTLSCAASGFTFSSYAMHWVRQAPGKGLEWVAAISYDGSGKYYPDSVKGRFTISRDNSKNTVSLQMSSLRSEDTAMYYCAK
Nannospalax galili V697 igkv AXCS01050597.1 3664 SSGDTAMTQTPLTLSAAPGDSASLSCRSSKSILRSDGNTYLSWCMQRPGQSPPGLIYKVSNRYSEVPDRFIGSGSGTEFTLKISRVEPEDVGDYYCMQHTGFP
Nannospalax galili V725 igkv AXCS01065330.1 579 IRCDIQITQSPSVVSASVGDSVTINCKASQNIGSWLAWYQQKPGDAPKLLIYYASKLETGIPSRFSGSGSGTDFTLTISSLLMEDVAAYYCQQYDTSP
Nannospalax galili V726 igkv AXCS01065333.1 10684 VRCDILMTQSPSLLSTSLGDKVTITCKASQNIGNWLAWYQQKPGEAPKLLIYGASNLQTGIPSRFSGSGSGTDFTLTISRLEPEDIATYYCQQLLSTP
Nannospalax galili V727 igkv AXCS01065334.1 877 GRCDILMTQSPSLLSVSLGDRVTITCKASQNIGNWLAWYQQKPGEAPKLLIYGASNLQTGIPSRFSGSGSGTDFTLTISNLEPEDIATYYCQQLLSTP
Nannospalax galili V728 igkv AXCS01065336.1 12104 VRCDILMTQSPSLLSASLGDRITINCKASEHINNYLGWYQQKPGEAPKLLIYGASNLQTGIPSRFSGSGSGTDFTLTISMLEPEDMGIYYCQQYYSNP
Nannospalax galili V730 igkv AXCS01066917.1 3033 ARCDIQMTQSPSSVSASLGDTVTIACLASQGISNSLAWYQQKPGTTPKLLIYGATYLQSGIPSRFSGSRSGTQFTLTISSLESGDVGTYFCQQYYSFP
Nannospalax galili V731 igkv AXCS01066919.1 2143 VRCDILMTQSPTLLSASLGDRVSITCKASQNIAHGLAWYQQKPGEAPKLLIYLTSILQTGIPSRFSGSGSGTDFTLTISRLESEDIATYYCQQYINTP
Nannospalax galili V733 trav AXCS01067560.1 35908 SASSQTVTQPEDHISVFEGALVQVKCSYSYFGSPMLFWYVQYPRQDLQLLLKHISTDSAKGFTAALHKEPRPSSCRSPLAQEDDTAVYHCAE
Nannospalax galili V741 igkv AXCS01070622.1 1426 ACGDIIMTQSPRSLAVPAGQRVTINCKYSQSISIGSNHYLAWYQQKPGQAPRLLIYGASTQGSGVPDHFIGSGSGTDFTLTISSVQPEDMADYYCQHYRVFP
Nannospalax galili V742 igkv AXCS01070623.1 644 ACGDIIMTQSPRSLAVSAGERVTINCKSSESVSLGYIQYLAWYQQKPGQAPKLLIYLASERESGVPDRFIGSGSGTDFTLTISSVEAEDLADYYCVQHYDSP
Nannospalax galili V747 igkv AXCS01074188.1 529 STGDIVLTQSPVSSAVSLGQKATISCKASQSVNFIGINMMHWYQQKPGQPPKLLIYEASNVASGVPDRFSGSGFGADFTLTINPVEADDAATYYCQQSKKLP
Nannospalax galili V750 igkv AXCS01075018.1 5028 ARCDIQMTQSPSSVSASLGDTVTIACLASQGISNLLAWYQQKPGTTPKLLIYGASYLQSGIPSRFSGSRSGTQFTLTISSLASGDVGTYFCQQYNSFP
Nannospalax galili V758 igkv AXCS01078277.1 3475 STGDIVLTQSPASSAVSLGQKVTISCQASQSVNKYGIINMMHWYQQKPGQPPKLLIYAASNVAPGVPARFSGSGSGTDFTLTINPVEADDPATYYCLQSKELP
