WGS Statistics
Organism WGS Record. Vs Total IGHV IGLV IGKV TRAV TRBV TRGV TRDV
Myotis brandtii ANKR00000000.1 (ANKR01) 278 121 54 1 44 40 11 7
Vgene Table
Organism Vgene Locus contig Contig Pos. AA sequence
Myotis brandtii V0 trbv ANKR01089556.1 167 SVFGALLSQKPLRDICQRGTSVTIQCQVDSQVALMFWYRQLPGQSLTLIATANQGSEATYESGFTKDKFSIHRPNLTFSILTVNSVNPEDSSFYFCSAG
Myotis brandtii V1 trgv ANKR01090408.1 226 GDTKMRISQDQLSFIRRPNRTVHISCKLSGVPLENAIVHWYQQKKGEPLRRILYGSTKNSKDNKLNPRLEAYRKDGTFNLIINNVVKSDEAIYYCACWD
Myotis brandtii V3 trbv ANKR01110604.1 519 YMGAMVTQNPRYQVTRMGKPVTLNCSQDLNHDVMYWYQQKLSQAPKLLFHYYDQDFNNETDTSDNFQPSRPNTSFCSLGIRSPGLGDSAVYLCASSK
Myotis brandtii V8 trdv ANKR01148663.1 1050 SSMTQKVIQAQSAISVVEKEAVALNCAYEVSSYNYYLFWYKQPPSGKMTFLIHQESYKEQNTTEGRYSLNFQKSASSISLTITDSQLRDSAVYFCALRD
Myotis brandtii V30 ighv ANKR01160650.1 553 VHSQEQLVQSGAEVRKPGASVKVSCKDSGYTFTSYYMHWVRQAPGQGLEWVGRIYPGDGSTSYAQKFQGRVFITRDMSTSTAYMELSSLRAEDTAVYYCAR
Myotis brandtii V50 trgv ANKR01170343.1 11133 GLGLSTLEQSQLSITTEVGESIDIDCKITSTNFEKDIIHWYRQKPNQALEHLIYVRSTKSPAISHVDGKRNKVEARKNSQLLTSTLRIYFIGKEDTGTYYCAGW
Myotis brandtii V51 trgv ANKR01170344.1 4192 GLGQLKLEQPELSISWAKGESAQIPCKVSSSTFSRDYIHWYQQKQDQSIEHLIYVVSTVTVFGKNNKLMARKYSQTSTSTLTINFLEKEDEAVYFCACWTG
Myotis brandtii V52 trgv ANKR01170346.1 154 GLGQLKLEQPVISISRAIYKSAQIPCKVSSGTFSSDSIHWYRQKPDKGIEHLMYVDFTTVVGGKNNKFEASKDFHTSTSTLRINFLEKEDEAVYFCACWTG
Myotis brandtii V53 trgv ANKR01170346.1 5567 GLGLSTLKQSQLSITTEVRESIDIDCKITSTNFEKDIIHWYRQKPNQALEHLIYVSSTIGPARSHVDGKRNKVEARKNSQLLTSTLRIYFIGKEDTGTYYCAGW
Myotis brandtii V54 trgv ANKR01170346.1 12443 GLGQLKLEQPEISISSARDESAQIPCKLSSGTFSKDYIHWYRQKPDQSIEHLIYVASTATVFGKNSKFKASKYTQTSTSTLTINFLEKEDEAVYFCACWTG
Myotis brandtii V55 trgv ANKR01170347.1 4710 GLGQLKLEQPEISISRAIYKSAQIPCKVSSGTFSSDSIHWYRQKPDQSIEHLIYVVSTTLAGGKNNKLEASKDFHTSTSTLRINFLEKEDEAVYFCACWTG
Myotis brandtii V56 trgv ANKR01170347.1 7865 GLGQFKLEQPVISISRARGESAQIPCKVSSGTFSSDYIHWYRQKPDQSMEHLIYVISTNVVGGKNNKLEASKEFYTSTSTLRIHFLEKKDEAVYFCACWTG
Myotis brandtii V57 trgv ANKR01170347.1 14353 TSGDIQITQALTSITKRKGSTAFLECQIRDILKKDSYIHWYQQKRDQALKRILSISSDDNINHEQGVSRERYEARKHHGNLLVSLRIHRVEEADAGLYYCACWI
Myotis brandtii V58 trgv ANKR01170347.1 15929 GDTKMRISQDQLSFIRRPNRTVHISCKLSGVPLENAIVHWYQQKKGEPLRRILYGSTKNSKDNKLNPRLEAYRKDGTFNLIINNVVKSDEAIYYCACWD
Myotis brandtii V59 trgv ANKR01170347.1 19836 TSGDIQITQALTSITKRKGSTAFLECQIRDILKKDSYIHWYRQKRDQALKRILSISSDDNVIHEQGVSGERYEARKHHGNLLVSLRIHRVEEADAGLYYCACWI
Myotis brandtii V71 ighv ANKR01174509.1 3420 VLSQVQLQGSGPGLVKPSQTLSLTCSVSGFSITTSSYCWHWIRQPPGKGLDWIAEICYEGSTYYSPSLKSRTSISRDTSKNQFFLQLSSMTTEDTALYYCARE
Myotis brandtii V81 trbv ANKR01178243.1 180 PTDAGVTQTPRHKVTKKGQGVTLSCEPISGHTYLYWYRQTSVQGLEFLISFSGLTPFDDTGMPKERFSAKMPNGSFSTLEIQPTEPGDSAMYLCASSL
Myotis brandtii V87 trbv ANKR01180226.1 2634 LVNAVITQTPKFQIWKTGQKGTLRCSQDMSHNYMCWYQQDLGHGMRLIHYSVGAGVTEKGDVPEGYSVTRSKTENFPLTLESATPSQTSVYFCASSV
Myotis brandtii V88 trbv ANKR01180226.1 8148 HTDAGVSQSPRHLVTKRGQDVTLRCDPISGHTVLYWYQQTLGQGLEFLLYFQNKEPLDTSGMPNKRFSAERPDGSYSTLKIQRAEQEDSAVYLCASSL
Myotis brandtii V89 trbv ANKR01180227.1 4886 SVAAGVTQFPRHLIKVQGGKAVLKCHPISGHNTVYWYQQALGHGPQFLISFYEKQEGQKGNIPDRFSGKQFNNYSSELAMSALQLGDSAVYLCASSL
Myotis brandtii V90 trbv ANKR01180227.1 9619 NLDAEITQSPRYKVAGTEKNVTLSCHQTNNHGIMYWYRQDMGHELTLIYYSVSAGITAKGDGANGYSVLRQNKENFVLTLKSATPSQTSVYFCASSEG
Myotis brandtii V91 trbv ANKR01180227.1 17042 SVAAGVTQSPRHIIKVQGGKAVLKCHPISGHSYVYWYQQALGHGPQFLISFYEKQEGQKGNIPDRFSGKQFNNYSSELTLSALQLGDSAMYLCASSL
Myotis brandtii V92 trbv ANKR01180228.1 4385 NLDAEITQSPRYKVAGTEKNVTLSCHQTDNHDVMYWYRQDMEPELMLIYYSVGAGITAKGDGADGYSVSRSNTENFALTLESATPSQTSVYFCASRE
