WGS Statistics
Organism WGS Record. Vs Total IGHV IGLV IGKV TRAV TRBV TRGV TRDV
Pelodiscus sinensis AGCU00000000.1 (AGCU01) 353 117 45 87 60 16 18 10
Vgene Table
Organism Vgene Locus contig Contig Pos. AA sequence
Pelodiscus sinensis Vs720 iglv AGCU01018396.1 7994 SLAQYVLTQPPSVSASPGQNAQLTCSGNNIGSKNVQWYQQKPGSAPLAVIYENNKRPSGIPERFSGTNSGNTATLTITGVQAQDEADYYCQVWDGSA
Pelodiscus sinensis Vs803 igkv AGCU01047415.1 5866 SIGQIVLTQTPESLAVSPGDTVTIRCKASSSASGGIAWYQQKSGQAPKLLIHSASTRPSGIPDRFSGSGSGTDYTFTISRVEAEDAGNYYCLQSVNLP
Pelodiscus sinensis Vs420 ighv AGCU01123281.1 515 ARSQVLVESGGDVKNLGDSLRLSCKASGFTFSSPWMVWVRQAPGKGLEWVAYISGKGDEIDYLNAVKGRFSISRDNPSNLLHLQMTRLKPEDTARYYCAR
Pelodiscus sinensis Vs421 ighv AGCU01123283.1 4580 QLKETGPGAAKPGESLTVTCTISGNSVSSTSATWDWVRQPAGKRPEWLGCTWYRSGTWYTEYPSALQGRVTISPDTARNQVLLQLRSLTAADTATYYCSG
Pelodiscus sinensis Vs589 igkv AGCU01174496.1 32523 SSGQIVLTQTPESLAVSPGDTVTIRCKASSSAGSAMAWYQQKSGQAPKLLIHSASTRPSGIPDRFSGSGSGTDFTFTISRVEADDAGDYYCQQHYSFP
Pelodiscus sinensis Vs588 igkv AGCU01174496.1 26595 SSGQIVLTQTPESLAVSPGDTVTIHCKASSNTYTNLVWYKQKSGQAPKLFIYGASTRPSGIPDRFSGSGSGTDFTFTISRVEAGDAGNYYCQQHTSYP
Pelodiscus sinensis Vs583 igkv AGCU01174494.1 6569 SSGQIVLTQTPESLAVSPGDTVTIRCKASSSLTSGSYQRLAWYQQKSGQAPKLLIYNASTRQSGVPDRFSGSGSGTDYTFTISRVEADDAGNYYCKQH
Pelodiscus sinensis Vs582 igkv AGCU01174491.1 19667 ASGDIVMTQTPESLAVSPGDRVTINCKASTSISSNIAWYQQKSGQAPKLIFYGSSSRPSGIPDRFSGSGSGTDYTLTITSFQAEDAGSYYCQQYSNWPL
Pelodiscus sinensis Vs581 igkv AGCU01174491.1 14556 TNGDIVMTQTPESLAVSPGDRVAINCKASSSVSSYVAWYQQKSGQAPKLIFYGSSSRPSGIPDRFSGSGSGTDFTLTITSFQADDAGSYYCQQYNELP
Pelodiscus sinensis Vs580 igkv AGCU01174491.1 8038 STGQKVLTQTPESLSVSPGDTVTIKCRASESVSTYLHWYQQKSGQAPKLIIHNASTRPSGIPDRFSGSGSGTDFTLTINRVEAEDAGDYYCHQSYIP
Pelodiscus sinensis Vs587 igkv AGCU01174496.1 21543 CSAQTVMTQTPESLSVSVGDTVTIKCKASASISNNINWFQQKPGQAPKLLIYYTSNRYTGVPDRFSGSGSGTDYTFTISRVEADDAGDYYCLQYNNFP
Pelodiscus sinensis Vs586 igkv AGCU01174496.1 16491 TRGDIVMTQTPESLTVSPGDRAAINCKASTSISTNIAWYQQKSGQAPKLIFYGSSSRPSGIPDRFSGSGSGTDFTLTITSFQAEDAGSYYCQQDQSWP
Pelodiscus sinensis Vs585 igkv AGCU01174496.1 8929 ASGETVMTQTPESLAVSPGDRVTINCKASSNVGSYVAWYQQKSGQAPKLLIHSASTRPSGIPDRFSGSGSGTDFTLTITSFQADDAGSYYCQQDYDS
Pelodiscus sinensis Vs584 igkv AGCU01174496.1 4061 STGQKVLTQTPESLLVSPGDTVTIKCRASESVSTYLHWYQQKSGQAPKLIIYNASNRPSGIPDRFSGSGSGTDFTLTINRVEAEDAGDYYCHQSYIP
Pelodiscus sinensis Vs233 trbv AGCU01067676.1 3758 AVSGNSLSQSPAALRHREGERVELNCQYSTSYSSFYLAWYQQRPGAHPMFLLRRSSYNIEYKPDSVPARFSSQLDTGAKSFRLSIAGAQRADTALYFCALWD
Pelodiscus sinensis Vs41 igkv AGCU01009787.1 9870 AKGQVVMTQTPEFLAVSPGDTVTIRCKASSSVGSWMAWYQQKPGQAPKLLIHSASTRPSGIPDRFSGSGSGTDFTFTISRVEPDDAANYYCQQGNNLP
Pelodiscus sinensis Vs40 igkv AGCU01009787.1 1122 SRGQIVMTQTPESLAVSPGDTVTIRCKASSSLTTGADNRLAWYQQKSGQAPKRLIYLASTLQSGVPARFRGSGSGTDYTLTISRIESEDAGDYYCQQ
Pelodiscus sinensis Vs43 igkv AGCU01009787.1 36095 SREQIVLTQMPESLAASPGDRVTVNCKASSSASRWVAWYQQKSGQALKLLIYNAATRASGVPDRFSGSGLGTDYPFTISRVEAEDAGDYYCHQYNSA
Pelodiscus sinensis Vs42 igkv AGCU01009787.1 32836 SQGQIVLTQTPESLSVVPGETVTINCKASSSLTDDDLNADFLAWYQQRPGQAPKLLIYGASTLEDGIPDRFSGSGSGTDFTLTISRVEADDAGDYYCQQSNETP
Pelodiscus sinensis Vs217 iglv AGCU01064920.1 6136 SLAQYVLTQPPSVSVSPGQNAQLTCSGNNIGSKYVYWYQQKPGSAPLLVIYQDSKRPSGIPERFSGANSGNTATLTITGVQAQDEADYYCQVTDSDA
Pelodiscus sinensis Vs216 iglv AGCU01064920.1 980 SLAQYVLTQPPSVSVSPGQNAQLTCTGEKFDKYYVYWYQQKPGQAPQLVIYKDSERPSGIPERFSGASSGKTATLTITGVQAQDEADYYCMVWDKDNS
Pelodiscus sinensis Vs46 trbv AGCU01011083.1 18523 SGLGVLISQFPRTATQRHGERMEITCVQNDTSYTYMYWYKQLKTEGPRLIALSVYGSNATYEKDYNASKFPVTRPNTGTSSMNIVALETQDSASYFCAAS
Pelodiscus sinensis Vs49 trbv AGCU01011086.1 6156 STDVRLNQTLSVVEEREKTVQLQCEQNADHDYMYWYQRHQGKGLHLIYYSYDTSEVKQGNISERFKATRLQTQRFHLNISSLKPEDSAVYFCASSL
Pelodiscus sinensis Vs48 trbv AGCU01011083.1 24086 YSGAWINQTQSLVLEKGYRAQLTCQQTYGHNSMFWYRQDPGQGLQLLFVFVNKDQTDKGNVTNRYRAEQRQAGVLHLDISPVAPEDSAVYFCASSL
Pelodiscus sinensis Vs219 iglv AGCU01064928.1 6084 SLAQYVLTQPPSVSVSPGQNAQLSCSGNNIGSESVQWYQQKPGSAPLLVIYDDSSRPSGIPERFSGDKSGNTATLTIAGVQAQDEADYYCQVWDSSSDQ
Pelodiscus sinensis Vs218 iglv AGCU01064928.1 1788 SSSQNVVTQPPSASVSPGNTVKLSCTMSSGTSISDYTVRWYQQKPGNSPRYLLSYKSDSDKHQGSGVPARFSGSKDTSSNSGYLTIFGSLVEDEADYYCAV
Pelodiscus sinensis Vs3 ighv AGCU01002833.1 433 ARSQELVESGGDVKKPGDSLRLSCKASGFTFSSYHMNWVRQAPGKGLEWVAFIYTDGSGPSYADAVKGRFTISRDNPNNLLHLQMTGLKPEDTARYYCA
Pelodiscus sinensis Vs4 ighv AGCU01002835.1 2094 TLKETGPGAAKPGESLTVTCTISGDSVSNTGVAWDWARQPAGKGLEWAGRIYYRSTGWHTQYPSALQGRVTISPDTSRNQVSLQLRSLTAADTATYYCTR
Pelodiscus sinensis Vs215 iglv AGCU01064919.1 912 SLAQYVLTQPPSVSVSPGQNAQLTCSGNNIGSKSVQWYQQKPGNAPLLVIYGSNSRPSGIPERFSGAKSGNTATLTITGVQAQDEADYYCQVWDSGA
Pelodiscus sinensis Vs6 ighv AGCU01002835.1 23501 VLAQVQLVQSGPGAVKPGETLTLSCAVSGFSISTQYYPWNWIRQPPGKGLEWMGHVHPYDRSARYARSLQGRVTISGDTAKNQLSLEIRSLTAADTATYYCTG
Pelodiscus sinensis Vs7 ighv AGCU01002836.1 5914 QLKETGPGAVKPGESLTLTCTISGDSVSSTSATWNWIRQPAGQGLEWVGRIYYRSSGWSTNYASALQGRVTIAQDTAKNQFSLQLRSLTAADTATYYCAR
Pelodiscus sinensis Vs8 ighv AGCU01002837.1 1739 VLAQVQLVQSGPGVVKPGETLTLTCAVSGFSVSTNGYVWNWIRQPPGKGLEWKGFVYPYNSGETGYAPSLQGRVTISADTARNQFSLQLRSLTAADTATYYCAR
Pelodiscus sinensis Vs9 ighv AGCU01002837.1 10931 VLSQVQLVQSGPGSVKPGETLTLICAVSGESLSVGNYWNWIRQPSGKSLEWMGQGDFRSSGWYTIYAPSFQSRVTISADSSKNQVSLQLRSLTAADTATYYCAR
Pelodiscus sinensis Vs214 iglv AGCU01064916.1 2050 SLAQYVLTQPPSVSVSPGQNAQLTCSGNNIGSKSVQWYQQKPGSAPLLVIYQGSSRPSGIPDRFSGANSGNTATLTITGVQAQDEADYYCQVSDSDA
Pelodiscus sinensis Vs455 ighv AGCU01138021.1 8562 ATSQIQLTQSGAEIKKPGESVKLTCKTSGYTFTSNDINWFRQAPGERPEWVGYITPSSGSTGYVPAFQGRVIITRDNSISTAWLQLGSLRADDTATYYCAR
Pelodiscus sinensis Vs454 ighv AGCU01138021.1 3862 GPVRPGDGEARRDPHPELRCLGCLGLHPSQNLRLGAQPVGKGLEWVGGVYDGATATYAAESFQSRVTLSADTARNQLSLQLRALTAADTATYYCARKR
Pelodiscus sinensis Vs456 ighv AGCU01138035.1 698 VRSQVRLVESGGDVKKPGDSLRLSCKASGFTFGDYWMSWIRQAPGKGLEWVARISYWAGTTIHYASSVQGRFTISRDNPNNLLHLQMTGLKPEDTARYYCARD
Pelodiscus sinensis Vs510 iglv AGCU01152935.1 12486 VRSQPVVTQEPSMSVTPGGAVTLSCSLSTGAITTGNYPSWYQQKPGSVPLMLIYETNKRPSGIPARFSGAISSNDAALTITGVQAEDEADYYCAVWASSA
Pelodiscus sinensis Vs34 igkv AGCU01009784.1 8230 AKRQVVMTQMPEFLAVSPGDTVTIRCKASSSVYGNMAWYQQKSGQAPKLLIHSASTRPSGIPDRFSGSKSGTDITFTISRVEADDAGDYYCQQGSS
Pelodiscus sinensis Vs35 igkv AGCU01009784.1 13541 AKGQTVMTQTPESLAVSPGDTVTIRCKASSSVSNRVAWYQQKSGQAPKLLIHSASTRPSGIPDRFSGSGSGTDFTFTIGPVEPDDAGDYYCQQGWSLP
Pelodiscus sinensis Vs36 igkv AGCU01009785.1 2328 TRGDIVMTQNPESLAKSPGDRVTINCKASSCLSDYLAWYQQKTGQAPKLLIYFASTRNSGSPSRFIDSGSGTDFTLTISRVEVDDAGDYYCQQDYETP
Pelodiscus sinensis Vs37 igkv AGCU01009785.1 5733 AKGQIVLTQTPESLAVSPGDTVTIRCKASSSVGTAIAWYQQKSGQALKLLIHSASTRHSGIPDRFSGSGSGTDYTFTISRVEADDAGDYYCQQGYLPLIV
Pelodiscus sinensis Vs33 igkv AGCU01009784.1 3504 AKGQTVPTQMPESLAVSPGYTVTIRCKVSFSVDSYMAWYQQKLGEAPKRLIYAASTHPSGIPDRFRGSGSGTNFTFTISQVEADDADYYCQQGYIP