Nannospalax galili V764 ighv AXCS01081025.1 2095 VQCEVQLVESGGRLVQPGGSLTLSCAASGFTFSSYGINWVRQAPGKGLEWVALVSTIEIVQYYANSVEGRFTISRDNSKNTVSLQMNSLRSEDTAMYYCAR
Nannospalax galili V765 ighv AXCS01081026.1 513 VQCEEKLLESGGGLVQPGGSLRLSCAASGFTFSNYWMDWVRQAPGKGLEWVGQINPNGGSTYYPDSVKGRFTISRDNSKNTVSLQMSSLRSEDTAMYYCAK
Nannospalax galili V766 ighv AXCS01081028.1 5416 VQCEEKLLESGGGLVQPGGSLTLSCAASGFTFSSYDMHWVRQDPGKGLEWVAAISYDGSGKYYPDSVKGRFIISRDNSKNTVSLQMSSLRSEDTATYYCAR
Nannospalax galili V773 igkv AXCS01084002.1 2630 ACGDIVMTQSLASLAMSTGERVTISCKSSQSLYISSAQKNYLSWYQQKPGQAPKLLMYWASTRETGVPDRFTGSGSGTDFTLTISNVWAEDPALYFCLQNYGYP
Nannospalax galili V774 igkv AXCS01084019.1 7501 ACGEIVMTQSPASLAASAGERVSLSCTSSQSLYYSSTQKNYLSWYQQKPGQAPKLLMYWASTRETGVPDRFTGSGSGTDFTLTISSVRAEDAAAYFCLQAYEYP
Nannospalax galili V796 ighv AXCS01092014.1 2104 VQGEVKLVESGGDLVKPGGSLRLSCAASGFTFSDYYMYWFRQAPEKAPEWVAVVRNKDKGYTTEYSASVKGRFTISRDDSKSTAYLQMNSLRVEDTARYYCGE
Nannospalax galili V797 ighv AXCS01092015.1 2973 VWAQVQLKESGPDLVKPTETLSLTCSVSGFSLTSKGVNWIRQPLGKGLEWIGIMGNGGGTAYNSALKSRVSITRDTSKSQVFLKLNTLQPEDTAMYYCAR
Nannospalax galili V798 ighv AXCS01092016.1 3249 ILAQVQLKESGPGLVKPKETLSLTCTVSGFSLTSNHVHWIRQPPGKGLEWIGAIWSGGSTDYNSALKSRVSITRDTSKSQVFLKLNDLQLEDTAMYFCVR
Nannospalax galili V799 ighv AXCS01092017.1 21625 VWAQVQLKESGPGLVKLTETLSLTCTVSGLSLTSNAVNWIRQPPGKGLEWIGVMRSSGSTYYNSALKSRVSITRDTSKSQVFLKLNDLQPEDTAVYFCTR
Nannospalax galili V800 ighv AXCS01092017.1 17371 VWAQVQMKESGPGLVRPTETLSLTCTVSGLSLTINGVNWIRQPPGKGLEWIGAIWAGGGTDYNSALKSRVSITRDTSKSQVFLKLNTLQSEDTAMYFCAR
Nannospalax galili V801 ighv AXCS01092017.1 9409 VWAQVRMKESGPGLGKPTETMSLTCTVSGFSLNSYGVHWIRQPPGKGLEWIGAMWSGGSTDYNSALKSRVSITRDTSKSQVFLKLNDLQLEDTAMYYCAR
Nannospalax galili V804 ighv AXCS01092019.1 6959 VLAQVQLQESGPGLVKPLEILPLTCTASGFSLTGYHMHWIRQAPGKGLEWIGVMWKGGSTDYNATLESRVSITRDTSKSQVFLKLNTLQSEDTAMYFCAR
Nannospalax galili V805 ighv AXCS01092023.1 35777 VQSEVKLVESGGGLVLPGGSLKLSCVASGFTFSSTYMSWVRQTPEKRLEWLSYISGSSSDIKYADSVKGRFTTSRDNAKSTLYLQMSSLRTEDTAIYYCVR