Myotis brandtii V93 trbv ANKR01180228.1 5596 HTDAGVSQSPRHIVTERGQNVTLRCDPISGHTFLYWYRQMFGQGPEFLLYFQNKEPLDTSGMPNKWFSAERPDGSYSTLKIQRAEQGDSAVYLCASSL
Myotis brandtii V94 trbv ANKR01180228.1 10300 SVAAGVTQSPRHLIKGHGGKAILKCQPISGHRSVYWYQQTLGQGPQFLISFYEKEEQQKGNIPDRFSAKQFSNYSSELAMSALQLGDSAVYLCASSL
Myotis brandtii V95 trbv ANKR01180228.1 19553 SVAAGVTQSPRHVIKGQGGMVILKCHPISGHRSVYWYQQTLGHGPQFLVEYFEKEEREKGSIPDRFSGKQSSDYSSELTLSALQLGDSAVYLCASSL
Myotis brandtii V96 trbv ANKR01180230.1 4415 HLDARITQSPTYKVTGREKKVTLSCHQTDNHNNMYWYRQDLGHGLRLIHYSVGAGITDKGDVADGYSVSRSNTENFSLTLDSATLSQTSVYFCASSE
Myotis brandtii V97 trbv ANKR01180230.1 6020 HTNTGVSQSPRIIVTERGQNVSLRCDPISGHVGLYWYQQRLGQGPEFLIYFQNKEPVDKSGMPKERFYAKRSDGSLLHSKIQRVEQGDSAVYLCASSL
Myotis brandtii V98 trbv ANKR01180230.1 7448 HLDARITQSPTYKVTGREKKVTLSCHQTDNHNNMYWYRQDLGHGLRLIHYSVGAGITDKGDVADGYSVSRSNTENFSLTLDSATLSQTSVYFCASSE
Myotis brandtii V99 trbv ANKR01180230.1 9053 HTNTGVSQSPRIIVTERGQNVSLRCDPISGHVGLYWYQQRLGQGPEFLIYFQNKEPVDKSGMPKERFYAKRSDGSYSTLKIQRVEQGDSAVYLCASSL
Myotis brandtii V100 trbv ANKR01180230.1 11874 HTNTGVSQSPRIIVTERGQNVSLRCDPISGHVGLYWYQQRLGQGPEFLIYFQNKEPVDKSGMPKERFYAKRSDGSYSTLKIQRVEQGDSAVYLCASSL
Myotis brandtii V101 trbv ANKR01180231.1 5426 SVAAGVTQFPRHLIKSREGKTVLKCHPISGHDTVYWYQQALGQSPQFLISFYEKEEREKGNIPDRFSGKQFSNYSSELAMSALQLGDSAVYLCASSL
Myotis brandtii V102 trbv ANKR01180231.1 9754 NLDARITQSPRYKIAGTEKNLTVSCHQTDNHDYMYWYRQDLNHELTLIYYSVGARLTTKGDGANGYSASRSNTENFALTLESATPSQTSVYFCASSE
Myotis brandtii V103 trbv ANKR01180231.1 10560 NLDARITQSPRYKVTQTEKKVTLRCNQTDNHNYMYWYRQDLGHGLSLIQYSYGVGGISKGDVPDGYNVTRSNIEDFPLTLESATTSQTSVYFCASSD
Myotis brandtii V104 trbv ANKR01180232.1 34 PTDAGVTQTPRHKVTKMGQTVTLNCEPISGHTYLYWYRQTLEQGPKFLIYFSSQMPVDNSGMPKERFSAKMPDGSFSTLEIQPTEPGDSAMYFCASRL
Myotis brandtii V105 trbv ANKR01180232.1 4011 PTDAGVTQTPRHKVTKMGQSVTLSCEPISGHTHLYWYRQTLERGPKFLIYFNNQIPVDDSGMPKERFSAKMLNGSFSTLNIQPTEPGDSAVYLCASSL
Myotis brandtii V106 trbv ANKR01180233.1 5930 HADAGVAQTPRHKVTKMGQAVRLNCEPISGHYDLYWYRQTSLQELKFLIYFNNGAPIDNSGMPKDRFSAKMPNGSFSTLNIQPTEPGDSAVYLCASSL
Myotis brandtii V107 trbv ANKR01180233.1 8877 LVDAGVTQTPRHKVTKIGQEVTLSCKPISGHDSLYWYRQTSLQGLKFLTYFRNQAPIDETGMPNDRFSAKMPNGSFSTLKIQPTEPGDSAMYLCASSL
Myotis brandtii V108 trbv ANKR01180234.1 5659 YMGAMVTQNPRYQVTRMGKPVTLNCSQDLNHDVMYWYQQKLSQAPKLLFYYYDKQFNNETDTSDNFQPSRPNTSFCSLGIHSPGLGDSAVYLCASSK
Myotis brandtii V109 trbv ANKR01180234.1 11205 PTEAEVTQTPRHLITETKKKLTVTCSQNMNHDAMYWYRQDPGLGLKLIYYSINVDHFEKGEVSDGYKVSRTEKRNFPLTLESAKINQTSLYLCASR
Myotis brandtii V110 trbv ANKR01180235.1 3766 SVFGALLSQKPLRDICQRGTSVTIQCQVDSQVALMFWYRQLPGQSLTLIATANQGSEATYESGFTKDKFPIHRPNLTFSILTVNSVNPEDSSFYFCSAG
Myotis brandtii V116 ighv ANKR01184064.1 3988 VLSQVQLQESGPGLVTPSEALSLTCSVSGFSITTSGYYWSWIRQPPGKGLEWIASIYSSGSTYYSPSLKSRTSRSRNTSKNQFSLHLSSMTTEDTAVYYCA
Myotis brandtii V117 ighv ANKR01184520.1 557 VQCEVQLVESGGGLVPPGGSLRLSCAASGFTFSGYWISWARQAPGKKVEWVSDINGDSSTTYYAASVKGRFTISRDNAKNMLYLQMNSLRAEDTALYYCARET
Myotis brandtii V123 trbv ANKR01186227.1 4304 TVRSGVTQTPKYLLREEGRDVTLDCEQNLSHDSMYWYRQDPGQGLRLIYFSTVVKDVQQGDLAEGYRASREKKPFFPLTVTSTQKSQTAVYLCASSV
Myotis brandtii V124 trbv ANKR01186227.1 6927 GSGLGALVSQYPRRAIHISGASVKIQCLPVDLQASTVFWYRQFPKQGLILMATSNVGSSVTYEQGFTEAKFPIIHPNLTFSTLTVTSAHPADSSFYLCGAS
Myotis brandtii V125 trbv ANKR01186227.1 12376 SVDTEVTQSPGHLVKGKGQNAKMGCVPIKGHIYVYWYRQKLGEELKFLVYLQNEEILEKTDMIDERYSPKCPQNSPCSLEIESTEPGDAALYFCASSQ
Myotis brandtii V126 trbv ANKR01186227.1 15189 PTCAEIYQVPAFRLARAGRDVTLECEQNLRYNAMYWYRQDPGEGLKLIYYSTVEKDVQRGDIPEGYNVSREQKGLFPLTVRLAHTNQTAVYLCSGS
Myotis brandtii V127 trbv ANKR01186227.1 21117 SSDVQVTQTPGHLVKGKGQRARMDCIPPKEHPFVYWYQLTQNKEFKFLISFQNEDVLDQIELVKERFLAQCPKNVGCSLEIQASEPGDSALYFCASS