Pelodiscus sinensis Vs38 igkv AGCU01009785.1 10003 AKGQTVMTQTPESLAVSPGDTVTIRCKASSSVSNYMAWYQQKSGQAPKLLIHSASTRPSGIPDRFSGSGSGTDFTFTISRVEADDAGDYYCYQGYS
Pelodiscus sinensis Vs39 igkv AGCU01009786.1 2357 AKGQIVLTQTPESLASSPGDTVTIRCKASSSVSNVMAWYQQKSGQAPKLLIYAASTRPSGVPDRFSGSGSGTDFTFTIRQVEADDAGDYYCQQGYS
Pelodiscus sinensis Vs816 trav AGCU01052330.1 2228 ASFTVLQFPSEVGVIQGASATLNCTFTQGLSPGKGAVSWSRVGPGGEVTVPLTARFMLAYPDTFLHRGEGTLAIANVSLEDAGKYICRVLLW
Pelodiscus sinensis Vs811 ighv AGCU01050896.1 1832 ARSQLQLQESGPGAVKPGETLTLTCSVTGGTVTGSYYWHWIRQAPGQGLEWMGLWSDYTSYNPSLQGRIAITVDSSSTKYYLRLSSLTAADTATYFCA
Pelodiscus sinensis Vs819 ighv AGCU01052806.1 36282 GQSQVQLVQSGAEVKKPGDSLKISCKTSGFSLPSYYMSWLWQASGKGLVWIGRIDPANGATIYASSFKDQFTITTENSISTMYLQFSSLRAEDMALYYCA
Pelodiscus sinensis Vs979 trgv AGCU01093523.1 20059 GHTQKTVTQTPISITRQKDKTAVMHCEIPGATINSENIHWYRQSPGAAPKRILYAQATSVTVDEGIDKGRFEVSNVASKNRSTLHMHRLTPEDTAMYYCAVWD
Pelodiscus sinensis Vs5 ighv AGCU01002835.1 10673 AWSQVQLVESGGDVRKPGDSLRLSCKASGFTFSSHWMGWVRQAPGKGLEWVAYIRYDGGSTYYLDAVKGRFTISRDNPNNLLHLQMTGLKPEDTARYYCA
Pelodiscus sinensis Vs772 igkv AGCU01036040.1 1139 AKGQIVLTQTPESLAVSPGDTVTIRCKASSSVGSLMAWYQQKSGQAPKLLIHSASTRPSGIPDRFTGSGSGTDFTFTISRVEADDAGDYYCQAA
Pelodiscus sinensis Vs675 trbv AGCU01011099.1 2424 QTDAKITQTSSLVLERGQTAYLRCQQTYQHDSMFWYRQDTGQGLQLLFYFNFKEEREKGKNLTRFQADQPQDDLLRLNISSVLVEDSAVYFCASKP
Pelodiscus sinensis Vs674 trbv AGCU01011097.1 4768 YTGAKITQTSSLVLNREEAAKLTCRQTDDHSYMYWYLQQQGKGLQLIYYSVGKDTTPEGDSKIKGFSASRPETAAFDLNISLVKPEHSAVYFCASSL
Pelodiscus sinensis Vs676 trbv AGCU01011102.1 6819 VHSATILQSPQSVVEELDRNASLECSVEGTSNPNIYWYRQLPSGVINMLAYSIGTSQAHNTGPRHFKPSRTNDTMLLLNITGLLANDTGVYYCAWS
Pelodiscus sinensis Vs671 trbv AGCU01011092.1 21957 YTGAKITQTSSLVLNREEAAKLTCRQTDDHSYMYWYLQQQGKGLQLIYYSVGKDTTPEGDSKIKGFSASRPETAAFDLNISSVKPEHSAVYFCASSL
Pelodiscus sinensis Vs670 trbv AGCU01011090.1 3780 YTGAEITQTESLVLAKGQTANLTCRQTDTHNNMYWYQQQQGKGLQLIYYSVAEKNTEEGDSKSGFSAFRPEIQVFYLDIPSVKPEHSAVYFCASSL
Pelodiscus sinensis Vs673 trbv AGCU01011095.1 6188 QTDAKITQTSSLVLERGQTAYLRCQQTYQHDSMFWYRQDTGQGLQLLFYFNYKKEIEKGENLTRFQADQPQDDLFRLNISSVQVEDSAVYFCASKA
Pelodiscus sinensis Vs555 ighv AGCU01169427.1 3013 AAAQAQLVESGGDTKKPGEFLRLTCKGSGFDFSQFGLHWFRQAPRKGLEWVSVIIYDGSQEYYAESVKGRFTTSRDNSLSQAYLDRSSLEPEDTARYYCAA
Pelodiscus sinensis Vs556 ighv AGCU01169428.1 728 VRCQVLVESGGDVKKPGDSLRLSCKASGFIFSSLYMDWVRQAPGKGLEWVAHINPSLWTAYADSVKGRFTISRDNSQSTLYLPMTGLRPEDTARYYCAG
Pelodiscus sinensis Vs557 ighv AGCU01169430.1 1717 ARSQVQLVESGGDVKKPGDSLRLSCKASGFAFSDYTMEWIRDVPGKGFQWVGGINTGLVAAYQDSVKGRFTISRENSQSALYLQMTGLKPEDTARYHCA
Pelodiscus sinensis Vs558 ighv AGCU01169430.1 5882 ASSQVQLTQSGAEVKKPGESVKLTCKTSGYTFTSYGISWVRQAPGKGLEWTGYINTNTGGTGYASAFGGRVTMTRDTSISTVWLQLGSLRADDTATYYCAR
Pelodiscus sinensis Vs559 ighv AGCU01169431.1 738 ARCQVQLVKSGGDVKKPGDSLRLSCKASGFTFSSYWMSWVRQAPGKGPEWVSDISADGGTKRYADSVKGRFTVSRDNSNNLLYVQMTGLRPEDTARYYCAS
Pelodiscus sinensis Vs418 igkv AGCU01122102.1 4250 SSGQTVMTQTPESLAVSPGDTVTIRCKASSSIGAAIAWYQQKSGQAPKLLVYAASSRPSGVPDRFSGSGSGTDFTFTISRVESDDAGDYYCQQYTNFP
Pelodiscus sinensis Vs413 igkv AGCU01122100.1 4301 CLGQVVMTQSPESLSVPLGGRVSINCKASTSIGSSLSWYQQKPGQAPKLLIYSATSLQSGIPTWFGGSGSGTDFILTITNVQADDAADYYCQQYNSYPL
Pelodiscus sinensis Vs412 igkv AGCU01122099.1 17019 SSGQVVMTQTPESLSVPVGGRVSINCKASTGITNDLHWYQQKPGQAPKLLIYYASSLQSGVPARFSGSGYGTDFTLTINSVEADDAGDYYCQQSNKLP
Pelodiscus sinensis Vs415 igkv AGCU01122100.1 20340 CSGQIVMTQSPESLSVPVGGRVSINCKASTSIGTCLNWYQQKPGQAPKLLIYYANTLQSGVPARFSGSGSGTDFTLTISSVEADDAGDYYCQQCGSYP
Pelodiscus sinensis Vs414 igkv AGCU01122100.1 15059 CLGQVVMTQTPESLSVPVGGRVSINCKASTSISNSLHWYQQKPGKAPKLLIAYASSLQSGVPARFSGSGSGTDFTLTISSIEADDAGDYYCQQSSSWP
Pelodiscus sinensis Vs417 igkv AGCU01122102.1 1786 CLGQVVMTQTPESLSVPVGGRVSINCKASKSISNSLHWYQQKPGQAPKLLIYSATNLQSGIPAWFSGSGSGTDFILTITNVQADDAADYYCQQGNEFP
Pelodiscus sinensis Vs416 igkv AGCU01122101.1 1211 SSGDTVMTQSPESLSVSAGESVTIRCKASSGISNHIAWYQQKSGKAPKLLIYEASTRDTGVPDRFSGSGSGTDFTFTISRVEADDAGDYYCQQYNNWP
Pelodiscus sinensis Vs323 trav AGCU01092512.1 6036 SALGDSIHSKDPAVSGSAGGSVTLSCDYTTSDSYVYLYWYRQYPNGAPQYLLSRGARTYSGQSDTAGFAQDRFASQADDNSTALTITALERADTAVYFCALRP
Pelodiscus sinensis Vs322 trav AGCU01092512.1 4228 MIRTDSVSQSPGEVTVSEGQDALLHCNFTTLSTGPILFWYRQYPNQPPQLVLTAYKSAEARNTFTDGRFSAVLFDQNRTVPLRVAAASLPDGAVYLCALS
Pelodiscus sinensis Vs321 trav AGCU01092511.1 13472 RAQGDSVSQSPPEVRIPEGRSVTLLCNFTSSYSDPYLFWYRQDPDQPPLHILTKATYNALDQTPVHGKFSASLHKENKTVALRIEKVSPQESAVYFCALR
Pelodiscus sinensis Vs320 trav AGCU01092511.1 11261 RAQSDSVSQSPPEVRIPEGRSVTLHCNFTTGDPDPYLFWYRQGPDQPPQHILTKRKYNALEQTPVQGKFFASLYLGNRTVSLRIEKVSPQESAAYFCALR
Pelodiscus sinensis Vs327 trav AGCU01092514.1 5104 VPGRARIQQLGSAEDLEGAEVNLTCSHAEITPSENIQWYRQSPGRGPQYIVQGFKGTVPSSEPEGALHIPEDRKSSALVLRRARLADAAVYYCALG
Pelodiscus sinensis Vs326 trav AGCU01092514.1 3176 SCCDAQVTQTPERLERSQGEVATMSCSYTSTYRTFYWYQQLPGGGPTHLLTVSSAENRTAGWFIGERLDSGKRSSLHNSASQLGDSGSYLCAVD
Pelodiscus sinensis Vs325 trav AGCU01092513.1 3271 SSMEDSVTQTQRSESALERESVSLDCTYETSEQYYYLYWYKQPPRGSLIPLFWQHSGGTKGNEAGERFSVNFEKDKSSISLRITALELGDAATYFCAFSR
Pelodiscus sinensis Vs324 trdv AGCU01092512.1 12198 PSMEDTVRQTPPAAARHEGGAVTLDCTYETDASYYTLYWYKQQPAEKPVFLLWEYSGGTRENQAGERFSADFKKSQSSISLRITGLKPRDSAVYFCAFSRG
Pelodiscus sinensis Vs329 trav AGCU01092514.1 10024 SSMEDSVTQTQPSASGLERESVSLECTYETSEQYYYLYWYKQPPRGSLIFLFRQYSEGAKKNEAGERFSVSFEKGKSSISLRITALELGDAATYFCAFSR
Pelodiscus sinensis Vs328 trav AGCU01092514.1 7187 SSMEDSVTQTQRSESALERESVSLDCTYETSLSDYFLYWYKQPPRGSLIFLLWQHSAGAKKNEAGERFSVNFQKDKSSISLRITALELGDAATYFCAFSR
Pelodiscus sinensis Vs850 ighv AGCU01057432.1 1476 VWSQIQLIQSGAEVKRAGDSAKLSCKATGYTYTDQGMHWARRAPGKGLEWVSSITHGAGDTQYYADSVKGRFTISRDNSQNLLFLRMAGLRPEDTAVYYCARWG
Pelodiscus sinensis Vs394 ighv AGCU01111971.1 695 ARSQVQLVESGGDVKKPGDSLRLSCKASGFTFSSYWMLWFRQAPGKGLEWVSSISEDGSSTSYADSLKGRVTISRDNPNNLLHLQLTGLKPEDTARYYCV
Pelodiscus sinensis Vs395 ighv AGCU01111975.1 833 ARSQINLVETGGDVKKPGDSLRLFCKASGFNFGSSGMSWMRQAPGKGLEWVAHLYWDRWDRAIYADRVKGRFTTSREPSESLLYLQMTGLEPEDTGRYHCARDRQ
Pelodiscus sinensis Vs392 ighv AGCU01111970.1 1732 VRSQIQLVQSGPGAVKPGETLTLSCAVSGSSISSGSDWSWIRQAPGKGLEYMGYVYGPSGGTNYAPAFQSRITITRDTAKNQFSLQLRSLTAADTATYYCAR
Pelodiscus sinensis Vs393 ighv AGCU01111970.1 4228 PILGFKMTQSGSGEVTVSGSLSLTCAVSDSALSTGSDWWHWLRQPPGKGLVWLALIDRYGNTIYLPDIHKRATITVNPSKNEFSLRVENLTPQDTGTYYCAR
Pelodiscus sinensis Vs390 ighv AGCU01111634.1 1222 VLAQVQLVESGPGTVKPGETLALSCAVSGYSIASTYSCDWLRQPPGKGLEWMEYVHPYDRSARYARSLQGRVTISGDTAKNQLSLEIRSLTAADTATYYCTG
Pelodiscus sinensis Vs258 ighv AGCU01076303.1 2881 ANSQIQLTQTGAEIKKPGESVKVTCKTSGYTFTDYCISWVRQAPGEVLEWLGYICPSAGSTSYAPAFQGRVTLTRDNSISTAWLQLGSLRADDTATYYCAT
Pelodiscus sinensis Vs932 igkv AGCU01076867.1 7331 ASGQIVLTQTPDSLAVFPGDTVTIRCKASSSLILGSYHRLAWYQQKSGAAPKLFIYYASSRVSGVPDRFSGSGSGTDFTFTISRVEAADAGEYYCLQHYSYP
Pelodiscus sinensis Vs933 igkv AGCU01076867.1 2778 AKGQIVMTQTPESLAVSPGDTVTIRCKASSSVSNYMAWYQQKSGQAPKMLIYLASTRPSGIPDRFSGSGSGTDFTFTINRVEADDAADYYCQQGSS