Nannospalax galili V806 ighv AXCS01092023.1 23291 VQCEVQLVESGGGLVQPGGSLKLSCAASGFTFSDYHMSWFRQTPEKRLEWISSISNDGSDTEYTESVKGRFTISRDNAKNTLYLQMNRLKSEDTATYYCV
Nannospalax galili V807 ighv AXCS01092023.1 11328 VQCEVQLVESGGGLVQPGGSLNLSCAASGFTFSDYPMIWFHQTPEKRLEWISVITNDGSGTEYAESVKGRFTISRDNDKNTLYLQMNRLKSEDMATYYCA
Nannospalax galili V808 ighv AXCS01092026.1 15656 VQSEVKLVESGGGLVLPGGSLKLSCVASGFTFSSYYMSWVRQTPEKRLEWLSYISGDSSAIKYADSVKGRFTTSRDNAKNTLYLQMDRLKSEDTAMYFCVT
Nannospalax galili V809 ighv AXCS01092029.1 18790 ALAQVKLQESGPALVRPSETLSLTCKVSEFSITASGYCWHWIRQFPGNRLEWMEVICYNGYTNYNPSLKSRISISRDTSKNEFSLQLKSLTPEDTAEYYCAR
Nannospalax galili V811 igkv AXCS01092865.1 3921 AKCDIQMTQSPSTQSASLGGRVTITCQASENIYRNIAWYQQKQGKAPKLLIYGASSLQTGVPSRFSGSGSGTDYTLTISSLESEDIATYYCQQYNEYP
Nannospalax galili V812 igkv AXCS01092870.1 4596 SAGDVVMTQTPLSLPVAPGESASISCKSSQSLLHSNGNTYLSWFLQKPGQSPQLLIYRVSNRYSGIPNRFSGSGSGTDFTLKISQVEPEDFGIYYCYQG
Nannospalax galili V815 ighv AXCS01093795.1 3989 VQCEEKLVESGGGLVQPGGSLTLSCAASGFTFSSYGMHWVRQAPGKGLEWVAVIWYDGSQKRYADSVKGRFTISRDNSKNTASLQMNSLRSEDTATYYCAK
Nannospalax galili V820 igkv AXCS01096069.1 1161 ACGEIMMTQTPASLAVSAGQRVTISCKSSQSLYKSSNKNYLAWYQQKPGQTPKLLIYWASTQESGVPDCFIGSGSGTDFTLTISSVQARDLADYYCEQYYELS
Nannospalax galili V850 trav AXCS01107834.1 5769 TSMAQMVTQTQKEMSVQEADSATLDCTYDTSDSNYYLFWYKQLPSGQMTFIIRQEAYKQQNATENRFSVNFQKAAKSFGLKISDSQLGDAAMYFCALSE
Nannospalax galili V851 trdv AXCS01107835.1 9721 ASMGQTVTQTQQEISVQEAELATLDCAYDTTRSDYYLFWYKQLPSGQMTFIIRQEAYKQQNTTENRFSVNFQKATKSFSLKISDLQLGDAAMYFCTLSE
Nannospalax galili V852 trav AXCS01107837.1 35675 VSGQEKTVVQSPSSLNVWEKETAVINCSYTNVAFNYFPWYKTEGGKGLTLLTDIRSNVDRRQDGRFTVLLHTKVKQISLQITATRSGDSGLYFCAAD
Nannospalax galili V853 trav AXCS01107837.1 27987 IVVDAKTTQPNSMESAEGERVHLPCSHSTISGNEYVYWYRQAPLQGPEYVIHVLKENITNNMATLLITADRKSCTLVLPHVSLSDAAVYYCMLR
Nannospalax galili V855 trav AXCS01107838.1 15581 LSAQLEQSPRFLSIHEGQDLTMYCNSSSTFPKFYWYRQEPGEGPVLLMTLVKSGEVKEQERITAQFGEARKDSSLRILTAQPGDAGIYLCAGAQCS