Myotis brandtii V128 trbv ANKR01186228.1 317 YIDAGVFQTPRNKIAETGNSIILECSQNEDHDYMYWYRQDPGLGLRLIYYSYNEKIYKGDVHNGYSASRKEHAKFPLFLKAASPNQTAVYFCTSS
Myotis brandtii V129 trbv ANKR01186229.1 8697 HQDAVVTQFPRHRILGTKKELTLECSQNMNHISMYWYHQDPGYGLQLIYYSNGIRTIAKGDVPEGYRVSRSELKYFLLTLESASTNQTSVYFCASSD
Myotis brandtii V130 trbv ANKR01186229.1 17340 PTEAEVTQTPRHLITETKKKLTVTCSQNMDHELMYWYRQDPGLGLKLIYYSINVDHFEKGEVSDGYKVSRTEKRNFPLTLESANISQTSLYFCASR
Myotis brandtii V131 trbv ANKR01186229.1 23138 LMDAEVTQVPRYLIKRKGEKVFMECLQDMDHDRMFWYRQDPALGLQLLHFSYGVDNYEKGDFPDGYSVSRKKKEGFSLILGSASTNQTSVYLCASSI
Myotis brandtii V140 ighv ANKR01188519.1 4159 VQCEVQLVESGGGLVQTGGSLRLSCAASGFTFSSYWMNWVRQAPGKGLEWVSTITHTDGSTYYPDSVKGRFTISRDNAKNMLYLQMNSLRSEDTAVYYCA
Myotis brandtii V141 ighv ANKR01188519.1 12873 AAGGVWGRLGAVLGSLRLSCAASGFTFSSYGMNWVHQVPGKDLEWVTGVSSIGGTTYLCRLVKGQFTVSRDNTKNTLYLQMNSLRTEDVAVYFCAS
Myotis brandtii V142 ighv ANKR01188522.1 1336 VQCEVQLVESGGGLVKPGGSLRLSCAASGFTFSSYWMHWVRQAPGKRLELLCQINPDGSTTYYANSVKGRFTISRDNGKNMLHLQMNSLRAEVSALYYCA
Myotis brandtii V143 ighv ANKR01188523.1 604 VQCEVQLVESGGGLVKPGGSLRLSCAASGFTFSSYWMHWVRQAPGKRLELLCQINPDGSTTYYANSVKGRFTISRDNGKNMLHLQMNSLRAEVSALYYCA
Myotis brandtii V144 ighv ANKR01188523.1 14517 VQCEVQLVESGGGLVQPGGSLRLSCKGSGFTFSDYYINWIRQTPGKGLEWVGFIRNKANSHTTEYAASVKGRFTISRDDSKSTAYLQMSSLRAEESALYYCA
Myotis brandtii V154 iglv ANKR01191947.1 406 SWAQSVLTQPSSVSGSLGQRVTISCSGSSSNIGGNGVGWYQQLPGKAPKLLIYDNSNRPSEVPDRFSGSRTGSSGSLTITGLQAEDEADYYCSAWDSGLSG
Myotis brandtii V155 iglv ANKR01191950.1 39 SWAQSVLTQPSSVSGSPGQRVTISCTGSSTNVGYGDYVSWYQQLPGKAPKLLIYQSSKRPTGIPDRFSGSRSGSSASLTITGLQAEDEADYYCQSYESSIDG
Myotis brandtii V176 iglv ANKR01202197.1 1611 PVASSVVNQPPAVSVAPGQKARITCQGDLVRESYASWYQQKPGQAPVLVVDSDENRTSKIPERFSGSDSGDTDTLTISGAQAQDEADYYCAVWDYSAG
Myotis brandtii V180 iglv ANKR01203609.1 1239 SVSAGSLSQPVLTQLPSLSASPGATATLTCTLSSGSNVGSYWISWFQQKPGSPPQFLLDYKSDSDKNQGSGVPSRFSGSKDVSANAGLLTISGLQPEDEADYYCA
Myotis brandtii V181 iglv ANKR01203609.1 7054 SFSQFAVTQPPSLSASPGATARLTCTLSGTTYPITDYWINWYQQKPGSRPRYLLYYKSDSEKGQGSGVPSRFSGSNDASAKAGILTISGLQPEDEAEYYCG
Myotis brandtii V185 ighv ANKR01205436.1 2823 VQCEVQLVESGGGLVQPGGSLRLSCAASGFPFSSYSMDWVRQAPGKGLEWVAYISSASGTIYYAASVKGRFTISSDNAKNTVYLQMNSLRAEDTAVYYCAR
Myotis brandtii V186 ighv ANKR01205440.1 2098 VQCEVTLVESGVGLVQPWGSLRLSCAASGFTSNSYYMNWFHQTPGKGLEWICAITGNGESTYCSDSVKGSFTISRDNAKNTIYLQMSSLRSKDTAVYYCAT
Myotis brandtii V187 ighv ANKR01205441.1 6622 VQCEVQLVESGGGLVQPGGSLRLSCAASGFNFSSYGMHWIRQAPGKGLEWVAVIWYDGSQKYYADSVKDRFTISRDNAKDMAYLQMNSLRVEDMAVYYCAA
Myotis brandtii V188 ighv ANKR01205444.1 6100 VLSQVQLQESGPGLVKPSQTLSLTCTASGFSLTSYGVHWIRQAPGKGLEWVGIMFGGGSTDYNPTLKSRLSITRDTSKSQVYLTLNSMRAEDTAVYYCA
Myotis brandtii V189 ighv ANKR01205445.1 2806 GLCQVQLMESGGGMVPPGGSLSLSCEASGFNFTDYSMHWVCQAPGKGLQWVAGVSQPTGDKQLYAPAVQGRFTISRGNPMSTVSLKMTKLTSEDTAIYYCT
Myotis brandtii V190 ighv ANKR01205447.1 8085 VQCEVQLMESGGGLVKPGGSLRVSCAASGFTFSSYWMQLVCQAPGKGLEWVAVINPDGGTTYYANSVKGQFTSFRDNAKNTMYLQMNSLKVEDTVLYYCAR
Myotis brandtii V191 ighv ANKR01205448.1 9684 VQCEVQLVESGGGLVKPGGSLRLSCAASGFTFSSYWMHWVRQAPGKRLELLCQINPDGSTTYYANSVKGRFTISRDNGKNMLHLQMNSLRAEDMDLYYCV
Myotis brandtii V192 ighv ANKR01205449.1 799 VLSQMQLQKSGPRLVKPSETLSLTCTVSGFSLTSYGVQWTRQVPGKGLEWVGGIWSNGDTYYNPTLKSRLSITRDTSKSQVYLTLNSLRAEDTAVYYCAR
Myotis brandtii V193 ighv ANKR01205450.1 2983 GLCQVQLVESGGGLVPPGWSLSLSCKASGFNFTNYEMNWVRQAPGKGLQWVAKVIQPTGNKQWYAPGVQGRFTISRDNPTSTVSLKMTKLTSEDTAVYYCTR
Myotis brandtii V194 ighv ANKR01205452.1 2475 VHSQVQLVQSGAEVRKPGASMKVFCKTSAYTFTSNYMKWVRQALGKGLQYMGFIKTDTGKPTYAQGFSERCIFSMDTSASTAYLQINGLKSEDTTMYYCAWE