Pelodiscus sinensis Vs930 igkv AGCU01076867.1 30587 SSGQIVLTQTPESLAVSPGDTVTIRCKASSTLTSGSYHYLAWYQQKSGQAPKLLIYAGSSLQSGVPARFSGSGSGTDFTLTINRVEAEDAGDYYCQQYRNL
Pelodiscus sinensis Vs931 igkv AGCU01076867.1 23123 SSGQIVLTQTPESLAVSPGDTVTINCKASSSLTHSSSGKELLAWYQQKSGQAPKLLIYYATTLRSGVPARFSGSRSGSDYTLTISRVETDDAGDYYCQQDKSFP
Pelodiscus sinensis Vs987 trgv AGCU01093525.1 1521 GAAQVQLIQTQLSMTKKPGNTAWINCKVDGINFGDAYIHWYRQRPGEAPQWLLYFKTQRDKSYSNEDKFRVEKIPEKSTCILVVQKVTYSDTATYYCAYWD
Pelodiscus sinensis Vs986 trgv AGCU01093525.1 7120 GAAQVQPTQTPLSITKPPDRTVRMDCEVEISNFENTYIHWYRQRLGEAPEWLLYFQSPTQQSNFDKEKFGISKTTGKPKCTLAVHKVNFDDAATYYCAYWD
Pelodiscus sinensis Vs985 trgv AGCU01093525.1 9184 GAAQVQLTQTQISITKIPKKTVRMDCKISGIDVGSAYIHWYRQRPGEAPEWLLYYKTQNDQSNFDKDKFSIDKTSGKPICTLTVDKLTYNDTATYYCATW
Pelodiscus sinensis Vs983 trgv AGCU01093525.1 17240 GEAQVLVQSQLSLTRVEDKTARIDCRVSGITFSSAYIHWYRQKRDAAPERILYLSSGKPVFDQDYEKAKYEAEKQLSESNCVLTVKKITKSDAAIYYCAVW
Pelodiscus sinensis Vs982 trgv AGCU01093524.1 5971 GAAQVQLRQNQLSITHKPDKTVRIDCQVSISDFGNTYIHWYRQRLGEAPEWLLYFKTESEYLNPNRNKFGAYKKPGKDTCTLTVDLLTYNDTATYYCAAWD
Pelodiscus sinensis Vs981 trgv AGCU01093523.1 7347 GHAQKSVTQTPISITRQKGKTAVMLCKIPGATINSEYIHWYRQSPGAAPKRILYAQATSVTVDEGIDKGRFEVSTVASEHVSILRMHQLTPEDTAMYYCAVWD
Pelodiscus sinensis Vs980 trgv AGCU01093523.1 16408 GAAQVQLIQTQLSITKKPDSSTARINCKVDGINFGDAYIHWYRQRPGEAPEWLLYYKTDSDSSNPNRNKFGAYKIPGKDTCTLTVDPTYNDAATYYCAAWD
Pelodiscus sinensis Vs730 iglv AGCU01018407.1 9907 VRSQPVVTQEPSMSVTPGGAVTLSCSLSTGAITSSNYPAWYQQKPGSAPQLLIYNTNNRPSGIPDRFSGAISGNKAALTITGVQAADEADYYCSVWASSA
Pelodiscus sinensis Vs989 trgv AGCU01093526.1 31607 GCAQIQLEQAQLSVTRAEARTARIDCKASGISNFRSAFLHWYRHRPSNPPERILYISTGKPVYDKETDKSIFDCDKKSDESISTFIIKELSRNDRATYYCAYWD
Pelodiscus sinensis Vs988 trgv AGCU01093526.1 40201 GCAQIQLKQAQLSVTRAEARTARIDCEASGISNFKSAVLHWYRHKPGNAPVRILYISTDKPVHDTDTDKKKFDCIKKSDQPVSTLIINGLTRDDRATYYCAYWD
Pelodiscus sinensis Vs594 igkv AGCU01174498.1 5692 SSGQIVLTQTPESLAVSPGDTVTIRCKSNSSVSSYMAWYQQKSGQAPTLLIYDASTRQSGVADRFSGSGSGTDFTFTISRVEADDAGDYYCQNHNSYP
Pelodiscus sinensis Vs595 igkv AGCU01174498.1 9258 ASGQIVLTQTPESLAVSPGDTVTIRCKARSSASGYMAWYQQKSGQAPKLLIYSASTRPSGIPDRFSGSGSGTDFTFTISRVEADDAGDYYCQQYSSTP
Pelodiscus sinensis Vs596 igkv AGCU01174498.1 14099 SSGQIVLTQTPESLAVSPGDTVTIRCKTSSSVGSEMAWYQQKSGQAPKLLIYYASSRPSGVPDRFSGSGSGTDFTFTIGRVEADDAGDYYCQQHY
Pelodiscus sinensis Vs597 igkv AGCU01174500.1 9485 SSGQIVMTQTPESLAVSPGDTVTIRCKASSNAGSEMSWYQQKSGQAPTLLIYGASTRQSGVPDRFSGSGSGTDFTFTISRFEAGDAGDYYCQQDYSFP
Pelodiscus sinensis Vs590 igkv AGCU01174496.1 37282 SSGQIVLTQTPESLAVSPGDTVTIRCKASSSVSYMAWYQQKSGQVPKLLIYDASSRPSGIPDRFSGSGSGTDYTFTISRVEAGDAGDYYCQSYYSSS
Pelodiscus sinensis Vs591 igkv AGCU01174496.1 40873 SSGQIVLTQTPESLAVSPGDTVTIHCKASSSVSSWMAWYQQKSGQAPKLLIYRASNRPSGVPDRFSGSGSGTDFTFTISRVEVDDAGDYYCQQY
Pelodiscus sinensis Vs592 igkv AGCU01174497.1 4410 SSGQMVLTQTPESLAVFPGDTVTIRCKASSSVGRWMSWCQQKLGQVPKLLIHTASTRLSGVPDRFSGSGSGTDFTFTIRRVEADDAGDYYCQNHNNSP
Pelodiscus sinensis Vs593 igkv AGCU01174497.1 9275 SSGQIVTQTPESLAVSPGDTVTIRCKASSSVGSYMAWYQQKSGQAPKLLIHSASTRPSGVPDRFSGSGSGTDFTFTISRVEADDAGEYYCQKYNSSP
Pelodiscus sinensis Vs598 igkv AGCU01174500.1 12015 SSGQIVMTQTPESLAVSPGDTVTIRCKASSNAGSEMSWYQQKSGQAPTLLIYGASTRQSGVPDRFSGSGSGTDFTFTISRFEAGDAGDYYCQQDYSFP
Pelodiscus sinensis Vs1049 igkv AGCU01113042.1 3333 SSGQVVVTQTPESLAVSPGDTVTIRCKTSSSVSGWMAWYQQKSGQAPKLLIHSASTRPSGIPDRFSGSGSGTDYTFTISRVEADDAGDYYCQKH
Pelodiscus sinensis Vs186 ighv AGCU01053381.1 515 GSPTAHSRSIATSKGLTLHHTNYCMSWVRQEPGKGLEWLVSYWKPGSEYYSPTIQGRFTASKDSANFYLQMTSLRAEDSAVYYCARGTARE
Pelodiscus sinensis Vs185 trav AGCU01053351.1 1083 MIRADSVSQSPGEVTISEGQDALLHCNFTTISTSPTLFWYRQYPNQEPQHVLTAYKSADAQNTFAAERLSAVLFDQNRTVPLRVAAASLPDGAVYLCALR
Pelodiscus sinensis Vs184 trav AGCU01053350.1 5661 QAQGDSVSQWPPEVRIPEGRSATLLCNFTTSDINPNLFWYRQDPSQPPQHILTKTRYDPPEQTLVQGKFSASLDMGNKTVALRIEKVSPQESAVYFCALR
Pelodiscus sinensis Vs183 trav AGCU01053349.1 506 TLGDSLRQSAGPVLVQAGAPLVIECTHESVVFPYLMWYVQRPGEAPALWLRDKASGGGQDPGDSRGFFAHHVQDEKSFHLRKNTSEVSDSARYFCAFS
Pelodiscus sinensis Vs182 trav AGCU01053347.1 8626 GTFGAESVTQSEGSFAISQGDRLDLNCTYELLSTYPSLFWYVQYPGQAPRMLLQDSDEGTRKGFGATHDKKDKSFPLWKASVELSDSATYYCAGS
Pelodiscus sinensis Vs181 trav AGCU01053347.1 7632 GTFGADTLIQAEGSVGFTHGDGLRLNCTYTFSGTPYLFWYVQYPGQGPRMLLRELGGQDSDEGIRRRFSATLDEQNKSFPLWKASVELSDSATYYCAGS
Pelodiscus sinensis Vs180 trav AGCU01053347.1 4483 APGLAKIQQPGTAEAVEGAEVNLTCSHADISPNENIQWYRHFPGRGPQYIVQGFKGTVPSSEPEGALHISGDRKSSALALPRARLADAAVYYCALS
Pelodiscus sinensis Vs748 ighv AGCU01024777.1 1400 LLQETGPGAAKPGESRTLTCTISGDCIATVSAAWHWLRQPAGKGLEWVGRTWYRSGQWNTEYNSALRGRATLPADTARNQVSLQLRALTAADTGTYYCARQ
Pelodiscus sinensis Vs169 trav AGCU01052777.1 733 GTCLSEITQPPGQSGAQGSDATIPCAHDVADGIYDSVYWYRREAGRALTYLGHSYRGEQKSGRFGVYVDRANRSSLLTIRALEPGDRAVYYCALQ
Pelodiscus sinensis Vs890 ighv AGCU01070855.1 1988 VRSQIQLVQSGPGAVKPGETLTLTCAVSGYTITSGYGWNWIRQPPGTGLEWLVSGYYSSSKWNTDYSPSFQSRVTNSLDSSKNQFSLQLRSLTAADTATYYCT
Pelodiscus sinensis Vs299 trav AGCU01092500.1 448 GTSRADSVNQTQGSIIISEGDPLRLSCTYKFSAPPDNLFWYVQYPRQAPRLLLRDLGRQDSDEGIRKRFNATHEKQNKSFHLRKPAGQVSDSATYYCAGR
Pelodiscus sinensis Vs298 trav AGCU01092499.1 4564 GMSRADSVTQTEGSVDISQGDPLSLNCTYQFSVTYPPYPFWYVQYPGETLRMLLRDLGRQDSDEGIRKGFNATHEKENKSFHLWKASVDLSDSATYYCAAS
Pelodiscus sinensis Vs116 ighv AGCU01038003.1 387 VLSQVQLVQTGPRAVKPGATLSLTCKISGVSVSSYYWSWARQPPGKGLEWLGFIRDTANGGTAEYNSAFKPRVTITRDTSKEEVYLQLGSLTAVDTATYYCAR
Pelodiscus sinensis Vs117 ighv AGCU01038003.1 3388 VRSQAQLVQSGPGTVKPGETLTLSCAVLGVSITDSTYSWHWVRRPLGKGLEWMGFVYPYDGDTGYAPSVRGRVTISGDTARNQFSLQLRSLTAADTGTYYCAR
Pelodiscus sinensis Vs118 ighv AGCU01038003.1 6205 VSSQVQLTQSGAEIKKPGETVKLTCKTSGYTFTSYWMQWVRQTPGKSLEWVGEINPNSGSTNYAPAFQGRVTITRDNSISTSWLQLGSLRADDTATYYCAT
Pelodiscus sinensis Vs119 ighv AGCU01038003.1 14619 ASSQVQLTQSGAEIKKPGESVKLTCKTSGYTFTDHWIHWVRQAPGKGLEWVGYIDPSSGSTGYASAFQGRFTITRDNSMTTSWLQLGSLRADDTATYYCAP
Pelodiscus sinensis Vs297 trav AGCU01092499.1 1596 GASGADTVTQTEGNVVISQSDSLRLNCTYELSFTPDNLFWYVQYPGQAPRMLLRDLARQDSDEGIRKVFGATHEKQHKSFHLWKPSIELSDSATYYCAAS
Pelodiscus sinensis Vs296 trav AGCU01092499.1 72 APGRAQIQQPGSDKASEGAEQNLTCNHPAITTSDSVFWYRQFPGRGPQFIVSGYSGTANSSDPEGALHIPGDRKSSALALRRARLADAAVYYCALG
Pelodiscus sinensis Vs449 ighv AGCU01135517.1 404 ARSQVLVESGGDVKKLGDSLRLSCKASGFTFSSPWMVWVRKAPGKGLEWVAYISGKGDEIDYLNAVKGRFIISRDNSNNLLYLQMTRLKPEDTARYYCAR
Pelodiscus sinensis Vs50 trbv AGCU01011086.1 10652 GTDAGLTQTPNLILMTGQTAHLRCEQTDEHYIMYWYWLQQGKGLQLIYSSVINSVQSEGDDSIQGFTASRPEISLFHLTISSVTVNHSAVYFCTNSRPAEE
Pelodiscus sinensis Vs51 trbv AGCU01011087.1 28751 LCEESEQMVLSQVPRWVTLKTGTLAILHCYQNNTDHSWMYWYRQPTTQLGPELIGVLIKGTPDPTFEENFKDSRFGMARDNDRHCMLQINQLSPGDSALYFCAS
Pelodiscus sinensis Vs947 ighv AGCU01081355.1 2796 AQSQVQLVESGGDVKKPEDSLRVSCKASGFTISSPCMDWVRQAPGKRLEWVAATNEAGSSQRYSPAVQGRFTISRDNPNNLLFLQMTDLKPEDTARYYCA