Nannospalax galili V856 trav AXCS01107838.1 9483 VRAQTKVEQSPETLVLQEGTHASLLCKYPSSVVSMHWFQQNPGGHLTTLFYIASGERQKGRLKVTIDTKEGYSQLNITDSQPGDSASYICAGE
Nannospalax galili V857 trav AXCS01107842.1 13300 VKGQQVEQSPGALTLQEGENCDLKCNFSSSANLQWFHQNPQGRLISLFYNPSGTKQSGRLKSTTDAKERRSSLHISSSQTTDSGTYFCAVDTQCSP
Nannospalax galili V858 trav AXCS01107842.1 9390 KDRSDQQQVKQSPQSLTVQEGRTSVLNCTYENSAFDYFPWYRQFPGKGPELLITVLEVTTKKEDGRFSVFFSKSEKQLSLHITASQPADSATYFCTAR
Nannospalax galili V859 trav AXCS01107843.1 8639 VSRGEQVEQSPAFLSVREGDSSVINCSYTDSTSSYFYWYKQEPGAGLQFLIKIVSNVDKKEDPRLSVLLNKKEKHLSLHITGAHPGDSATYFCAAE
Nannospalax galili V860 trav AXCS01107843.1 7264 KSNGDSVTQTEGPVTLRERASVMLNCTYQTTDSAPVVFWYIQDLNKAPQLLLKTATENKRTENRGFQAMLVKSSNSFHLHKSSLQPSDSALYYCAVS
Nannospalax galili V861 trdv AXCS01107845.1 2401 STVAQKVAQVQPATSGQEGKEVTLHCSYETSWNNYYLFWYKQLPSAEMIFLIRQISYLQNEKSGRYSVSLQRSAKSISLTISALQLEDSAKYFCALGD
Nannospalax galili V862 trav AXCS01107848.1 7922 VTGLQVEQSPGALTLQEGENCDLQCNFSSSANNLQWFYQNPQGLLITLFFNPSGTKQSGRLKSTTDTKERRSSLHISSSQTTDSGTYFCAVDTQCSQ
Nannospalax galili V863 trav AXCS01107851.1 3908 KSNGDSVTQTEGPVTVTERASVMLNCTYQTTYSTPAVFWYIQDLNRAPQLLLKTATGNQRTENRGFQATLVKSSRSFHLHKSSLQPSDWALYYCAVS
Nannospalax galili V864 trdv AXCS01107852.1 2605 STVAQKVTQVQPATSRQEGEAVTLDCSYETSQTLYHLFWYKQLPSGEMIFLLRQGSSSGNEKSGRYSVSFQRSAKSISLTISALQLEDSAKYFCALWE
Nannospalax galili V865 trav AXCS01107853.1 12312 LKGLRVEQSPGALTLQEGENCDLQCNFSNSASNLQWFHQNPQGLLISLFYNPSGTKQSGRLKSTTDAKERRSSLHISSSQTTDSGTYFCAVDTQCSQ
Nannospalax galili V866 trav AXCS01107856.1 1627 KSNGDSVTQTEGPVSLTERASVMLNCTYQTTYSVPMVFWYIQDLNRAPQLLLKTATENQRTENRGFQATLVKSSNSFHLHKSSLQPSDSALYYCAVS
Nannospalax galili V867 trdv AXCS01107857.1 2318 STVAQKVTQVQPATSGQEGKEVTLDCSYETSQTLYYLFWYKQLPSGEMIFLLRQGSSSENEKSGRYSVSFQRSAKSISLTISALQLEDSAKYFCALGE
Nannospalax galili V868 trav AXCS01107858.1 3723 MKGQQVEQSPRALTLQEGENCDLQCNLSTSTNNLQWFYQNPQGLLITLFSNPSGTKQSGRLKSTTDAKERRSSLHISSSQTTDSGTYFCAVDTQCSP
Nannospalax galili V869 trav AXCS01107859.1 2670 KSNGDSVTQTEGPVTVTERASVILNCTYQTTYSAPTAFWYIQDLKKAPQLLLKTATENKRTENRGFQATLVKSSNSFHLHKSSLQLSDSALYYCAVS