Myotis brandtii V195 ighv ANKR01205452.1 13909 VQCEVQLVESGGGLGKPEGSLRLSCAASGYASSSYYMNWVRQTPGKGLEWICAITGNGDSTYYADSVKGRFTISRDNTKNMIYLQMNSLRSEDMAVYYCAT
Myotis brandtii V207 ighv ANKR01210344.1 296 VQCEEQLVESGGGLVQPGGSLRLSCAASGFTFSSYWMGWVCQAPGKGLEWVTYISTGGSTYYANSVKGRLTISRENAKNSLYLQMSSLKDEDTALYYCA
Myotis brandtii V218 iglv ANKR01214793.1 1819 PVASSELTQPPAVSVALGQAARITCKENLEKKYFPSWYQQKPGQAPVLVIYSDTNRTSTIPERFSTSWSVDTDTLTISRVQAQDEADYYCLTWDDSAK
Myotis brandtii V245 iglv ANKR01223222.1 224 SVSAGSLSQPVLTQPPSLSASPGVTVRLTCTLNSGFSVGSYYISWYQQKPGSPPRYLLYYHSDSIKGQGSGVPSRFSGSKDASANAGLLTISGLQPEDEAVYYCA
Myotis brandtii V257 ighv ANKR01228005.1 974 VLSQVQLQESGPGLVKPSQTLSLTCTASGFSLTSYDVHWIRQAPGKGLEWVGVVWSDGSTYYNPTLKSRLSITRDTSKSQVYVTLNSLRAEDTAVYFCA
Myotis brandtii V277 ighv ANKR01234194.1 2244 VLSQVQLQESGPGLVKPSQTLSLTCTVSGFSITTSGYAWSWIRHPPGKGLKWMGNIWDNGDTYYSPSLKSRTSISRDTSKNQFSLQLSSMTTDDSAVYYCT
Myotis brandtii V278 ighv ANKR01234195.1 1697 VQCEVQLVESGGGLVQPGGSLRLSCAASGFTFDDYNMHWIRWAPGKGLEWVSADSGGGSSKYTNSVKDHITISRDNAKNTLYLQMNSLRAEDTAVYYCAR
Myotis brandtii V282 iglv ANKR01235491.1 1702 SLSQQPEVTQPPSLSASPGATARLTCTLRSDISVGGKYINWYQQRPGSPPRYLLEYKSDSEKHQGSGVPSRFSGSKDASANAGLLTISGLQPEDEADYYCMI
Myotis brandtii V295 iglv ANKR01244346.1 2621 SWAQAPLTQPPSVSGTPGSSVTISCAGSSNDIGYYNDVSWYQHRPGTAPKLLIYGVSYRPSGIPERFSGSKSGNTATLIIAGLLAEDEADYYCCSYTTS
Myotis brandtii V296 iglv ANKR01244347.1 603 SWAQAALTQLPSVSGNMGQSVTISCVGSGNDIGRYNYVSWYQQRPGTAPKLLISYVNARHSGVPERFSGFKSSNTAFLLISGLQAEDEADYHCFSYVGS
Myotis brandtii V297 iglv ANKR01244350.1 1813 SWAQAPLTQPPAVSGTPGTSVTISCAGSSNDIGYYNYVSWYQHRPGTAPKLLIYSVSTRPSGIPERFSGSKSGNTATLTIAGLQAEDEADYYCCSYRYTDS
Myotis brandtii V298 iglv ANKR01244350.1 5603 SWAQAPLTQPPSVSGTPGSSVTISCAGSSNDIGYYNDVSWYQHRPGTAPKLLIYGVSYRPSGIPERFSGSKSGNTATLTIAGLQAEDEADYYCCSYTTS
Myotis brandtii V309 iglv ANKR01251863.1 230 VDSQTVVTQEPSMSVSAGGTVTLTCGLSSGSVSSGNHPGWFQQTPGKPPRTLIYNTNNRPSGVPDRFSGSISGNKAALTISGAQPEDEAHYHCL
Myotis brandtii V328 iglv ANKR01260284.1 5642 VDSQTVVTQEPSVSVSAGGTVTLTCGLSSGAVSSGNNPSWLQQIPGKPPRHLIYEANKRPSGVPDRFSGSISGNKAALTISGAQPEDEDDYYCALYLGSG
Myotis brandtii V329 iglv ANKR01260285.1 4552 VDSQTVVTQEPSMSVSPGGTVTLTCGLSSGAISTSNYPGWYQQTPGKPPRQLIYYTNNRPSGVPARFSGSISGNKAALTISGAQPDDEADYYCALYNVGAL
Myotis brandtii V330 iglv ANKR01260285.1 8206 VDSQTVVTQEPSVSVSAGGTVTLTCGLSSGAVSSSNYPSWYQQTPGKPPRMLIYEANKRPTGVPDRFSGSISGNKAALTISGAQPEDEDDYYCN
Myotis brandtii V331 iglv ANKR01260288.1 1071 SRSQAVVTQEPGMTVSPGGTVTLTCGSSTGAVTDGHYPYWIQQKPGQVPRTLIYNTDKKHSWTPARFSGSIQGGKAALTLSGAQPEDEAEYYCWLYFSG
Myotis brandtii V332 iglv ANKR01260288.1 4446 SRSQAVVTQEPEMTVSSGGTVTLTCGSSTGAVTDGHYPYWFQQTPGHTPRTLIYNTNNRHSWTPARFSGSIRGGKAALTLAGAQPEDEAVYHCWLVYSGA
Myotis brandtii V333 iglv ANKR01260288.1 6957 TTSQSVIQQASLITNPGGTAILTCGASTGAAVTTSNYASWIQQKPYQVPKGIIGGTTNRVPGVPVRFSGALAGGKATLTITGAQPEDEAEYYCALWFSNH
Myotis brandtii V334 iglv ANKR01260315.1 613 PVASSELTQPTEVSVALGQMARITCKENLKTKYYPVWLQQKPSQAPMLVIYGDTNRTSKIPERFSTSWSVDTDTLIISGAQAQDEADYYCAVWEKNAK
Myotis brandtii V335 trav ANKR01261156.1 10218 LSGEDQVEQSPQTLRVQEGDNVSLTCSYTVSTFRGLQWYRQDPGEGPEHLFLLYSVGKGQQKGRLSVSLSQKESSLHITTPKAEDSATYLCAVE
Myotis brandtii V336 trav ANKR01261156.1 17888 VSSEQEVNQSPGALTVHEGDSLFLNCSYTDSAIYFLQWFRQDPGKGLTSLLLIQSSQREETSGRIKVSLDKTSRHSALYIATSQLGDSATYLCAV
Myotis brandtii V337 trav ANKR01261156.1 27968 VRGVQVEQSPPALILQEGASSTLWCNFSTSVNNVQWFRQNPGGRLVNLFYVPSGTKWNGNLKAMTDPKERRSSLHVSSSQTTDSAIYFCAVEAQCFP
Myotis brandtii V338 trdv ANKR01261158.1 4638 SSMAQKVIQDQVETVKQEGALVTTLNCRYETSDSVYYIFWYKQLTSGKLIFLIRQASSGQNAKDGRYSINFQKAAKSISLTISTLQLEDSAKYFCALWE