Pelodiscus sinensis Vs946 ighv AGCU01081245.1 1580 VCSQVQLIPSGPGAVKPGETLTLSCAISGDSVTSNWWDWIRQAPGKGLEWVGEIDWSDSKWRINYGPAFQSRATLSADSSKNQFSLQLRSLTAADTATYYCAR
Pelodiscus sinensis Vs795 ighv AGCU01044193.1 3876 ARSQALVESGGDVKKPGDSLRLSCKASGFTFSDYNMNWVRQAPGKGLEWVASISSGSGSYIYYLDAVKGRFTISRDNPNNLLHLQMTGLRPEDTARYYCA
Pelodiscus sinensis Vs499 ighv AGCU01152623.1 890 VLAQVQLVQSGPGTVKPGETLTLSCAVSGFSISTQHYSWSWIRQPPGNGLEWVGSVYPYNSGETAYAPSLQSRVTVSGDTAKNQVSLQLRSLTAVDTGTYYCAR
Pelodiscus sinensis Vs701 igkv AGCU01016649.1 1336 SRGQTVLTETPESLAVSPGDTVTICCKASSSLTLGSTHLLAWYQQKSEQAPKLLIYDASTRASGIPDRFTGSGSGTDFTLTISNVQAEDAGDYYCQQGF
Pelodiscus sinensis Vs703 igkv AGCU01016651.1 762 AKGQIVLTQTPESLAVSPGDTVTIRCKASSSVSSYMAWYQQKSGQVPKLLIHSASTRPSGIPDRFSGSGSGTDFTFTISRVEADDAGEYYCQQAQSWP
Pelodiscus sinensis Vs702 igkv AGCU01016650.1 5418 TKGETVMTQTPESLAVSPGDTVTIRCKASEGITGTYTYLAWYQQKSRQTPKLLIYRVSTRASGIPDRFTGSGSGTDFTLTISNIQAEDAGDYYCQQGYNL
Pelodiscus sinensis Vs121 ighv AGCU01038004.1 10410 VRSQIQLVQSGPGAVKPGETLTLTCAVSGYTITSGYGWNWIRQPPGTELEWLVSGYYSSSKWNTDYSPSFQSRVTNSLDSSKNQFSLQLRSPTAADTATYYCAR
Pelodiscus sinensis Vs120 ighv AGCU01038004.1 3104 ARSQISLVESGGDVKKPGDSLRLSCKASGFTFTSYWMGWVRQAPGRGLEWLAHIHGSSIYYSDSVKGRFTVSRDDPSSLLHLQMTGLKPEDTARYFCAR
Pelodiscus sinensis Vs123 ighv AGCU01038004.1 18094 RCAPEGLGNVKKPGDSLRLFCKTSGFTFSSYWMLWFRQAPGKGLEWFAQIHGSTTYYSDSVKGRFTVSRDDRRSLLHLQMTGGKPEDTARYYCV
Pelodiscus sinensis Vs122 ighv AGCU01038004.1 15734 ASSQIQLTQSGAEIKKPGESVKLTCKTSGYTFTDYCINWVRQTPGKGLEWMGYICPSDGSTSYASAFQGRVTMTRDNSITTAWVQLGSLRADDTATYYCAR
Pelodiscus sinensis Vs125 ighv AGCU01038007.1 1074 ARSQELVEFGGAEKKAGDTLRLFCKASGFNFGSSGMSWMRQAPGKGLEWVAHLYWDRWDRAIYADRVKGRFTTSREPSESLLYLQMTGLEPEDTGRYHCARDRQ
Pelodiscus sinensis Vs124 ighv AGCU01038004.1 20638 ALSQLQLQESGPGAVKPGETLTLTCSVTGGTVTSSNYWHWIRQAPGQGLEWMGYWSGGTSYNPSLQGRIAITVDSSSTKYYLRLSSLTAADTATYFCA
Pelodiscus sinensis Vs126 ighv AGCU01038008.1 1218 ARSQVQLVESGGDVKKPGDSLRLSCKASGFTFTDYSMLWVRQAPGKRLEWLAQIRPDASAQWYSPAVQGRFTISRDNPNNLLHLQMTGLKPEDTARYYCAR
Pelodiscus sinensis Vs179 trav AGCU01053347.1 3017 APGRAKIQQPGSAEALEGEELNLTCSHGGIQGYEYIYWYRRFPGQGPQYIVHGLKENAETSEPEGALHISGDRKSSALVLRRARLADAAMYYCALG
Pelodiscus sinensis Vs409 iglv AGCU01120893.1 5557 GRCQRASFSQSPSEISVSPGETATLECAVANVGADTVVVIWIRQSPGQKPEGVLYMTTDLSVYRAQGIPERFESSRDAANKKFLLTICQVQAGDDSVYFCFAF
Pelodiscus sinensis Vs401 ighv AGCU01115162.1 73 ARSQELVEFGGAEKKAGDSLRLFCKASGFNFGSSGMSWMRQAPGKGLEWVAHLYWDRWDRASYADRVKGRFTTSREPSESLLYLPMTGLEPEDTGRYHCARDRQ
Pelodiscus sinensis Vs235 ighv AGCU01067679.1 531 ARAQVRLVESGGGVKRAGDSLRLSCKGSGFTFSNFTMRWFRQAPGQGPEWVATVSQPSGSKQWYSEAAKGRFTISRDNPRNTTHLQMSGLKREDSAVYYCAR
Pelodiscus sinensis Vs234 ighv AGCU01067678.1 3310 QVRLVESGGGVKRAGDSLRLSCKGSGFTFSNFTMRWFRQAPGQGPEWVATVSPISYWAGTDKRYAGSVQGRFTISRDNPNNRLHLEMGGLRAEDTAVYYCQR
Pelodiscus sinensis Vs237 ighv AGCU01067684.1 651 ARSQLQLAESGGAVTEEGESLRLTCTGSGGSFGSYTMFWYRQRPGTEPEFVSRINTDGTDPRYATWDQGRFTISRHNSRSEVYLAMRRLNQADSGRYLCAARD
Pelodiscus sinensis Vs236 ighv AGCU01067682.1 2222 ARSQLQLAESGGAVTEEGESLRLTCTGSGGSFGSYTMFWYRQRPGTEPEFVSRINTDGTDPRYATWDQGRFTISRHNSRSEVYLAMRRLNQADSGRYLCAARD
Pelodiscus sinensis Vs338 trav AGCU01092517.1 12702 DTSGADTVNQTEGNIAISQGDRLRLNCTYEFSGSAYLFWYVQYPGRAPRMLLSNFGGQSSDEGIRKGFNATQDTKGKSFPLWKASVELSDSATYYCAGR
Pelodiscus sinensis Vs339 trav AGCU01092517.1 14219 GTSWADSVNQTEGAVSISQALPLRFNCAYHVSVTGYPSVFWYVQYPGQAPRMFMQELAGKGSGEGIPKGFNASHDRKEKSFPLWKPAVELSDSAAYYCAVS
Pelodiscus sinensis Vs232 trdv AGCU01067674.1 489 AVSGNSLSQSPAALRPREGERVEINCQYSTSYTYFALAWYQQRPGAHPVFLMRRSYDNNEYKPSSVPGRFSSQLDTGAKSFRLRIAWAQRADSAVYFCALWD
Pelodiscus sinensis Vs335 trav AGCU01092517.1 6519 SSMEDSVTQTQPSASDLERESVSLDCTYETSFSNYYLYWYKQPPRGSLILLFWQHSGGTKSNEAGERFSVNFQKDKSSISLRITALELGDAATYFCAFSR
Pelodiscus sinensis Vs336 trav AGCU01092517.1 8322 SCCDAQVTQSPERLERSQGEVATMSCSFTSPYQTFHWYQQLPGRGPAHLLTVSSAENTTSERFIGERLDSGKRSSLHISASQLGDSGSYLCAVD
Pelodiscus sinensis Vs337 trav AGCU01092517.1 10698 GTFGADSVNQTEGSVVISQGDPLRLNCTYQFSFLTSSPNLFWYVQYPGETLRMLLRDLGRQDSDEGIRKGFSAAHEKENKSFHLWKASVDLSDSATYYCAGS
Pelodiscus sinensis Vs330 trav AGCU01092515.1 4334 APGRAKIQQRGSAEALEGDELNLTCSHEGIQANDYIQWYRHFPGRGPQFIVQGFKENVRSSEPEGVLHIPADRKSSALALRRARLADAAVYYCALR
Pelodiscus sinensis Vs331 trav AGCU01092515.1 5910 SCCDAQVTQSPEWLETGQGEVATLSCSYTSSYGIFQWYRQLAGQVPEHLRTGSSNENAKTTRFISELLDSGKRSSLHISDSQLGDSGSYLCAVD
Pelodiscus sinensis Vs332 trav AGCU01092515.1 9055 SCCDAQVTQSPERLEKDQGEVATMSCSFSSPYQTFWWYQQLPGRGPGHLLTVSSTENTTSERFIGERLDSGKRSSLHISASQPGDSGSYLCAVG
Pelodiscus sinensis Vs333 trav AGCU01092515.1 10310 AASGAQIDQPGSAEAPEGAELNLNCSHPAITSQESVFWYRQFPGRGPQYIVFGYSATAPSSEPEGTLHISGDRKSSALALPRARLADAAVYYCALS
Pelodiscus sinensis Vs1232 igkv AGCU01176262.1 6523 SRGQIVLTQTPESLAVSPGDTVTIRCKASSSLTSGSYQVLAWHQQKSGQAPKRLIYNASTRPSGIPDRFTGSGSGTDFTLTISNVQTEDAGDYYCQQGLSLP
Pelodiscus sinensis Vs1237 ighv AGCU01178029.1 637 ARSQVQLVESGGDVKKPGDCLRLSCKASGFTFSSYGMSWVRQAPGKGLEWVAVISGDESYIRYLDAVKGRFTISRDNGNNLLHLQMTGLKPEDTARYYCAG
Pelodiscus sinensis Vs848 ighv AGCU01057432.1 9217 ARSQVQLVESGGDVKKPGDSLRLSCKASGFTFSSYWMLWVRQAPGKGPEWVAAIEYDGDRIFYLDAVKGRFTISRDNPNNLLSLQMTGLKPEDTARYYCAG
Pelodiscus sinensis Vs843 ighv AGCU01057432.1 32902 TWSQVLVESRGDVKKPGDSLRLSCKASGFTFSNYHMSWVRQAPGKGLEWVSLIYTDGSNIFYEDSVKGRFTISRNNANNLLSLQMTGLKPEDTARYYCA
Pelodiscus sinensis Vs846 ighv AGCU01057432.1 21133 ARCQVLLVESGGDVKKPGDSLRLSCKASGFTFSSYNMNWVRQAPAKGLEWVAHIKSAPTYYADSVKGRFTISRDNPNNLLHLQMTGLKPEDTARYYCARD
Pelodiscus sinensis Vs847 ighv AGCU01057432.1 16912 ARSQISLVESGGDVKKPGDSLRLSCKASGFTFSSYNMNWVRQAPGQGLEWISRIYTDGSQQFYADSVKGRFTISRDNPNNLLHLQMTGLKPEDTARYYCAG
Pelodiscus sinensis Vs844 ighv AGCU01057432.1 30692 VLSQAQLVQTGPGAVKPGATLSLTCKVSGASISDYYWIWVRQPPGTGLEWVGYIRSTAQGGTTEYSPALKPRATITRDTSKNEIYLQLRSLAAADTATYYCVK
Pelodiscus sinensis Vs845 ighv AGCU01057432.1 25621 GRSQVTLRQPGAAQVKPSQTLSLTCSVSGFSLTDNTVGWIRQPPGKGLEWLTTVYWNDDKYYQESLKSRLSISRDTSKGEVYLEMRSLEAGDSGTYYCA
Pelodiscus sinensis Vs240 ighv AGCU01067702.1 3284 GWAVEFRESGGDVKKPGDSLRLSCLTSGFPFSNYWMSWYRLSPRRGLEWVSSIGKLPTSTAYYAGSVKGRFLISRDNAKNMAFLQMNSLRQEDTAWYYCHA
Pelodiscus sinensis Vs537 igkv AGCU01162400.1 8071 SSGQVVVTQTPESLAVSPGDTVTIRCKASSSVSSWIPWDSNKTVIHAASTRPSGIPDRFSGSGSGTDFTFTISRVEANDAGDYYCQCYYSGS
Pelodiscus sinensis Vs242 ighv AGCU01067705.1 2332 ARPKPEFVASGGEAKMLGDSLQISCKTSGLSFGDSWMSWVRHTPGKGLEWVAYISKLSGQTTSYAESVRGRFTISRDNSRGLLYLQMKNLRPEDAAEYYCG
Pelodiscus sinensis Vs538 igkv AGCU01162400.1 9634 SSGQIVLTQTPESLAVFPGDTVTINCKTSSSVRSYMAWYQQKTGQAPKLLIYRGSTRQSGIPDRFSGSRSGTDFTFTISRVEANDAGDYYCQCYYRGS
Pelodiscus sinensis Vs909 igkv AGCU01076857.1 26596 SSGQIVLTQTPESLAVSPGDTVTIRCKASSSLTYSSYQQLAWYQQKSGQAPKLLIYDGSSLQSGVPSRFSGSGSGTDFTLTINQVEAEDAGDYYCQQYRSFP
Pelodiscus sinensis Vs908 igkv AGCU01076857.1 36250 SSGQIVLTQTPESLAVSPGDTVTIRCKASSSLTWGSNQLLAWYQQKSGQAPKLLIYDGSSLQSGVPARFSGTGSGTDFTLTINRVEAEDAGVYYCQQYQNFP