Nannospalax galili V870 trav AXCS01107861.1 67626 KTHGDTVTQTEGKVTLSEEDFLTINCTYSASGYPALFWYVQYPGEGPQLLFRASKANEKGTKKGFEATYVKDASSFHLHKASVQESDSAVYYCALS
Nannospalax galili V871 trav AXCS01107861.1 60556 VSSQQKVEQHPESLGVPEGAMVSLNCTFSDSSLQYFFWYKQHSGERPEFLMSIFSNGDKEEGRFRAHLDKVSRHLSLHIRGSQPSDSAVYLCAV
Nannospalax galili V872 trav AXCS01107861.1 55608 SASSQTVTQPEDYISVFEGAPVQVKCSYSYSGSPVLFWYVQYPRQGLQLLLKHISTDSAKGFTAALNKDASSFHLQKPLAQEDDTAVYYCALS
Nannospalax galili V873 trav AXCS01107861.1 45285 TSVAQKVTQAQAAISVIEKKDVTLDCVYETSESTYSLFWYKQPPSGEMVFLVRQDSYNKENATDGRYSLNFQKSASYIGFTVTATRIEDSAVYFCALTR
Nannospalax galili V874 trav AXCS01107861.1 37389 KSNGDSVTQTEGPVTVTERASVMLNCTYQTTYSVPTVFWYIQDLNKAPQLLLKTATENQRTENRGFHATLVKSSNSFHLHKSSLQLSDSALYYCAVS
Nannospalax galili V875 trav AXCS01107861.1 14766 VKGQQVVQSPGALTLQEGDTSVLQCNFSSTPTNLQWFHQNPQGLLISLFYNPSGTKQSGRLKSTTDAKERRSSLRISSSQTTDSGTYFCAVDTQCSQ
Nannospalax galili V876 trdv AXCS01107861.1 2381 GSTVAQKVTQVQPATSRQEGEAVTLDCSYETSWSEYDLFWYKQLPSGEMIFLIYQFSSSRNEKSGRYSVSFQRSAKSISLTISALQLEDSAKYFCALGD
Nannospalax galili V877 trav AXCS01107862.1 32821 LKGQQVVQSPGALTLQEGENCDLQCNFSSTPTNLQWFHQNPQGRLITLFSNPSGTKQSGRLKSTTDAKERRSSLHISSSQTTDSGTYFCAVDTQCSP
Nannospalax galili V879 trav AXCS01107862.1 5899 VSRGEKVEQLPSTLSVQEGDSNEINCTYSDSGSEYFPWYRQEPGKGPQLIIAIRSNSERKQNQRFTVSLDKKAKHFSLHIAATQPGDTALYFCAAS
Nannospalax galili V880 trav AXCS01107865.1 13485 RTHGDSVTQMAGQLTLSEGNFLTINCTYSTSAYPTLFWYVQYPGEAPQQLFQVAKASEKGKNKGFEATYDREASSFHLHKASVQESDSAVYYCALS
Nannospalax galili V891 igkv AXCS01115706.1 747 TKCDIQLTQSPSSLSASVGDTVTITCRASQGISDYLHWYQHKQGEAPKLLIYYAKNLQPGVPSRFSGQYSGTDFTLTISNIETEDVADYFCQQSNSNP
Nannospalax galili V904 igkv AXCS01122391.1 15920 STADIVLTQSPASLALSLGQKATISCKASQSVTAYGSNYMHWYQHKPGQPLKLLIYRASNLESGVPARFSGSGSGTDFTLTINPVEADDAATYYCQQSKELP
Nannospalax galili V905 igkv AXCS01122406.1 8321 CHRQITLTQPGESLYVSPGERVSLTCRANQSLLYTNGKHYMLWYQQKPEKTIKALINHASVRVDGVPTRFSGSGSGAEFTLTIENLEPEDFGIYYCLQ