Myotis brandtii V339 trav ANKR01261159.1 7055 VSSELNVEQSPPSLRVQEGKSTNFTCRFPTSSFYALYWYRWEPAKSPTILFVISLNGDVKKEGRVTATLNTTKGYSYLYIKGSQPEDSATYLCAF
Myotis brandtii V340 trav ANKR01261159.1 12071 VNGQQIKQIPQFLLLQEGENFTTYCNFSSTVNNLQWYKQSPGGNPVFLVMLVRGGEAKKQERLTARFGETRKDGSLHITATQTADVGAYFCAE
Myotis brandtii V341 trav ANKR01261159.1 20040 AMIDAEITQPNSMDYAEGKDVNLPCNHSTIGGTDYIHWYRQNPNQRPQYIIHGLRNKVTNNMASLIITEDRKSSTLILPRVTLRDSAVYYCAVR
Myotis brandtii V342 trav ANKR01261160.1 9335 ESTQQLEQTPRFLSIQEGENCTVSCSSSSVFPTFQWYRQEPGEGPVLLMTLTKGGEKKEQKRLTAQFGKERKDSSLLITAAQPGDAGIYLCAG
Myotis brandtii V343 trav ANKR01261160.1 26321 VRSQEMQQSPQSLIIQEGEEVTIECKSSQPLYSLHWYWQKHGEGPVFLMILRKGGEESRDKITATLDEKKQNSSLYITASQPSHSGTYFCAGA
Myotis brandtii V344 trdv ANKR01261160.1 32696 FIMTEKVTQAQTTVTVQEGEAVTMDCTYETSWSVYALYWYKQPPSGEMVFLIYQFSSYPNAKQDRYFVNFQREKNSISLTISSLQLADSAKYFCALWI
Myotis brandtii V345 trav ANKR01261161.1 6383 IMGDAKSTQPGAMESTAEEAVHLPCDHSTISGNEYIHWYRQIPHQGPEYVIHGLKDNVTKGTSSLIIATDRKSSTLILPQVSLRDSGVYYCLVRD
Myotis brandtii V346 trav ANKR01261163.1 3122 VSSQKLEQSSQSLNIQFIPEGKKFTINCNSSKTVYAFHWYRQKYSEGPISLLITLWKSREEKSHEKMTAKLDEKKKRNVLHITALLTSHSGIYFCGVH
Myotis brandtii V347 trav ANKR01261165.1 2837 VSGQQLNQSPQSMSISEGEAISMSCISSSTFNTLLWYKQDARGGPVLLITLYKGGEFIRNGKLTAQFGGTRKDSFLNISAPELADAGTYFCAG
Myotis brandtii V348 trav ANKR01261165.1 8592 VYSEDKVLQSPPSLAVHEGDSATLHCRYEVTSFQGLYWYKQKEKATIFLCRLITSGFDSGRIKGTIDKTERLSTLHITATQMEDSATYLCALE
Myotis brandtii V349 trav ANKR01261165.1 14116 PGGADWIKSQETEVSEPEGKSVTLLCNYGTSSRGTVDLYWFRQYPNQAPEFILYRGWGYTGKGDAEFAIGKFYSDSSADTTNLYFRKLEFADTARYHCALRM
Myotis brandtii V365 iglv ANKR01267591.1 3275 PVASSELTQPPAVSVALGQAARITCKENLEKKYFPSWYQQKPGQAPVLVIYSDTNRTSTIPERFSTSWSVDTDTLTISRVQAQDEADYYCLTWDDSAK
Myotis brandtii V381 iglv ANKR01276202.1 13522 SWAEVVFTQPGSVSGSPGQKAVISCTRSSGSIGGYYVSWYQQRPGRAPTMVIYGDDERPSGVPDRFSGSIDSSSNAAHLTISGLQPEDEADYYCQSYDSGYTK
Myotis brandtii V397 ighv ANKR01281771.1 4456 VQCEVQLVGPGGGLFQPGGSPSLSCAASGFTFSSNSMNWVRQVPGKGLEWVAVIWNDGSQKYYADSVKSRFTISRDNAKNTLYLQMSNLRAEDTAMYYCAR
Myotis brandtii V421 iglv ANKR01292168.1 4465 SLSQPVLTQPPSLSASPGASARLTCTLSSGSNVGGYTIYWYQQKPGSPPRYLLYYYTSTSLGTGVPSRFSGSKDTSANAGLLLISGLQPEDEADYYCQV
Myotis brandtii V422 iglv ANKR01292168.1 6722 SLSQPVLTQPPSLSASPGASARLTCTLSSGYNVGGYRIYWYQQKPGNPPRYLLNYYTSTSLGTGVPSRFSGSKDTSANAGLLLISGLQPEDEADYYCQVYESSA
Myotis brandtii V423 iglv ANKR01292169.1 1473 SLSQPVLTQPLSLSASPGASARLSCSLSSGSVVAGYHISWFQQKPGSPPRFLLRYKSDSDKTQGSGVPSYFSGTKDASANAGLLLISGLQPEDEAEYYCAT
Myotis brandtii V432 ighv ANKR01296616.1 2811 VLSQVQLQESGPGLVKPSQTLSLTCSVSGYSITSDYYWSWIRQPPGKGLEWIGSIRYDGSTYYSPSLKSRTSISRDTSKNQFFLQLSSVTTKDTAVYYCAR
Myotis brandtii V433 ighv ANKR01296616.1 8390 VLSQVQLQESGPGLVKPSKTLSLTCSVSGFSITTSSYCWHWICQPPGKGLEWIAKICYEGSTYYSPSLKSRTSITRDMSKNQFSLQLSSVTTEDTAVYYCA
Myotis brandtii V434 trdv ANKR01297857.1 6954 KGMLCNKVTQNSLDQTVAIGSEVTLLCTYDTQYLNPDLYWYRKRPDHSFQFILYRDNIRAYDADFAQGRFSVQHSHTHRTFHLVISSVRTEDRATYYCAMS
Myotis brandtii V443 iglv ANKR01300752.1 466 SGVRAGLTQEASLSGSLGQKVTLSCTGNSNNVGTYGVGWYQQVTGSAPKTVMLGSSRPTGIPDRFSGSQSGNTASLVITGLQPEDEAVYYCSTWDYGIS
Myotis brandtii V446 ighv ANKR01303205.1 7612 VQCEVQLVESGGGLVQPEGSLRFSCATSEFTFSSYHMTWVRQAPGKGLEWVAIIWNDGSQKYYADSVKGRFTISRDNSKNTLYLQMNSLRAQDMAVYYCGK
Myotis brandtii V447 ighv ANKR01303206.1 6773 VWCEVQLVESGGGFVQPGGSLRLSCATSGFTFTSSWMDWVHQAPGKGLERLCRINPDGNTTYYANSVKGQFTTSRDNAKKLLYLQMNSLRAQDMALYYCLT
Myotis brandtii V448 ighv ANKR01303207.1 8027 VLSQVQLQEYNPGLVKTSQTLSLTCTVSEGSITNGYYWNWIYQPSGKGLQQMGCRTGCTRYNIAFQGRISITADMARNQFSLQLSSVITQDMAVYYCV
Myotis brandtii V449 ighv ANKR01303207.1 12073 VHSQVQLVQSGAEVRKTGASVKISCKASGYTFTSFIISWVRQALGESMKYMGWIKTETGAPTYAQGFSERFVFSMDTSISTAYLQINGLMSEDTAMYYCARE