Pelodiscus sinensis Vs907 igkv AGCU01076857.1 40313 SSGQTVMTQTPESLAVSPGDTVTIRCKASSSINYGSTPYQAWYQQKSGQAPKLLIYDASSRPSGIPDRFTGSGSGTDFTLTIRNVQMEDAVDYYCQQGF
Pelodiscus sinensis Vs906 igkv AGCU01076856.1 5613 SSGQIVLTQTPESLAVSPGDTVTIRCKASSSLTYSSYQLLAWYQQKSGQAPKLLIYHGSSLQSGVPSRFSGSGSDTDFTLTINRVEAEDAGDYYCQQSRSDP
Pelodiscus sinensis Vs990 trgv AGCU01093526.1 11125 GSSQVKLTQPQQSMTREESKTIRIDCRVSVRNFDQAYIHWYKQRPGAAPERILYISTQAAFDRASDKGKFNAEKKKIGQPTCTLIIDKTSFSDTATYYCAYW
Pelodiscus sinensis Vs991 trgv AGCU01093527.1 5275 GKAQSIVLVQSQISITKAEDKTAQIHCHVSGITFSSAYIHWYRKRRDAAPERILYLSSGKPVFGQKSDQGKSEVEKKHSNSICTLTVKKTTKSDAATYYCVVW
Pelodiscus sinensis Vs992 trgv AGCU01093528.1 2696 GCAQIQLEQAQLSVTRAEARTARIDCEASGISNFKSAVLHWYRHRPGNAPERILYISTDKPVYDKETDKNNFDCEKKPDQPVSTLIISKLSRDVRATYYCAYWD
Pelodiscus sinensis Vs993 trgv AGCU01093529.1 15587 LWAIDLEQKPISITKQPGAGHTAEFTCTMSGGLSSTYIHWYRAQAGRAPQRLLYHSSSKPEPIRESSFSSEKLTAYFQSSSMSKLLVYKLEAADSGHYYCAAWDY
Pelodiscus sinensis Vs994 trgv AGCU01093529.1 12190 VLWAIRLEQEQISVTKQPLQGSSAKFTCKVSGGSDSTYIHWYRARAAPQRLLHLTLSGSQLTREPGFSSDKFSAYVRHSTCVLLVHKLEAADSGHYYCAAWD
Pelodiscus sinensis Vs995 trgv AGCU01093529.1 5348 GKAQSIVLVQSQISITKAEDKTAQIHCHVSGITFSSAYIHWYRQRRDAALERILYLSSGKPEFDQDSDKGKFEAEKKHSQSICTLTVKKTIKRDEATYYCAVW
Pelodiscus sinensis Vs996 trgv AGCU01093529.1 2657 VSSQVSLTQPQLSITREESKTIRIDCHVSVPGDFGQAYIHWYRQRSGAAPERILYISTQTVFDNNSEKEKFNADKRIGQPICTLTINKISSSDKATYYCAYW
Pelodiscus sinensis Vs1050 igkv AGCU01113043.1 4281 ASSDTVMTQTPESLLVSPGDSVAINCKASASIGQQIGWYQQKSGQPPKLLVYAASIRHSEVPDRFSGSGSGTDYTLTITNFQADDTGTYHCLQDKRFPL
Pelodiscus sinensis Vs1056 ighv AGCU01115160.1 1602 ACSQVQLIPSGPGAVKPRETLTLSCAISGDSVTSNWWDWIRQAPGKGLEWVGEIDWSDSKWRINYGPAFQSRATLSADTSKNQFSLQLCSLTATDTTTYYCAR
Pelodiscus sinensis Vs1055 ighv AGCU01115160.1 3166 AQSQVQLVESGGDVKKPGDSLRLSCKASGFTFTDYWMSWVRQAPGKGLEWIGEIHPSSSSINYAQAFKGRFTISRDNPNNLLFLQMTGLKPEDTARYYCA
Pelodiscus sinensis Vs1054 ighv AGCU01115160.1 8123 ARSQITLVESGGDVKKPGDSLRLSCKASGFTFSSYYMGWVRQAPGNGLEWVASIYSSSIYYNDAVKGRFTISTDNSNNLLHLQMTGLKPEDTARYYCA
Pelodiscus sinensis Vs1114 ighv AGCU01132493.1 6305 QLKETGPGAGKPGESLTLTCTISGDSVSSTSITWTWVWQPAGKGLEWAGRIYYRSNNCSTSYTSALQSRVTIAQDTAKNQFSLTAADTATYYCAREE
Pelodiscus sinensis Vs1115 ighv AGCU01132493.1 2474 ARSQLQLQESGPGAVKPGETLTLTCSVTGGTVTSSYWWNWIRQAPGQGLEWMGLWTGSTSYNPSLQGRIAITVDSSSTKYYLRLSALTAADTATYFCA
Pelodiscus sinensis Vs176 trdv AGCU01052783.1 1052 ARSAVELDQGSQDLIVREGEEVTFPCSIKGGSMGSYYMFWYRKGQSGPLTWIYREGDLYGEGFQGRFVGEVKSSENKFTLRIRAAELRDRAVYLCAAR
Pelodiscus sinensis Vs177 ighv AGCU01052785.1 1967 ARAQVRLVESGGGVRKAGDSLRLSCKGSGFDFSSYEMHWYRQAPGKGLEWVAYFSSPSGSSTDYANAVRGRFTISRDNPSSLLSLQMSGLTPQDTARYHCARG
Pelodiscus sinensis Vs174 ighv AGCU01052782.1 2594 ARAQVRLVESGGGVTKAGDSLRLSCKGSGFTFSSYWMYWYRQAPGQGLEWVAYITSGSSTQYANAVGGRFTISRDNPNRLLSLQMSGLTPEDTGRYHCA
Pelodiscus sinensis Vs175 trdv AGCU01052782.1 3997 ARSDVVLDQGEQNLIVREREEVTFPCSMKGGRMGSYLMYWYRKGQSGPLTWIYKEGDRYGEGFQGRFVGEVKSSENKFILRIRAAELRDRAVYLCAAE
Pelodiscus sinensis Vs172 trdv AGCU01052780.1 4093 ARSDVVLDQGSQDLAAREGEEVTFPCSMKGGDMSSYYMYWYRKGQSGSLTWIYKEGGLYGADFQGRFEGTDDSSNNRFPLRIRTAELRDQAVYLCA
Pelodiscus sinensis Vs173 ighv AGCU01052781.1 191 VRAQVQLVESGGDVRKAGDSLRLSCKTTGFTFRDYWMYWYRQAPGHGLEWVAYISDTGSSVRYNDKMRSRFTISRDNSKSLLYLQLSRLTPEDTARYHCARG
Pelodiscus sinensis Vs170 trdv AGCU01052777.1 3639 ARSDVILDQSPQDLTVREGEEVTFPCSMKGGRMSSYWMYWYRKGQSGPLTWIYREGGDYGEGFQGRFVGTDDSSNNRLTLTIRTVELRDRAVYLCAAR
Pelodiscus sinensis Vs171 trdv AGCU01052778.1 1417 ARSDVLLDQGSQDLAVREGEEVTFPCSMKGGRMSSYWMYWYRKEQSGPLTWIYRQGGEYGAGFRGRFEGTDDSSNNRFPLRIRTAELRDRAVYFCAAR
Pelodiscus sinensis Vs273 ighv AGCU01081050.1 1235 VSSQVQLTQSGAEIKKPGESVKLTCKTSGYTFTSYYMHWVRQAPGKGLEWVGRINPYSGGTDYASAFQGRVTITRDNSITTAWLQLGSLRADDTATYYCAR
Pelodiscus sinensis Vs275 ighv AGCU01081053.1 12442 ALSQLRLQESGPGAVKPGETLTLTCSVTGGTITSSYGWNWIRQAPGQGLEWMGYWSGGTSYNPSLQGRIAITVDSSSTKYYLRLSALTAADTATYFCA
Pelodiscus sinensis Vs178 trav AGCU01052846.1 30939 LGVQLFLHQPQPIQFVEVGHSAEIHCSSTENLEGKGKVLWYLRREGETPTCIMRCLDDKNVSKFACKHEPHSTMLEISNIEKNESGVYYCAY
Pelodiscus sinensis Vs276 ighv AGCU01081063.1 697 ARSQVLVESGGDVKKLGDSLRLSCKASGFTFSSPWMVWVRQAPGKGLEWVAYISGKGDEIDYLNAVKGRFSISRDNPSNLLHLQMTRLKPEDTARYYCAR
Pelodiscus sinensis Vs1024 ighv AGCU01103518.1 491 ARAQVQLVESGGDVTKAGDSLRLSCNASGFDFSSYYMDWYRQAPGQRPEWVAQIRPDATREWYSKAVKGRFTISRDNPNSLLYLQLSRLTPEDTARYHCARRT
Pelodiscus sinensis Vs1023 trdv AGCU01103517.1 1060 ARSDVLLDQGSQDLAVREGEEVTFPCSMKGGRMSSYWMYWYRKGQSGPLTWIYREGGDYGEGFRGRFEGTDDSSNNRFPLRIRTAELRDRAIYLCAA
Pelodiscus sinensis Vs1048 igkv AGCU01113041.1 8554 SCGDIVMTQTPESLSVSPGDRVTINCKASSSVSSYMAWYQQKPGQAPKLLIHSASTRPSGIPDRFSGSGSGTDFTFTISRVEADDTGNYYCQQGNYYP
Pelodiscus sinensis Vs289 ighv AGCU01089090.1 653 VLSQVQLVQSGPGAVKPGETLTLSCAVSGFSISTQYYPWNWIRQPPGKGLEWMGHVHPYDRSARYARSLLGRVTISGDTAKNQVSLEIRSLTAADTATYYCAG
Pelodiscus sinensis Vs578 igkv AGCU01174490.1 8091 STGQKVLTQTPESLSVSPGDTVTIKCRASESVSTYLHWYQQKSGQAPKLIIHNASTRPSGIPDRFSGSGSGTDFTLTINRVEAEDAGDYYCHQSYIP
Pelodiscus sinensis Vs579 igkv AGCU01174490.1 10406 STGQKVLTQTPESLLVSPGDTVTIKCRASESVSTYLHWYQQKSGQAPKLIIQNASTRPSGIPDRFSGTGSGTDFTLTISRVEAGDAADYYCQQGYLP
Pelodiscus sinensis Vs477 ighv AGCU01145979.1 1765 PCVRARTNYSLVKKPGDSLRLSCKASGFTFSSYWMTWFRQAPGKGLEWVSDISTDGSTTRYADTLKGRVTISRDNPNNLLHLQLTGLRPEDAARYYCAR
Pelodiscus sinensis Vs476 ighv AGCU01145975.1 2424 QLKETGPGAVKPGESLTLTCTISGDSVSSTSATWNWIRQPAGQGLEWVGRIYYRSSGWSTNYASALQGRVTIAQDTAKNQFSLQLRSLTAADTATYYCAR
Pelodiscus sinensis Vs475 ighv AGCU01145969.1 5715 ACSQVQLIPSGPGAVKPRETLTLSCAISGDSVTSNWWDWIRQAPGKGLEWVGEIDWSDSKWRINYGPAFQSRATLSADTSKNQFSLQLCSLTATDTTTYYCAR
Pelodiscus sinensis Vs474 ighv AGCU01145964.1 771 VLSQVQLVQSGPGVVKPGETLTLTCAVTGVSLTSSSYAWNWVRQPPGKGLEWVARIYPYDGRKWFAASLQSRTSISADTAKNQFSLQLTSLAAADTAMYYCAR
Pelodiscus sinensis Vs576 igkv AGCU01174488.1 7544 CLGQVVLTQTPESLSVPVGERVSINCKASTSIGTCLNWYQQKPGQAPKLLIYYASSLQSGVPARFSGSGYGTDFTLTINSVEADDAGDYYCQQSNKLP
Pelodiscus sinensis Vs577 igkv AGCU01174488.1 10527 SRGQIVLTQTPESLAVSPGDTVTIRCKASSSAYSYMAWYQQKSGHAPKLLIYNTSTRPSGIPDRFSGSGSGTDFTFTISRVEADNARDYYCQQ
Pelodiscus sinensis Vs575 igkv AGCU01174488.1 6165 CLGQVVLTQTPESLSVPVGERVSINCKASTSIGTCLNWYQQKPGQAPKLLIYYASSLQSGVPARFSGSGYGTDFTLTINSVEADDAGDYYCQQSNKLP
Pelodiscus sinensis Vs305 trav AGCU01092503.1 11746 SSMEDSVTQTQHSESVLERESVSLDCTYETSAGNYYLYWYKQPPHGGLILLFEQYSGGRKSNEAGERFSVNFEKDKSSFSLRITALELGDAATYFCAFRSLE
Pelodiscus sinensis Vs304 trav AGCU01092503.1 6919 VGGQVSVEQSPRSLSGSEGQDFSLACNYSGTERSVQWYRQAPGGNPALLGILYRDEPGTWGPNLRAELRTKEKRSFLNISDAQLRDTATYLCAVE
Pelodiscus sinensis Vs307 trav AGCU01092505.1 1975 AAGGAQIEQPGSVEAPEGAEMNLNCSHPAITLQDSVVWYRQFPGRGPQYIVSGHSGTTSSSESGGVLHISGDRKSSALALRRARLADAAVYYCALS
Pelodiscus sinensis Vs306 trav AGCU01092505.1 394 SCCAAQVTQSPERLETGQGEVVTMSCNFTAAYRPFHWYQQLPGRGPTHLLTVSSAENATERRFIGERLDSGKRSSLHISASQLGDSGSYLCAVD