Nannospalax galili V906 igkv AXCS01122422.1 7299 STGDIVLTQSPASSAVSLGQKVTISCQASQSVNKYGIINMMHWYQQKPGQPPKLLIYAASNVAPGVPARFSGSGSGTDFTLTINPVEADDPATYYCLQSKELP
Nannospalax galili V911 igkv AXCS01124262.1 3062 VRCDTLMTQSPSLLSASLGDKVTITCKASQNIATLLAWYQQKPGEAPKLLIYLASTLQTGIPSRFSGSGSGTDFTLTISKVEPEDIATYFCQQGYDDP
Nannospalax galili V926 igkv AXCS01128760.1 1115 SSGDTLMTPSPLTLSAVLGESAFISCRSSKSSLHSDGNTYLSWYMQRPGQSPWGLIYKVSNWGSGVPDRFIGSGSGTDFTPKISRVEPEDVGVYYCMQHTGFP
Nannospalax galili V927 igkv AXCS01128761.1 1342 YNGDVVLTQSPSSLPVVPGESVSISCRSSQSLLYSDGYTYLEWYLQKPGQSPQLLIYLVSNRANGVPNRFIGSGSGTDFTLKISQVEPEDFGIYYCYQG
Nannospalax galili V934 igkv AXCS01131524.1 6219 FTEDTVLTQVLASLTVSSGQRAAISCKASQSAESFSLSCMHWYQQKPGQSLNVLTYLASSMILGVLSRFSVSESETDFILTINPPEADDAATYYCQQSKDFP
Nannospalax galili V979 igkv AXCS01153111.1 16331 AQGVIQLTQSPSLSVSLRGRVTISCRASQDISSYLNWYQQKPGKAPMLIIYGATNLESGVPSRFSGSGSRTDFTLTISSVESEDIATYYCQHYKEYP
Nannospalax galili V980 igkv AXCS01153113.1 26812 SRGEIVMTQSPTVLPVTPGDRITLNCRASQNVGTSLHWYQQKPNQAPKLIIKYASQTISGIPSRFSGSGSGTDFILTISTLQPEDLATYYCQQVYNYF
Nannospalax galili V982 igkv AXCS01153115.1 18356 STAETVLTQSPAVFSVTPGKEVIINCRAIQGIGTYLHWYQQKPNQAPRLLIKYASQTISGIPSRFSSSGSGTDFTFTISSLQPEDVASYYCQQNNSPP
Nannospalax galili V983 igkv AXCS01153125.1 10393 SISDTVVMTQTPLSLNVAPGEPASISCRSSYSLLYNDGNTYLNWYLQKQGQSPQLLIYGASKLASGVPDRFSGSGTEKDFTLKISKVEAEDAGIYYCLQALYV
Nannospalax galili V984 igkv AXCS01153126.1 7461 ARCDIQLTQKQTLLVVSLGHRVTITCQASQGISNYLNWYQKKPGEPIKPLIYCTSRLLSGVPSRFSGSGSRRDYYLTISSLESEVVATYYCQQYVSS
Nannospalax galili V985 igkv AXCS01153127.1 8958 AKCDIQLTQSPSFLSASVGDRVKITCRASQGISYYLNWYQQKSGKAPKLLIYYGNSLQSGVPSRFSGQYSGTDFTLTISNIETDDVADYFCQQSNSYP
Nannospalax galili V986 igkv AXCS01153129.1 24133 ARCDIQMTQSPSSLSASLGDTVTITCRASQGISNNLNWYQQKPGETTKLLIYYTNRLESGVPSRFSGTGSGTDYSLTISKLESEDAGIYYCQEGYSTP
Nannospalax galili V987 igkv AXCS01153137.1 2193 TKCDIQLTQSPSSLSASVGDTVTITCRASQGISDYLHWYQHKQGEAPKLLIYNAKNLQPGVPSRFSGQYSGTDFTLTISNIENEDVADYFCQQSNSNP