Myotis brandtii V450 ighv ANKR01303213.1 5516 VQCEVQLVESGGGLVQPGGSLRLSCAASGFNFSSYWMSWVRQTPEKGLEWVGIISTDGGTTNYADSVKGRFTISRDNDKNTLYLQMNSLTAKDTAVYYCA
Myotis brandtii V451 ighv ANKR01303213.1 22914 VLCQVQLVESGGGVVPPGGSLSLSCKASGFAFTNYSMNWVRQAPGKGLQWVATVSRPTGKNQWYAPAVQGRFTISRDNPTSTVSLKMTKLTSEDTAMYYCIR
Myotis brandtii V452 ighv ANKR01303215.1 2711 VHSQVQLVQSGAEMRKPGASVKVSCKGSRYTFTSYWMQWVQQAPGERIKYMGWINTNTGKPTYAQGFSERFVFSMDTSVSTAYLQINGLKSEDTAMYYCA
Myotis brandtii V479 iglv ANKR01314896.1 4054 SVASQELTQSGPLSVAPGGTASITCTGDFLDKRYTSWHQQKPGQAPVQVIYKDSERPSGIPDRFSGSSSGKTVTLTISGARAEDEADYYCQSSTSDDN
Myotis brandtii V480 iglv ANKR01314898.1 4897 SVASYELTQPPSVSVSPGQTARLTCGGNSIGIKSVHWYQQKPGQAPVLVIYDDIGRPSGIPDRFSGSSSDDTVTLTISGAQAQDEADYYCSAWDDSSN
Myotis brandtii V481 iglv ANKR01314898.1 7631 LCADPVLTQPPSASAALGASAKLTCTLSAEHSNYFIHWYQQSPGQAPRYLMKVNSDGSHTKGDGIPDRFSGSSSGADRYLTISNLQSEDEGEYYCGVPYGSE
Myotis brandtii V482 iglv ANKR01314898.1 10834 PVASSEVTQTPAVSVALGQTARITCQGELVKKVYLSWYQQKPGQAPVLVVYGNKNRTSTIPDRFSGSDSGDTDTLTISGAQAQDEADYYCAVWEKNAK
Myotis brandtii V483 iglv ANKR01314898.1 14467 LCAVPVLTQPPSASASLGASAKLTCTLSAEHSNYIIEWYQQRPGQAPRFLMYIHSNGSHTKGDGIPDRFSGSSSGADRYLTISNLQSEDEGEYHCGLAY
Myotis brandtii V484 iglv ANKR01314898.1 18859 SVASYELTQSGHLSVAPGETASMTCTGDLLDEKYTDWYQQKPGQAPVLVIYNDSERPSGIPDRFSGSSSGKTNTLTISGVLAEDEADYYCLSSTSD
Myotis brandtii V496 iglv ANKR01318175.1 1112 LCAAPVLTQPPSASASPGASAKLTCTLSREHSSFYIHWFQQRPGQAPRYIMQLKSDGNQTKGDGIPDRFSGSSSGADRYLTISNLQSEDEAEYICGVNY
Myotis brandtii V497 igkv ANKR01318176.1 1866 SVASYELTQSGPLSVAPGGTASMTCSGDLLDKKYTHWYQQKPSQAPVLVIYEDNKRPSGIPDRFSGSSSGKTNTLTISWVLAEDKPEYFCQSWDSSGN
Myotis brandtii V502 ighv ANKR01319668.1 609 VLSQVQLQESGPGLVKPSQTLSLTCTISGLSPTSYGVFWIRQAPGNGLEWVGVMWSSGNTAYNAALKSRLSITRDTSKSQVYLTLSSLRAEDTALYYCA
Myotis brandtii V506 iglv ANKR01322681.1 43 SWAQSVLTQPSSVSGSPGQRVTISCTGSSSNIGSYYVHWYQQLPGKAPKLVIYSTNSRPTGVPDRFSGSKSGNSGTLTITGLQAEDEADYYCS
Myotis brandtii V507 iglv ANKR01322681.1 2983 SWAQSVLTQPSSVSGSPGERVSISCTGNSTNVGYADYVSWYQQLPGKVPKLLIYQSSKRPSGIPDRFSGSRSGNSASMNITGLQAGDEGIYYCASYESSPFG
Myotis brandtii V508 iglv ANKR01322683.1 245 SWAQSVVTQPSSVSGSPGQKVTISCTGSSTNIGNNHASWQQQLPGKAPKCIIHSSNTRPSGVPDRFSGSKSGSSGTLTITGLQAEDEGDYYCSAWDDSLKA
Myotis brandtii V515 iglv ANKR01090907.1 570 CGPQPMLDQPPSVSSPLGTTIRLACTLSRDHDVSIYSIYWYQQRPGHPPRFLLRYFSHSDKRQGPKVPPRFSGSKDVAENTGYLSISGLQPEDEAMYYCAV
Myotis brandtii V519 trbv ANKR01105298.1 561 LMDAEVTQVPRYLIKRKGEKVLMGCLQDMDHERMFWYRQDPALGLQLLHFSYGVDNYEKGDFPDGYSVSRKKKEGFSLILGSASTNQTSVYLCASSI
Myotis brandtii V521 trbv ANKR01111192.1 357 PTEAEVTQTPRHLITETKKKLTVTCSQNMNHDAMYWYRQDPGLGLKLIYYSINVDHFEKGEVSDGYKVSRTEKRNFPLTLESANISQTSLYFCASR
Myotis brandtii V530 ighv ANKR01152345.1 4131 VLSQVQLQESGPGLVKPSQTLSLTCTVSGGSVTSSSYWSWIRQPPGKGLQWMGYWRGSTSYNPAFQGRISITADQAKNQFSLQLSSVTSEDTAMYYCAR
Myotis brandtii V534 trav ANKR01153191.1 1291 TAGQGVQQPPELTAMEGASVQINCTYQTPGFNGLFWYQQHDGGAPIFLSYNVLDGLDRRGRFSSFLSRSDTYSYLLLRELQMKDAASYLCAVI
Myotis brandtii V545 iglv ANKR01157589.1 3186 VDSQTVVTQEPSMSVSPGGTVTLTCGLSSGAVSRSKLPSWYQQTPGKPPRMLIYSTNNRPSGVPDRFSGSISGNKAALTITGAQPEDEADYHCALYMGSGI
Myotis brandtii V552 ighv ANKR01160873.1 2680 VHSKVQLVQSGAEVRKPGASVKVSCKASGYTFTSYTIHWVRQAPGQGLEWVGWVYPEDGDTKYAQKFQGKVSMTRDTSTSTAYMELSNLSAEDTALYYCA
Myotis brandtii V559 ighv ANKR01163987.1 341 VLSQVQLQESGPGMVKPSQTLSLTCSFSSYSITSGYCWNWILQPPGKGLEWIGRLCSSGNTYYRPSLKSRTSISRDTSKNQFSLQLSSVTTEDTAIYYCAR
Myotis brandtii V563 trav ANKR01164906.1 14706 GTSGASVNQTEGPVTLVEGAFLTLKCTYQTTYSVFFFWYVQYQNKEPVLLLKSSSDNQEVSNRGFRASLVKTDSSFHLKKPSVQMSDSAVYYCALG