Pelodiscus sinensis Vs301 trav AGCU01092502.1 4006 AGLGDSVEPRELQVPGAEGASVTLSCRYRTDYTGGVYLYWYRQYPNRAPQYLLWRGAGSVSQLSDTAEFAKGRFTSQADDNSTALTIRTLELADTAVYFCALQS
Pelodiscus sinensis Vs300 trav AGCU01092501.1 2741 RAQADAVTQPAGSVEVREGEPISISCAYNYSGSPVLFWYEQRPPGPPRLLLTQYEASDEGEKRRRRGFSATLQKDSKSFPLEKRASEAGDAAVYYCALR
Pelodiscus sinensis Vs303 trav AGCU01092503.1 2235 IAWADSVSQSPREVTVSEGRDVVLQCNYNTTLLTDPYLFWYRQYPNQPLQHVLTAYKSAAARNTFADGRFSAVLFDQNRTVPLRVEAASLPDGAVYLCALS
Pelodiscus sinensis Vs302 trav AGCU01092503.1 268 RAQGDSVSQWPPEVRIPEGRSVTLQCNFTTSDPAPYLFWYRQDPDQPPQHILTKTKFDSSEETPIQGKFSAFLDMGNKTVSLRIEKVSPQESATYFCALR
Pelodiscus sinensis Vs309 trav AGCU01092505.1 6187 GTLGADTVNQTEGTVVISQGDPLRLNCTYQFSSSVTFVYPFWYVQYPGQGPRMLLRDLGREDSDEGIRKGFNATHDKKDKSFPFWKPSVELSDSATYYCAAS
Pelodiscus sinensis Vs308 trav AGCU01092505.1 4273 APGRAQIQQPGSADAQAGEELNLTCSHSSASTESVFWYRQFPGRELQYIARGYTDSVRSSEPEGALHISGDRKSSALALRRARLADAAVYYCALG
Pelodiscus sinensis Vs12 ighv AGCU01002841.1 1654 ARCQVQLVESGGDVKKPGDSLRLSCKASGFTFSSYWMTWFRQAPGKGLEWVSDISTDGSTTRYADTLKGRVTISRDNPNNLLHLQLTGLKAEDTARYYCAR
Pelodiscus sinensis Vs13 ighv AGCU01002842.1 541 ARSQPQLMESGGDVKKPGDSLRLSCKASGFTFSSYNMSWIRHAPEKGLEWVGRIYTDGSQQFYAGSVKGRFSISRDNRNNQLSLQMTGLKPEDTARYYCAG
Pelodiscus sinensis Vs10 ighv AGCU01002837.1 13184 VRSQVLVESGGDVKKLGDSLSLSCKASGFNFGGSHMSWVRQAPGKGLEWVAYISNGGITILYLDAVKGRFTISRDNLNNLLYLQMTGLKPEDTARYYCAR
Pelodiscus sinensis Vs11 ighv AGCU01002837.1 17812 VRSQVQLVQSGPGAVKPGQTLTLSCAVSGVSLASKSWDWFRKPAGKGLAWLGYISSSGGTSYAASLQGRLTFSRDTARNELSLQLRSLTAADTATYYCAV
Pelodiscus sinensis Vs18 igkv AGCU01003596.1 4732 SIGQIVVTQTPESLAVSPGDTVTIRCKTSSSVSNNMAWYQQKSGQAPKLLIYYASSRPSGVPDRFSGSGSGTDFTFTISRVEANDAGDYYCQYYYSNS
Pelodiscus sinensis Vs376 ighv AGCU01105148.1 9962 VWSQIQLIQSGAEVKRAGDSAKLSCKVSGYTYTDQGMHWARRAPGKGLEWVSSITHGAGDTQYYADSVKGRFTISRDNSQNLLFLRMAGLRPEDTAVYYCARWG
Pelodiscus sinensis Vs379 iglv AGCU01106455.1 5282 CRVQPVLIQPASILVLLGQTVNLSCALNPGYNISDYGVSWYQQRAGRPPKFLLYYNSETDQHKPAGTPARFSATKEPALNACVLTIAAFEAEDAADYYCSIML
Pelodiscus sinensis Vs1099 trdv AGCU01128680.1 9128 ASRWALAQVFQPPQITLVEGERILIPCSQNATSHNSMYWYVQPQQGRGALSFLGTGYKDSSAAGEFTMVVDPASRSTNLTRDSARLGEAGTYYCAVR
Pelodiscus sinensis Vs238 ighv AGCU01067690.1 730 LRAQIQLVQSGAQTKKPGESVTVSCTGSGYSFTQYPINWFRQASGKGLVSIGWINTASGAPTYAESFRGKVTMTQDTPSRTAFLQVRNLQAADAAVYYCA
Pelodiscus sinensis Vs712 iglv AGCU01018385.1 1309 SLAQYVLTQPPSVSVSPGQNAQLTCSGNNIGSKAVHWYQQKPGSAPLLVIYSDSNRPSGIPDRFSGANSGNTATLTITGVQAQDEADYYCQVWDS
Pelodiscus sinensis Vs713 iglv AGCU01018386.1 7335 SSSQNVVTQPPSVSVSPGNTVKLSCAMSSGTSISGYNVRWFQQKPGNSPRYLLRYKSDSDKHQGSGVPARFSGSKDTSSNTGYLTISGALAEDEADYYCAV
Pelodiscus sinensis Vs716 iglv AGCU01018390.1 2071 SRSQNVVTQPPSASVSPGNTVKLSCTMSSGTSISGYNVRWFQQKPGNSPRYLLRYKSDSDKHQGSGVPARFSGSKDTSSNTCYLTISGALAEDEADYYCAV
Pelodiscus sinensis Vs717 iglv AGCU01018393.1 2705 SLAQYVLTQPPSVSVSPGQNAQLTCTGEKFDKYYVHWYQQKPGQAPQLVIYKDSERPSGIPERFSGASSGNTATLTITGVQAEDEADYYCYVGYD
Pelodiscus sinensis Vs714 iglv AGCU01018387.1 912 SLAQYVLTQPPSVSVSPGQNAQLTCSGNNIGSKNVQWYQQKPGSAPLFLIYESSKRPSGIPERFSGANSGNTATLTITGVQAQDEADYYCMVWDSSAL
Pelodiscus sinensis Vs715 iglv AGCU01018390.1 5100 SLAQYVLTQPPSVSVSPGQNAQLTCSGNNLGSKYVQWYQQKPGSAPLLVIYDNSNRPSGIPNRFSGAKSGNTATLTITGVQAQDDADYYCQVWDSDSS
Pelodiscus sinensis Vs718 iglv AGCU01018394.1 3793 SLAQYVLTQPPSVSVSPGQNAQLTCSGNNLGSKNVCWYQQKPGSAPLLVIYDNNKRPSGIPERFSGANSGNTAMLTITGVQAQDEADYYCLVWDS
Pelodiscus sinensis Vs719 iglv AGCU01018395.1 2853 SLAQYVLTQPPSVSVSPGQNAQLTCSGNNIGSKNVQWYQQKPGSAPLTVMYYSSSRPSGIPDRFSGANSGNTATLTITGVQAQDEADYYCQVWDSDSS
Pelodiscus sinensis Vs132 ighv AGCU01040388.1 3195 VLSQVQLVQTGQGVVKPGATLSLTCKVSGVSVSSYYWSWARQSPRKGLEWLGFIRDTANGGTAEYNSAFKPRVTITRDTSKEEVYLQFGSLTAADTATYYCA
Pelodiscus sinensis Vs133 ighv AGCU01040388.1 10178 VRCQVLVESGGDVKKPGDSLRLSCKVSGFTFSSLYMDWVRQAPGKGLEWVAYINPSLWIAYADSVKGRFTISRDNSQSTLYLPMTGLRPEDTARYYCAG
Pelodiscus sinensis Vs688 ighv AGCU01014235.1 1886 VSSQVQLTQSGAEIKKPGESVKLTCKTSGYTFTSYHINWARQAPGKGLEWVGRINPNSGGTDYASAFQGRVTITRDNSITTAWLQLGSLRADDTATYYCAR
Pelodiscus sinensis Vs134 ighv AGCU01040390.1 2896 VRSQIQLVQSGPGAVKPGETLTLSCAVSGYTISSGYDWAWNRQAPGKGLEYLGLVYGPSGSTNYAPAFQSRISVARDTAKNQFSLQLRSLTAADTATYYCARG
Pelodiscus sinensis Vs135 ighv AGCU01040390.1 8017 ARSQVQLVESGGDVKKPGDSLRLSCKASGFTFSSYTMRWVRQAPGKGLEWISSISGDGDTPYYLDTVKGRFTISRDNPNNLLHLQMTGLKPEDTARYYCAG
Pelodiscus sinensis Vs1140 ighv AGCU01138341.1 8295 ARSQLQLQESGPGAVKPGETLTLTCSVTGGTVTSSYWWNWIRQAPGQGLEWMGLWTGSTSYNPSLQGRIAITVDSSSTKYYLRLSALTAADTATYFCA
Pelodiscus sinensis Vs1148 iglv AGCU01141846.1 646 PCSKAVLTQMASVSVSRGNSAKLSCILSASTSISSSHIVWLPRYLLHCKDESSPGLALGASTKFSAFKEASTNTCYLAISAVEAEDDASYYCLTSSGGE
Pelodiscus sinensis Vs1064 ighv AGCU01119021.1 538 VRPQIILVESGGDVKKPGDSLRLSCKASGFTFADYRMCWVRQASGKGLEWVSYFYGDTTFYLDAVKGRFTISRDIPNNLLFLQMTGLKPEDTARYYCAR
Pelodiscus sinensis Vs1065 ighv AGCU01119022.1 1936 ARCQVQLVESGGDVKKPGDSLRLSCKASGFTFSSYWMSWVRQAPGKGPEWVSDISADGGTKRYADSVKGRFTVSRDNSNNLLYVQMTGLRPEDTARYYCAS
Pelodiscus sinensis Vs224 iglv AGCU01064932.1 4518 SSSQNVVTQPPSASVSPGNTVKLSCTMSSGTSISGYSMFWYQQKPGNSPRYLLKYKSDSDKHQGSGVPARFSGSKDTSSNTGYLTISGALAEDEADYYCAV
Pelodiscus sinensis Vs222 iglv AGCU01064930.1 5035 SLSQSMLTQPPSVSVSPGQNAQLTCTGEKVDKNYVHWYQQKPGQAPQLVIYKDSERPSGIPERFSGASSGKTATLTITGVQAQDEADYYCQMWDSDSSS
Pelodiscus sinensis Vs223 iglv AGCU01064932.1 326 SLAQYVLTQPPSVSVSPGQNAQLTCSGNNIGSKAVHWYQQKPGSAPLLVIYSDSNRPSGIPDRFSGANSGNTATLTITGVQAQDEADYYCQVWDSSSDQ
Pelodiscus sinensis Vs220 iglv AGCU01064928.1 20372 SSSQPVLTQPPSASVSPGNTVKLSCTMSSGTSISGYNVRWFQQKPGNSPRYLLRYKSDSDKHQGSGVPARFSGSKDTSSNSGYLTIFGSLVEDEADYYCAV
Pelodiscus sinensis Vs221 iglv AGCU01064929.1 254 SLAQYVLTQPPSVSVSPGQNAQLTCSGNDIGSNVVHWYQQKPGSAPLLVIYNDNSRPSGIPERFSGAKSGNTATLTITGVQAQDEADYYCQVWDSGA
Pelodiscus sinensis Vs341 trav AGCU01092519.1 6127 GTSWADSVNQTEGIVGISEGDRLSLNCSYEFSLSAYPGVFWYVRYPGQAPRMLLQDLAGQNSGEEIGKGFSATHEREDKSFPLRKPAVDLSDSGTYYCAAS
Pelodiscus sinensis Vs340 trav AGCU01092519.1 4163 GTSGADIVNQTEGSVSIPQGDPLHLICTYEFSSSANPYLFWYVQYPGQSPRMLLQEFGQDSDEGSRKGFGATHDKQHKSFPLWKRSIELSDSATYYCAVR
Pelodiscus sinensis Vs343 trav AGCU01092519.1 9417 VPGRAQIQQPASDEALEGAELNLTCTHKGIKTNENIQWYRHFPGRGPQFIIQGFKGTFRSSEPEGALHIPEDRKSSALVLRRARLADAAVYYCALG
Pelodiscus sinensis Vs342 trav AGCU01092519.1 7799 APGRAKIQQRGSAEAVEGAELNLTCNHDEIKGTENIYWYRQFPGRGPQFIVKGFKENVQTSDPEGALHIPRDRKSSALVLRRARLADAAVYYCALG
Pelodiscus sinensis Vs345 trav AGCU01092520.1 2325 FVNQAEGSFVISQEDPLHLNCTYEFSSGAIPYLFWYVQYPGQGPRMLLRELGGQDSDEGIRRRFSATLDEQNKSFPLWKASVELSDSATYYCAKGKSRARP
Pelodiscus sinensis Vs344 trav AGCU01092519.1 11128 VPGRAQIQQPGSVEVFQGAEQNLTCSHSKISTETVFWYRQFPGRGPQFIVSGYSGTKTSSDPEGALHISGDRKSSELVLSRARLADAAVYYCALS
Pelodiscus sinensis Vs346 trav AGCU01092520.1 3997 GTSGADFVNQTEGSVVISESERLHLNCTYKFSTPPDYLYWYVQYPGQAPQMLLWNLAGPNSADGIRKGFSATHETQEKSFPLWKASVELSNSATYYCAAR