Nannospalax galili V988 igkv AXCS01153151.1 1716 TKCDIQLTQSPSSLSASVGDKITMTCRASQGISNDLHWYQKKQGEASKLLIYNAKNLQPDVPSRFSGQYSGTDFTLTISNLETEDVAAYYCQHGYNLP
Nannospalax galili V989 igkv AXCS01153162.1 2829 ARCDIQMTQSPPSLSASLGDTVTIKCVASQGISNDLNWYQQKPGNSPKLLIYYATNLYPGVSSRFSGQYSGTDFTLTISKLELEDTGLYYCLQHYSNP
Nannospalax galili V992 igkv AXCS01154310.1 4991 ARCDIQMIQTPSALSASLGNRDTITCRASEDIRKWLSWYQKKPGKSHELLIYGASNLVTGISLRFSGSGSGTEYYVTISGLESEGDSTYYCLQTCSNP
Nannospalax galili V996 igkv AXCS01156061.1 6521 MRCDILMTQSPSLLSASLGDRVTINCKASQNIASGLAWYQQKPGEAPKLLIYLASTLQPGIPSRFSGSGSGTDFTLTISSLEPEDIGTYFCQQYIDTP
Nannospalax galili V997 igkv AXCS01156078.1 662 VRCYIVMTQSPSLLSASLRDRVTIKCKTSYYIGSWLYWYQEKPGENPKILIFDASSPATGIPSRFRGSGSGTDFTLTISSLESEDISTYYCLQHYDTP
Nannospalax galili V1006 igkv AXCS01160425.1 3886 VRCDILMTQSPSLLSASLGDRVTMTCKASQRIGNMLAWYQRKPEEAPKCLIYNTSALENQIPSRFSGSEFGTNYTLTINNLESEDIATYYCQQGYC
Nannospalax galili V1016 igkv AXCS01166060.1 2818 VRCDILMTQSPSLLSASLGDKVTITCKASQNIGTLLAWYQQKPGEAPKLLIYLASTLQTGIPSRFSGSGSGTDFTLTISRLEPEDIGTYYCQQYVNIP
Nannospalax galili V1020 igkv AXCS01167667.1 644 ACGDIIMTQSPRSLAVSAGERVTINCKSSESVSLGYIQYLAWYQQKPGQAPKLLIYLASERESGVPDRFIGSGSGTDFTLTISSVEAEDLADYYCVQHYDSP
Nannospalax galili V1021 igkv AXCS01167687.1 4011 IRCDIQMTQSPSLVSASVGDSVTINCKASQYIGSGLAWYHQKLGNAAKLLIYGASYLETGIPSRFSGSGCGTDFTLTITSLEPEDIAAYFCQQSYGTP
Nannospalax galili V1034 igkv AXCS01172933.1 12161 VRCDILMTQSPSLLSASLGEKVTITCKASQNFFNGLAWYQHKPGEAPKLLINGASILQTGIPSRFSGSGSGTDYTLTISSLEPEDVATYFCHQYTSTP
Nannospalax galili V1035 igkv AXCS01172935.1 603 VRCDILMTQSPSWLSASLGDKVTITCKASQNFFNGLAWYQHKPGEAPKLLINGASILQTGIPSRISGSGSGTDYTLTISSLEPEDVATYFCQQYIYAP
Nannospalax galili V1036 igkv AXCS01172942.1 3628 IRCDTQMTQSPSSLSASLGDRVTITCRASQGISNFLAWYQQKPGTTPKLLIYGASTLHSGVPSRFSGGGSGTQFTLTISSLESGDVGIYYCQQYGYLP
Nannospalax galili V1037 igkv AXCS01172957.1 6029 TCGDIIMTQSPRSLSVSAGQRATMNCKSSQSISSGASHYLAWYQQKPGQAPKLLIYWASTWESGVPDRFVGSGSGTDFTLTISSVQPEDLADYYCQQYYSSP
Nannospalax galili V1084 igkv AXCS01190522.1 485 VRCDILMTQSPSLLSVSLGDRVTITCKASQNIGNWLAWYQQKPGEAPKLLIYDASNLQTGIPSRFSGSGSGTDFTLTISSLEPEDIATYFCQQYTSTL