Myotis brandtii V564 trdv ANKR01164906.1 12453 SSMTQKVIQAQSAISVVEKEAVALNCAYEVSSYNYYLFWYKQPPSGKMTFLIHQESYKEQNTTEGRYSLNFQKSASSISLTITDSQLRDSAVYFCALRD
Myotis brandtii V565 trav ANKR01164906.1 3019 VTNGDSVTQTEVPVTLTEGASVILNCNYQTTYSAPYLFWYVQYRSKAPSLLLKSSTEHQTAEHQGFQAKLVKSDRSFHLEKSSLQMSDSAVYYCALG
Myotis brandtii V566 trav ANKR01164907.1 1726 RTSGASVNQTEGPVTLVEGEFLTLKCTYQTTYSDFLYWYVQYRNKEPVLLLKSSSDNQEVSNRGFRASLVKTDSSFHLRKPSVQMSDSAVYYCALR
Myotis brandtii V567 trav ANKR01164908.1 4067 GIRAQTVTQPEDIISVLEGASVQVKCNYVYSGSPVLVWYVQYPRQSLQLLLKHFSGESAKGFTAVLDKSEASFHLKKPSAQEEDLAVYYCALS
Myotis brandtii V568 trav ANKR01164909.1 2232 GTGAQSATQPDGHVTVSEGAPLELRCKYSSSTSPYLYWYLQYPNQGLQLVLKYFSGNTLVKGIKDFEAEFRKDETSFNLKKHSAHWSDSAVYFCAVS
Myotis brandtii V569 trav ANKR01164911.1 19934 RIHGDSVTQTKGQVTLSEGAPLTVNCSYETILFPALFWYVQYPGEGPQLLLKATRVNESGSSKGFVATYQKQPNAFHLEKASVHQSDSAMYYCAQS
Myotis brandtii V570 trav ANKR01164911.1 15347 GVTGMNVEQSPSILILQEGTSYTVRCNFSTSVRNVQWFRQNPGGGLINLFYMTSGTKHSGRLSSTLNSKDLYSTLSITASQLEDSATYLCAAE
Myotis brandtii V571 trav ANKR01164911.1 10245 VSHGEKVDQHPSTLNVQEGNTAVINCSYSDSASNYFPWYKQELGKGPQLSIDIRSNKDKIQAGRLTVFFNKATKHLSLHIAATQPGDSAVYFCAAS
Myotis brandtii V572 trav ANKR01164911.1 487 QTHGDSVTQMEGQVTLLEGAPLTVNCTYSATGYPTLFWYVQYPGESPQFLLKAATANGKGRNKGFEATYQKQPNAFHLEKASAHQSDSAMYYCVLG
Myotis brandtii V573 trav ANKR01164914.1 4605 VSHGEKVDQHPSILNVQEGNTAVINCSYSDSRSDYFPWYKQEPGKGPQFIIDIRSNKDKNQAGGLTVLLNKAAKHFSLHMAATQPGDSAIYFCAAS
Myotis brandtii V574 trav ANKR01164915.1 5868 RIHGDSVTQTKGQVTLSEGAPLTVNCSYETILFPALFWYVQYPGEGPQLLLKATRVNENGSSKGFVATYQKQPNAFHLEKASVHQSDSAMYYCALR
Myotis brandtii V575 trav ANKR01164915.1 880 GVRGMKVEQSPSALSLQEGTSSTLRCNFSTTVTYIQWFRQNPGGGLINLFYLTSRTKYNGRLSSTLNSKDLYSTLSITASQLEDSATYLCAAS
Myotis brandtii V576 trav ANKR01164916.1 8357 GVIGMNVEQSPSILSLQEGTSSTLRCNFSTTVTNVQWFRQNPGGGLINLFYMTSGTKHSGRLSSTLNSKDRYSTLSITASQLEDSATYLCAAE
Myotis brandtii V577 trav ANKR01164917.1 25247 GVRGMKVEQSPSALSLQEGTSSTLWCNFSSTMYKVLWFRQNPGSGLISLFHMSSGTNHNGRLSSTVDSANLYSTLSITASQLKDSATYLCAAD
Myotis brandtii V578 trav ANKR01164917.1 15227 VSHGEKVDQHPSTLNVQEGNTAVINCSYSDSGSVYFPWYRQEPGKGPQFIIDIRSNKDKNQAERLTVFLNKAAQHLSLNIATTQPGDSAVYFCAAS
Myotis brandtii V579 trav ANKR01164917.1 8613 SSIAQKVTQGQRAILVQEEEAVSLDCTYDISVPRYSLFWYKQLSRGAMVFLIRQDSYNQQNATGGRYSLNFQKAKSSANLVISASQLEDSAVYFCALSE
Myotis brandtii V580 trav ANKR01164918.1 368 GVRGMKVEQSPSALSLQEGTSSTLRCNFSTTVTYIQWFRQNPGGGLINLFYLTSRTKYNGRLSSTLNSKDLYSTLSITASQLEDSATYLCAAS
Myotis brandtii V581 trav ANKR01164920.1 30508 VSHGEKVDQHPSTLSVQEGNTAVINCSYSDSASAYFPWYKQEPGKGPKLSIDIRSNKDKNQVERLTVFLNKAAKHLSLHIAATQPGDSAVYFCAAS
Myotis brandtii V582 trav ANKR01164920.1 24828 SSIAQKVTQGQQAILVQEKEAVSLECTYDTSDPRYSLFWYKQLSSGAMVFLIRQDSYNQQNATGGRYSLNFQKAKSSANLVISASQLEDSAVYFCALSE
Myotis brandtii V583 trav ANKR01164920.1 13999 GVRGMKVEQSPSALSLQEGTSSTLRCNFSTTVTNVQWFQQNPGGGLINLFYLASGTKHSGRLSSTLNSKDLYSTLSITASQLEDSATYLCAAS
Myotis brandtii V584 trav ANKR01164920.1 11055 VSHGEKVDQHPSTLNVQEGNTAVINCSYSDSVSNYFPWYKQEPGKGPQFIIDIRSNKDKIQAGRLTVFLNKAAKHLSLHIAATQPGDSAVYFCAAS
Myotis brandtii V585 trav ANKR01164921.1 1441 GVRGMKVEQSPSALSLQEGTSSTLRCNFSTTVTYIQWFRQNPGGGLINLFYLTSRTKYNGRLSSTLNSKDLYSTLSITASQLEDSATYLCAAS
Myotis brandtii V586 trav ANKR01164922.1 23892 RSNGGNSVTQTKGQVTLLEGASLTVNCSYETTGYPTLFWYVQYPGEGPHLLLKAATANEKGSGKGFEATYQKQPNAFHLEKASVHQSDSAMYYCAQS
Myotis brandtii V587 trav ANKR01164922.1 12217 DARAQSVSQPDHHVSVSERASLELRCTYVYAATPYLFWYVQYPSQGLQLLLKNFSGKTLVQGIKGFEAEFKKNESSFILRKSSAHWSDSAMYFCALS
Myotis brandtii V588 trav ANKR01164925.1 4989 DARAQSVTQPDNHISVSEGASLELRCTYSYTGTVYLYWYVQDPSQGLQLLLKYYSGDTLVKGIKNFEAELRKNESTFNLRKHFAHWSDSAEYFCAVS