Pelodiscus sinensis Vs503 iglv AGCU01152928.1 1525 ACSQPVLTQPSSASVSPGQTAKLSCTISSDYSPSSANLDWYQQGSGQAPRFVLRRTSSRGVGVSDRFTGSSSGNVAYLTITNVKAEDEDDYYCALWYDGVAI
Pelodiscus sinensis Vs502 iglv AGCU01152919.1 6708 LSSQSVLTQTQTSLSVAPGERARMECTLEGVTFISEKKPSWYQQRWGKAPRLLIYDSRNRATGIPERFSGDTSNNIASLTITGVQTEDEADYYCSLWTGNA
Pelodiscus sinensis Vs501 iglv AGCU01152916.1 1270 PSSQQLLALKTSESVSPGGTVTLSCSLSSETFSDNNYPQWIQQRPGNVPRRLIHGASNRPAGVPERFTASMAGNTMSLTIAGALPEDNADYYCVAWRGDD
Pelodiscus sinensis Vs507 iglv AGCU01152934.1 369 VRSQPVVTQEPSMSVTPGGAVTLSCSLSTGAITSGNYPSWYQQKSGSAPRQLIYNTNSRPSGIPAQFSGAISGNKAALTITGVQAEDEADYYCAV
Pelodiscus sinensis Vs506 iglv AGCU01152931.1 2541 VRSQPVVTQEPSMSVTPGGAVTLSCSLSTGAITSSNYPTWVQQKPGSSPRTLIYNTNSRPSGIPARFSGAISGNNAALTITGVQAEDEADYYCAVLVSGA
Pelodiscus sinensis Vs505 iglv AGCU01152929.1 25040 VRSQPVVTQEPSMSVTPGGSVTLSCSQSTGAITSSIYPGWFQQKPGSAPRQLIHGTSTRPSGIPARFSGAISGNKAALTITGVQAEDEADYYCFVATGGA
Pelodiscus sinensis Vs504 iglv AGCU01152929.1 9041 VRSQPVVTQEPSMSVTPGGSVTLSCSLSTGAITTGNYPAWYQQKPGSVPLMLIYETNKRPSGIPARFSGAISSNDAALTITGVQAEEEGDYYCMVWAGS
Pelodiscus sinensis Vs509 iglv AGCU01152935.1 7971 VRSQPVVTQEPSMSVTPGGAVTLSCSLSTGAITSSNYPHWFQQKPGSAPRTLIYDTNNRPSGIPDRFSGAISGNKAALTITGVQADDEADYYCMVWAGS
Pelodiscus sinensis Vs508 iglv AGCU01152934.1 4633 VRSQPVVTQEPSMSVTPGGSVTLSCSQSTGAITSSIYPGWFQQKPGSAPRQLIHGTSTRPSGIPARFSGAISGNAALTITGVQAEDEADYYCFVATGGA
Pelodiscus sinensis Vs910 igkv AGCU01076857.1 20656 ARGDIAMTQTPESLAVSPGDRVTINCKASSSLTYSGSDYLAWYQQKTGQAPKLLIYLASTRASGIPDRFSGSGSGTDFTLTINRVEADDAGDYYCQQSYETP
Pelodiscus sinensis Vs911 igkv AGCU01076857.1 14738 SSGQIVLTQTPESLAVSPGDTVTIRCKASSSLTSGSYQLLAWYQQKSGQAPKLLIYDGSSLQSGVPSRFSGSGSGTDFTLTINRVEAEDAGDYYCQQYRS
Pelodiscus sinensis Vs912 igkv AGCU01076857.1 7328 SSGQIVMTQTPESLAVSPGDTVTIRCKASSSVTSGSTHYIAWYQQKSGQAPKLLIYYASTRASGVPDRFSGSGSGTDFTFTINRVEADDAGDYYCQQH
Pelodiscus sinensis Vs913 igkv AGCU01076857.1 4440 ARGDIVLTQTPKSLVVSPGDRVTINCKASSSLTDSGDDYLVWYQQKMGQAPKLLIYLASTRASGIPAQFSGSGSGTDFTLTISRVEADDAGDYYCQTGYETP
Pelodiscus sinensis Vs914 igkv AGCU01076857.1 1155 AKGQVVMTQTPEFLAVSPGDTVTIRCKASTNVGSYVAWYQQKSGQAPKLLIHSASTRPSGIPDRFSGSGSGTDFTFTINRVEADDAGNYYCQQGTSLP
Pelodiscus sinensis Vs915 igkv AGCU01076858.1 3362 SSGQIVMTQTPESLAVSPGDTVTIRCKASSSVTSGSTHFVNWYQQKLGQAPKLLIYYASTRTSGVPDRFSGSGSGTDFTFTISRVEADDAGEYYCQQHYDTP
Pelodiscus sinensis Vs916 igkv AGCU01076859.1 628 SSGQIVLTQTPESLAVSPGDTVTIRCKASSSLTTGSYQLLAWYQQKSGQAPKLLIYDGSSLQSGVPARFSGSGSGTDFTLTINRVEAEDAGDYYCQQYQNLP
Pelodiscus sinensis Vs917 igkv AGCU01076860.1 2151 ARGDMVLTQTPESVTVSPGDRVTINCKASSSLTYSGSDYLAWYQQKRGQAPKLLINLASIRASGSPGWFSGSGSGTDFTLTISRVEADDAGDYYCQ
Pelodiscus sinensis Vs536 igkv AGCU01162400.1 2686 SIGQIVLTQTPEALAVSPGDTVTIHCKASSNTYTNLVWYKQKSGQAPKLFIYGASTRPSGIPDRFSGSGSGTDFTFTISRVEAEDSGDYYCQQHASFP
Pelodiscus sinensis Vs241 ighv AGCU01067703.1 1479 VQANYKFEASGGEVKTLGDSLRLSCKASGFNFGESWMAWVRHAPGKGLQWVATISKASGDTKSYAESVRGRFTISRDNYWNTLYLDMTRLSREDAAEYYCTW
Pelodiscus sinensis Vs969 ighv AGCU01089061.1 959 ARSQVQLVESGGDVKKPGDSLRLSCKASGFTFSSYWMSWVRQAPGKGPEWVSDISADGGTKRYADSVKGRFTVSRDNSNNLLYVQMTGLRPEDTARYYCAS
Pelodiscus sinensis Vs968 ighv AGCU01089055.1 3758 VLAQVQLVQSGPGAVKPGETLTLSCAVSGFSISTQYYPWNWIRQPPGKGLEWMGHVHPYDRSARYARSLQGRVTISGDTAKNQLSLEIRSLTAADTATYYCTG
Pelodiscus sinensis Vs965 ighv AGCU01089046.1 562 AAGPIRLGGGKARRDPHPELRCLGCMLFGGDGFRQPLGKGLEWVGGVSGGATDTYAAASVQSRVTFPADTAKNQFSLQLRSLTAADTGTYYCARKVETVT
Pelodiscus sinensis Vs967 ighv AGCU01089052.1 1884 QLVPSGPGTVKPGETLTLSCAVSGDSSGIISSGCCCWSWIRQSPGKGLEWMGYRTRDGSTNYAPSLQSRIVITVDSSRNQFSLQLRSLTAADTATYYCAR
Pelodiscus sinensis Vs966 ighv AGCU01089051.1 2532 ASSQIQLTQSGAEIKKPGESVKLTCKTSGYTFTSNYLSWVRQAPEKGLEWVGYIDPSDGETGYAQNFQGRFTITRENSISTTWLQVGSLRADDTATYYCAR
Pelodiscus sinensis Vs1100 trdv AGCU01128680.1 5781 GLRWALAQVFQPPQVTVVEGERILIPCSQNATSHDSMYWYQQPQQGWGALSFLGMGYKDSSAAGEFTMVVDPASRSTNLTRDRARLREAGTYYCAVR
Pelodiscus sinensis Vs687 ighv AGCU01014234.1 1206 ARSQVQLVESGGDVKKPGDSLRLSCKASGFTFSSYGMSWVRQAPGKGLEWVAVISGDESYIRYLDAVKGRFTISRDNGNNLLHLQMTGLKPEDTARYYCAG
Pelodiscus sinensis Vs763 ighv AGCU01031881.1 8462 GTGASSQIQLTQSGVEIKKPGESVKLTCKTSGYTFTSNYLSWVRQAPGKGLEWIGYIDPRDSETGYAQNFQGRFTITRENSISTTWLQVGSLRADDTATYYCA
Pelodiscus sinensis Vs762 ighv AGCU01031880.1 5506 ARSQISLVESGGDMKKPGDSLRLSCKASGFTLSSYHMNWIRQAPGKGLEWVAFISNAGGTIHYLDAVKGRFTISRDNPNNLLHLQMTGLNPEDTARYYCG
Pelodiscus sinensis Vs761 ighv AGCU01031879.1 565 GRSQINLVESGGDGKKPGDSLRLSCKASGFAFSDYTMEWIRDVPGKGFQWVGGINTGLVAAYQDSVKGRFTISRENSQSALYLQMTGLKPEDTARYHCA
Pelodiscus sinensis Vs760 ighv AGCU01031877.1 675 VRSQIQLVQSGPGAVKPGETLTLSCAVSGYTISSGFNGTRIWQGPGKGLENLGYVGAPNAVQSRISIARDTARNQMSLQLRSLTTADITYYCAI
Pelodiscus sinensis Vs765 ighv AGCU01031883.1 4026 ARSQISLVESGGDVKKPGDSLRLSCKASGFTFSNYNMHWVRQAPGKGLDWVAQVSQPTGSKQWYSPAVQGRFTISRDNAVNSVYLQMTGLKPEDTARYYCA
Pelodiscus sinensis Vs764 ighv AGCU01031883.1 11250 ARSQISLVETGGDVKKPGDSLRLSCKASGFTFSSYRMNWVRQAPGKGLEWVAYFSSDGSTTHYLDAVKGRFTISRDNPNNLLHLQMTGLKPEDTARYYCAR
Pelodiscus sinensis Vs96 iglv AGCU01032019.1 2493 VRSQPVVTQEPSMSVTPGGSVTLSCSQSTGAITSSIYPGWFQQKPGSAPRQLIHGTSTRPSGIPARFSGAISGNKAALTITGVQAEDEADYYCFVATGGA
Pelodiscus sinensis Vs1035 trbv AGCU01108852.1 3092 MGAVFVEQPPFLTGTRKNPESLQCTLKQTNCNWMYWYRQRKGRELEGLFSSRQDGPGTNFTSEPMTAQRASTKWDLIWNNLSQSDSAVYYCAC
Pelodiscus sinensis Vs543 iglv AGCU01164355.1 1813 VRSQPVVTQEPSMSVTPGGAVTLSCSLSTGAITSSNYPTWYQQKPGSVPRTLIYNTNNRPSGIPARFSGAISGNNAALTITGVQAEDEADYYCIVWTGSA
Pelodiscus sinensis Vs316 trav AGCU01092511.1 2153 GTFGADTVTQTGGSVGISQGDPLRLNCTYQFSFTPYPFWFVEYPGQAPRMLLRDLGGQDSDEGIRKGFNATHDERDKSFHLWKPSVELSDSATYYCAGS
Pelodiscus sinensis Vs317 trav AGCU01092511.1 4901 GTFGADTVTQTEGSVGISQGDPLRVNCTYKFSVTPNNLFWYVQYPGQAPRLLLQHLVRLDSDEGIRKGFNATHDTKEKSFHLWKASVELSDSATYYCAGS
Pelodiscus sinensis Vs314 trav AGCU01092509.1 582 GTFGADTVTQAEGSVISQGDPLRLNCTYQFSSLTSFPNLFWYVQYPGQAPRMLLRDLGRQDSDEGVQRGFNATHETQKKSFPLWKASVEVSDAATYYCAGS
Pelodiscus sinensis Vs315 trav AGCU01092509.1 3683 APGRAQIQQPGSDEALQGAEVNLTCNHPAITVDNSVVWYRQFPGRGPQFIVSGYSGTANSSEPEGTLHISGDRKSSALALRRARLADAAVYYCALS
Pelodiscus sinensis Vs312 trav AGCU01092507.1 408 GAPGRAKIEQPGSAEDVEGAELNLTCSHASIANENIYWYRQFPGRGPQYIMSGYSRTTPISEPEGALHISGDRKSSALALRRARLADAAVYYCALG
Pelodiscus sinensis Vs313 trav AGCU01092507.1 1824 GASGADTVTQTEGSVGISQGDPLRLNCTYQFSFTTSLFWYVQYPGQAPRMLLEDLAGQNSGEGIREGFDATHETKDKSFHLWKASVELSDSATYYCAAI
Pelodiscus sinensis Vs310 trav AGCU01092505.1 7779 APGRAQIQQPGSAEAVESAELNLTCNHDGIKGTEYIYWYRQFPGQGPQYIVRGFKQNVETSEPEGALHIPADRKSSALVLRRARLADAAVYYCALG
Pelodiscus sinensis Vs311 trav AGCU01092505.1 9710 VPGRAQIEQPGSAEALEGAELNLNCSHSKISTETVVWYRQFPGRGPQFIVSGYSGTKTSSDPEGALHISGDRKSSALALPRARLADAAVYYCALS
Pelodiscus sinensis Vs319 trav AGCU01092511.1 9383 RSGADPVTQPNRTVTIQEGELVRIPCFYDYSGIPYLFWYEQRPPGPPRLLLTQYEASDEAEKRRRRGFSARLQSDSKSFQLEKSASEASDAAVYYCALR
Pelodiscus sinensis Vs1215 ighv AGCU01169839.1 518 VLSQVTLKETGPGAAKPGESLTLTCTISGDSVSSTSITWTWVWQPAGKGLEWAGRIYYRSNNCSTSYTSALQSRVTIAQDTAKNQFSLTAADTATYYCARE