Nannospalax galili V1097 igkv AXCS01194338.1 8172 SCGDIVMTQTPLSLSVAPGESASISCRSSQSLLDNDGYTYLYWYQQKPGQAPWLLIYEVSKRENGVPQRFSGSGSGTDFTLKISRVEPEDFGVYYCMQA
Nannospalax galili V1098 igkv AXCS01194347.1 22774 TTGSPVMTQSPAFLSVVIGESISIICKASESVSDYVTWYQQKPGQLPKILIYDADNQYSGVPDRFTGIQSGTEFTLKISKLTVDDIGSYYCQQG
Nannospalax galili V1111 trav AXCS01199632.1 1320 DAGAQSVTQPDAHVTVSEAAALELRCTYSYGGTPYLFWYVQYPSQSPQLLVKYFAEDPMVQGMKAFKAEFKKTNSSFHLRKASVHWSDSAVYFCALS
Nannospalax galili V1125 igkv AXCS01210665.1 2302 IRCDIQMTQSPSLVSASVGDSVTINCKASQYIGSGLAWYQQKPGNAPKLLIYGASSLETGIPSRFSGSGSGTDFTLTITSLEPEDIAVYFCQQSYGTP
Nannospalax galili V1131 igkv AXCS01212552.1 786 SSGDTLMTQSPLTLSAVLGESASISCRSSKSSLRSDGNTYLSWCMQRPGQSPPGLIYKVSNRYSEVPDRFIGSGSGTEFTLKISRVEPEDVGDYYCMQHTGFP
Nannospalax galili V1132 igkv AXCS01212553.1 7778 SSGDVVMTQTPLSLSVAPGESASISCRSSQSLVYNDGNTYLRWFLQRPGQSPRLLIYKVSNRYSGVPDRFSGSGSGTDFTLKISRVEPEDSGVYYCMQA
Nannospalax galili V1133 igkv AXCS01212556.1 6695 SCGDVVMTQTPLSLSVAPGESASISCRSSQSLVYSDGNTYLNWFLQRPGQSPQLLIYKVSNRFSGVPDRFSGSGSGTDFTLKISRVDSEDFGVYFCMQGIHYP
Nannospalax galili V1158 igkv AXCS01220847.1 4987 MRCDILMTQSPSSLSASLGDRVTINCKASENIAGGLAWYQQKPGEAPKLLIYHASTLKPGIPSRFSGSGSSTDFTLTISRLEPEDIGTYYCQQYVNIP
Nannospalax galili V1160 trav AXCS01223080.1 845 DAGAQSVTQPDAHVTVSEAAALELRCTYSYGGTPYLFWYVQYPSQSPQLLLKYVSGDSLVQGMKGFQAEFKKTNSSFHLRKASVHWSDSAVYFCALS
Nannospalax galili V1180 trav AXCS01232510.1 68794 AHTQVVQVNDSMYGFIGTDVVLHCSFANPLPSVKITQVTWQKATNGSKQNVAIYNPAMGVSVLAPYRERVEFLRPSFIDGTIRLSHLELEDEGVYICEF
Nannospalax galili V1185 trgv AXCS01332734.1 565 SQASSEERLKSITRQKGSSIVITCDIDKEKRYIHWYRVQEGNAPQYLLNFDFLTSTVAVDSGLSPKKYHAYKGSEKSCNFVLRDVEENDSGVYYCAVWL
Nannospalax galili V1188 ighv AXCS01350809.1 504 VQCEVQLVESGGGLVQPGGSLTLSCVASGFTFSSYGMHWVRQAPGKGLEWTAAISPNSASMYYLESVKGQFTISRDNAKNTLHLQMSGLRSEDTAMYYCAR
Nannospalax galili V1190 igkv AXCS01355837.1 629 SIGDVVMTQTPLSLSVTTGEPASISCRSSQSLLYSDGNTYLEWHLQRPGQNPQLLIYKVSKRVSGIPDRFSGSGSKTSFTLEISRVEPEDFGVYYCFQGTYFP