Pelodiscus sinensis Vs1214 ighv AGCU01169835.1 446 ACLLFLLFFIDRCQLPGPADPLKLTCKTSGYTFTSYWMQWVRQTPGKSLEWVGEINPNSGSTNYAPAFQGRVIITRDNSITTAWLQLGSLRADDTATYYCAR
Pelodiscus sinensis Vs1216 trbv AGCU01169845.1 3862 SLFLLGVVSTYVEQLPFLTEVEGRSLALECILKKSNCDRMFWYRQREGRELEGLFYSYGNQLMNFTAESMLAQRKNKNWHLQWNNLSQLDSAVYYCAC
Pelodiscus sinensis Vs824 igkv AGCU01053138.1 3423 CSGQIVMTQSPESLSVPVGGRVSINCKASTSIGTCLNWYQQKPGQAPKLLIYYANTLQSGVPARFSGSGSGTDFTLTISSVEADDAGDYYCQQCGSYP
Pelodiscus sinensis Vs825 igkv AGCU01053138.1 903 SSGQTVMTQTPESLAVSPGDTVTIRCKASSSIGAAIAWYQQKSGQAPKLLVYAASSRPSGVPDRFSGSGSGTDFTFTISRVESDDAGDYYCQQY
Pelodiscus sinensis Vs820 ighv AGCU01052806.1 33367 VQSEVQLVQSGAEIKKPGESVKISCKTSGFTLTDYYMSWVRQAPGGRLVWLGYIDPEDGTTDYAESVKSRVTITTDNAISTMYVQLRSLTPDDTAVYYCAR
Pelodiscus sinensis Vs821 ighv AGCU01052806.1 8063 GVRSEIQFVQSGAEVKKPGQSLKLSCKASGYTFNNYRMGWLRQAPGKGLEWVASIRTDTFETFYPSHLKGHATISVDVPLSTAYLQIGSLGPEDTAVYYCAR
Pelodiscus sinensis Vs822 ighv AGCU01052806.1 5859 AWSQIQLVQPGAEVKRPGESMKLTCKASGYTFTDHSLAWIRQAPGKGLEWVATIWTNNFNTFYPEGLKGRVTVSVDTAASTTSLQLASLAAEDTAVYYCA
Pelodiscus sinensis Vs823 ighv AGCU01052810.1 1437 STAAITLTQPPSAQAAPGGSLTLDCVVAGYNINDHHLHWIRQAPGEGLVWLAAFRTGYTTHVAQAFQGRLTPSTSGSTARLRVDRLTAADTATYYCARE
Pelodiscus sinensis Vs422 ighv AGCU01123283.1 10954 ARSQVVLTQSGPALKKPGEAHKLQCATSGFALSSYWMGWVRQEPGKGLEWLVYYYDEANTKFYAASVQGRFTASKDSANLYLQMTSLREEDSAGYYCAR
Pelodiscus sinensis Vs921 igkv AGCU01076862.1 9430 SSGQIVLTQTPESLAVSPGDTVTIRCKASSSLTSSSYQYLAWYQQKSGQAPKLLIYLGSSLQSGVPSRFSGSGSGTDFTLTINRVEAEDAGDYYCQQTLSNP
Pelodiscus sinensis Vs920 igkv AGCU01076862.1 18569 SSGQIVMTQTPESLAVSPGDTITIRCKASSSLISGSNNYLAWYQQKSGQRPKLLIYLASTRASGIPDRFSGSGSGTDFTLTISRVEAEDAGDYYCLQSRSSP
Pelodiscus sinensis Vs923 igkv AGCU01076863.1 5782 SSGQIVMTQTPESLAVSPGDTVTIRCKASSSLTSGSYHYLAWYQQKSGQAPKLLIYRASSHPSGVSDRFSGSGSGTDYTFTINRVEADDAGDYYCQQH
Pelodiscus sinensis Vs922 igkv AGCU01076862.1 2911 SRGQIVLTQTPESLAVSPGDTVTIRCKASSSVTHGSDHFIAWYQQKSGQAPKLLIYRASTRASGVPDRFSGSGSGTDFTFTISRVEADDAGDYYCQ
Pelodiscus sinensis Vs925 igkv AGCU01076864.1 5260 SSGQIVLTQTPESLAVSPGDTVTIRCKASSSVTSGSYNYLAWYQQKPGQAPKLLIYLASTRPSGVPDRFSGSGSGTDFTFTISWVEVDDAGEYYCQ
Pelodiscus sinensis Vs924 igkv AGCU01076863.1 2992 ARGDIVMTQTPESLAVSPGDRVTINCKASSSLTYSGSDYLSWYQQKSGQVPKLLIYLASTRASGIPDRFSGSGSSTDFTLTISGVEAVDAGDYYCLQSRS
Pelodiscus sinensis Vs927 igkv AGCU01076865.1 4441 AKGQIVMTQSPQSLAVFSGDRITINCKASSSASNWMSWYQQKTGQAPKLLIYQASSRPSGIPDRFSGSGSGTDFTFTISRVEADDAGDYYCLQSQSWP
Pelodiscus sinensis Vs926 igkv AGCU01076864.1 2418 ARGDIVLTQSPESLAVSPGDRVTINCKASSSLTSWGRNYLAWYQQKRGQTPQLLIYGASTRASGIPDRFSGSGSGTDFTLTISRVEVDDAGDYYCQQSYETP
Pelodiscus sinensis Vs929 igkv AGCU01076866.1 4064 SSGQIVLTQTPESLAVSPGDRVTINCKASSSLTSSSTGKELLAWYQQKSGQAPKLLIYYATTLETGVPARFSGSRSGSDYTLTISKVETDDAGDYYCQQGKSFP
Pelodiscus sinensis Vs928 igkv AGCU01076866.1 13133 SSGQIVLTQTPESLAVSSGDTVTIHCQASSSLIYSSNQRLAWYQKTSGQALKLLIYYGSSLHSGVPARYSSSGSGTDFTLSINRVEAEDAGDYYCQQYCS
Pelodiscus sinensis Vs729 iglv AGCU01018407.1 12769 VRSQPVVTQEPSMSVTPGGAVTLSCSLSTGAITSNNYPTWFQQKPGSVPRTVIYNTNSRPSGIPARFSGAISSNDAALTITGVQAEDEADYYCFVATGGA
Pelodiscus sinensis Vs728 iglv AGCU01018406.1 725 VRSQPVVTQEPSMSVAPGGAVTLSCSQSTGAITTSSCPYWYQQKPGSVPRTLIYDTNNRLPGIPDRFSGAISGNKAALTITGVQAEDEADYYCSIWTGS
Pelodiscus sinensis Vs727 iglv AGCU01018405.1 11541 VRSQPVVTQEPSMSVTPGGAVTLSCSLSTGAITSSNYPHWFQQKPGSAPRTLIYSTNSRPSGIPDRFSGAISGNNAALTITGVQAEDEADYYCSVWASSA
Pelodiscus sinensis Vs726 iglv AGCU01018404.1 2185 VRSQPVVTQEPSMSVTPGGAVTLSCSLSTGAITSGNYPGWFQQKPGSAPRLLIYSTNNRPSGIPARFSGAISSNDAALTITGVQAEDEADYYCIIWTGSA
Pelodiscus sinensis Vs725 iglv AGCU01018404.1 8318 VRSQPVVTQEPSMSVTPGGSVTLSCSQSTGAITSSIYPGWFQQKPGSAPRQLIHGTSTRPSGIPARFSGAISGNKAALTITGVQAEDEADYYCAEWTGSA
Pelodiscus sinensis Vs724 iglv AGCU01018402.1 4204 SLAQYVLTQPPSVSVSPGQNAQLTCSGNNIGSKYVDWYQQEPGSAPLAVIYDSNKRPSGIPERFSGANSGNTATLTITGVQAQDEADYYCTVWDNDSS
Pelodiscus sinensis Vs723 iglv AGCU01018399.1 1412 SSSQNVVTQPPSASVSPGNTVKLSCTMSSGTSISGYNVYWYQQKPGNSPRYLLRYKSDSDKHQGSGVPARFSGSKDTSSNTGYLTISGALAEDEADYYCAV
Pelodiscus sinensis Vs722 iglv AGCU01018399.1 7168 SSSQLVLTQPPSASVSPGNTMKLSCTMSSGTSISDYYLYWYQQKPGNSPRYLLYYSSESSKNQGSGVPARFSGSKDMSSNTGYLTITGALAEDEADYYCAM
Pelodiscus sinensis Vs721 iglv AGCU01018399.1 9396 SSSQNVVTQPPSASVSPGNTVKLSCTMSSGTSISGYNVRWFQQKPGNSPRYLLRYKSDSDKHQGSGVPARFSGSKDTSSNTCYLTISGALAEDEADYYCAV
Pelodiscus sinensis Vs47 trbv AGCU01011083.1 22764 LCSGVTVTQKEKFIAIQSGSEGRIPCEHNDTSYYTVLWYQQKKGAEKQLQLVATSVDVTNSPKIEENFKPRYNMIRPAILNASLTISRGTVEDSAVYFCAASK
Pelodiscus sinensis Vs1139 ighv AGCU01138341.1 14330 VLSQVRLDQFGPTTAKPGETLTLRCAVYGVSITDGNYGWDWVRQPVGKGLQWLGGIYPAGGSTRYSPAFQGRVTISAVTARNQVSLQLRSLTAADTATYYCA
Pelodiscus sinensis Vs672 trbv AGCU01011093.1 570 HTGAKITQTSSLVLNREEAAKLTCNQTDNHSYMYWYLQQQGKELQLIYYSLGTDMTKEGDSKIKGFSASRPETAAFDLNISSVKPEHSAVYFCASSL
Pelodiscus sinensis Vs71 ighv AGCU01020226.1 564 VFSEVQLVESGPGAVKPGETLTLSCTISGYSVTNSYWDWVRQAPGKGLEWVGQIDWSGSSWRTYYSPAVQSRATLSADKSKNQFSLQLRSLTAADTATYYCARG
Pelodiscus sinensis Vs984 trgv AGCU01093525.1 15118 GFSQVNLTQPQLSITREESKTIRIDCRVTVPEDFGQAYIHWYRQRSGAAPERILYISTQTVFDRDSDKGKFNAEKKKIGQPTCTLIIYKTSLNDTATYYCAYWD
Pelodiscus sinensis Vs27 ighv AGCU01007028.1 1514 VRAQVQLVESGGDVRKAGDSLRLSCKTTGFTFRDYWMYWYRQAPGQGLEWVAYISYNGVTVRYHDRAKGRFTISRDNSNSLLSLQMSRLTPEDTARYYCARG
Pelodiscus sinensis Vs802 igkv AGCU01047415.1 16663 SSGQIVLTQTPESLAVFPGDTVTINCKTSSSVRSYMAWYQQKTGQAPKLLIYRGSTRQSGIPDRFSGSRSGTDFTFTISRVEADDTGNYYCQQYSSTPL
Pelodiscus sinensis Vs334 trav AGCU01092515.1 12381 GATGANTVNQTEGSIVIWQGVRLRLNCTYQFSFIPDNFFWYVQYPGQAPRLLLQHLVRQDSDEGIRKGFDATHEKQDKSFHLWKASVELSDSATYYCAAR
Pelodiscus sinensis Vs849 ighv AGCU01057432.1 3582 LRAQIQLVQSGAETKKPGEAVKMSCKGSGYTFTSYSIHWIRQAPGKGLVYIGWINTDTGAPTYADSFKGKVTMTLDKSSSTAFLQVSSLQAGDTAVYYCA
Pelodiscus sinensis Vs1047 igkv AGCU01113038.1 7338 AKGETVLTQTPESLAVSPGDTVTIRCKASSSVYSYMAWYQQKSGQAPKLLIHSASTRPSGIPDRFSGSGSGTDFTFTISRVETDDAGDYYCQHFYGTP
Pelodiscus sinensis Vs274 ighv AGCU01081053.1 2514 GRSQVQLVESGGDVKKPGDSLRLSCKASGFTFSRQAPGKGLEWVAYIYSDGSPQLYADSVKGRFTISRDNPNNLLHLQMTGLKPEDTARYYCAR
Pelodiscus sinensis Vs239 ighv AGCU01067694.1 469 DLPPFQLVEFGPATAQPSETLQVNCAVYGVYITAPGTYWYWLKHSPQKGLECLGWIDYQGNARYAPSFQSRIAITRDVSKNQFYFQLRSLTRADSARYLCARLL
Pelodiscus sinensis Vs711 ighv AGCU01018312.1 1136 GRSQVTLRQPGAAQVKPSQTLSLTCSVSGFSLTTSGIRMNWIRQLPGKGLEWLCLVYWDDDKRYTESLKSRLSISRDTSKGEVYLEMRNLEAGDSGTYYCAR
Pelodiscus sinensis Vs918 igkv AGCU01076861.1 4659 ARGDIVLTQTPESLAVSPGDRVTINCKASSSLTSWGRNYLAWYQQKRGQTPQLLIYGASTRASGIPDRFSGSGSGTDFTLTISRVEVDDAGDYYCQQGYET
Pelodiscus sinensis Vs919 igkv AGCU01076861.1 740 AKGQLVVTQTPESLAVSPGDTVTIRCKASSSVGSYMAWYQQKSGQAPKLLIHSASTRPSGIPDRFTGSGSGTDFTFTISRVEADDSGDYYCQAT
Pelodiscus sinensis Vs318 trav AGCU01092511.1 6586 KASGAAGNQTGGSLVLSQGEPVRLNCSYAASFTAFPFWFVQYPGAGPRLFLRDTGREDSDLGLAKGFNATHDAERKTFPLWKAASELSDSGTYYCLA