Myotis brandtii V589 trav ANKR01164926.1 2581 RSNGDSVTQTKGQVTLSEGASLTVNCSYETTGYPTLFWYVQYPGEGLQLLLKAAKANEKGSNKGFEATYQKQPNAFHLEKASVHQSDSAMYYCAQS
Myotis brandtii V590 trav ANKR01164931.1 9679 TLSLAKTTQPIFMLSDEGQEVNIPCNHTNIATNEYIFWYQQFHNQGPQFVIQGYKTDTANEVASLFIAADRKSSVLRLPWASLKDTAVYYCIVSD
Myotis brandtii V591 trav ANKR01164931.1 871 LSSQKMEQNPQSLSIQESEKAVLTCSYANYSPVFFQWYRQDPGRGPIFLLLIRENERTKLVGRLRATFDTTIKQSSFYITASQPADSATYLCAA
Myotis brandtii V592 ighv ANKR01165082.1 6797 VQCEVQLVESGGDLVKFAASLRLSCAASGFTFSSSWMNWVRQPPWKGLEWVSYIRGDGSTTSYTDSVKGRFTFSRDNAKNMLYLQMYSLRVEDMAVYYCAT
Myotis brandtii V593 ighv ANKR01165085.1 26270 VQCEVQLVESGGGLVQPGGSLRLSCAASGFIFSDYEMDWVRQASGKGLEWVSYINPDGSSTSYASSVKGRFTISRDNTKNTLYLQMNSLRDEDMALYYCAR
Myotis brandtii V594 ighv ANKR01165085.1 8315 VQSEVQLVESGGGLVQPGGSLRLSCKCSGFTFSDYYINWIRQTPGKGLEWVGFIRNKANSHTTEYAASVKGRFTISRDDSKSTAYLQMSSLRAEESALYYCA
Myotis brandtii V595 ighv ANKR01165086.1 14425 ALSEVKLQESGPGLVTPSQTLSLTCTVTSYAITSVYCWSWVRQPPGKGLEWMGRICYDGNLYYTPSLKSRTSISRDTSKNQFFLQLSSVTTEDTAVYYCSR
Myotis brandtii V596 ighv ANKR01165087.1 935 VLSQVQLQESGSTVVQPSQTLSLTCAISGDSVSNNSAAWHWVRQPPGKGLQWLGRTYFESKWYREYTPSLQSQLVIDPDMSKNQFSLQLSSVTTEDTAVYYCAG
Myotis brandtii V597 ighv ANKR01165089.1 10544 VQCEVQLVESGGGLVPPGGSLRLSCAASGFTFSDYWMHWVCQAPGNGLEWVSGISGDGSSYINYANSVKGHFTISRDNSKNTLYLQMNSLRAKDTALYYCAR
Myotis brandtii V598 ighv ANKR01165089.1 7703 VLSEVQLQESGPGLVKPLQTLSLTCTVSGLSITTSASCWHWICQALGKGLEWMGRICSDGSTNYSPSLKSQTSISRDKAKNQFSLQLSSVTTEDTAVYYCMS
Myotis brandtii V599 ighv ANKR01165097.1 16276 VQCEVQLVESGGGLVQPGGSLRLSCAASGFIFSSNWMSWVRQAPGKGLEWVGIISTDGGTTNYADSVKGRFTISRDNAKNTLYLQMNSLTAKDTAVYYCA
Myotis brandtii V600 ighv ANKR01165097.1 11661 VQCEVQLVESGEGLGKPGGSLSLSCKGSGFMFSDYYISWIRQTPGKGWEWIGFIRNKANGHTTEYAASVKGRVTISRDDSKSTANLQMSSLREEDTAMYYCTTE
Myotis brandtii V601 ighv ANKR01165099.1 22022 VLSQVQLQESGPGLVKPSQTLSLTCTVSGFSLSSYGVHWNRQAPGKGLEWIGVIWADVSRIYNPTLKSRVSITKDTSNSQVYLTLNSLVAEDTARYYCAR
Myotis brandtii V602 ighv ANKR01165099.1 10230 VQCEVQLVESGGGLVQPGVSLRLSCAASEFTFSSSWITWVGQAPGKGLEWVSLINPDGSSTYYADALKGRFTISRDNAKNTLYLQMNSLRSEDMAVYYCAR
Myotis brandtii V603 ighv ANKR01165103.1 10009 VQCEVQLVESGRGLVQPGVSLRLSCAASGFTFSSYWMDWVRQAPGKGLEWLCRMNPDGSTTNYANSVKGRFTISRDNAKNMLHLQMNSLRAEESALYYCA
Myotis brandtii V604 iglv ANKR01165227.1 853 PVASSEVTQPPAVSVAPGQTATITCQGDPLTSYYPSWHQQKPGQAPVVVVYGNNNRPSGIPERFSSSDSGDTNTLTISGAQAQDEADYYCSVWDGSAE
Myotis brandtii V619 ighv ANKR01170263.1 3265 VLSQVQLQESGPGLVKPSQTLSLTCTVSGFSLTSYGVNWIRQAPGRGLEWVGVIWSGGSTDYNPTLKSRLSITRDTSKSQVYLTLNSLRAEDTAVYFCA
Myotis brandtii V659 ighv ANKR01183029.1 4717 VQCEVQLVESGGGLVQPGGSLILSCAASGFTFSSYWMYWVRQAPGNGLEWLCRMNPDGSTTNYANAVKGRFTISRDNAKNTLYLQMNSLSTQDTALYYCTT
Myotis brandtii V660 ighv ANKR01183031.1 5590 VLSQVQLQESGSSVVQDSQTLSLTCAISGDRVSSNSAAWHWVRQPPGKGLQWLGRIYFSSKWCREYAPSLQSRLVIDPDTSKNKFSLELRSVTTEDTAMYYCV
Myotis brandtii V661 ighv ANKR01183034.1 24332 VQCERQLVESGGGLVQPGGSLRLSCAASGFTFSSYHMTWVRQAPGKGLEWLCGMNPDGSNTNYANSVKGRFTISRDNTKNTLYLQMNSRRAEETALYYCA
Myotis brandtii V662 ighv ANKR01183035.1 10697 VLSQVQLQESGPGLVKPSQTLSLTCAVSGYSITSGSDWSWIRQPQGKELEWMGLINNNGDTYYSPSLKRRTSISRDTSKNQFSLQLSSLTTEDTAVYYCAG
Myotis brandtii V663 ighv ANKR01183036.1 3022 GLCQVQLVESGGGVMPPGGSLSLSCKASGFTITDYGMHWVHQAPGKGLQWVAKVNKPTGKDQWYAPAVQGRFTISRDNPTSTVSLKMTKLTSEDMAMYYCTR
Myotis brandtii V664 ighv ANKR01183039.1 8754 GLCQVQLVESRGGVVPPEGSLSLSCKASGFTFTDYSMHWVRQAPGKGLQWVAEVSKPKGTTQWYAPAVQGRFTISRDNPTSTGSLKMTKLTSEDTAVYYCA
Myotis brandtii V665 ighv ANKR01183040.1 6150 VQCEVQLVESGGGLVLPGGSLRLSCAASGFTFSIHWMGWFRQAPGKELEWLGEITPDGSTTHYANSVKGRFTISRDNAKNMLYLQMNSLRATDTDHYYCA
Myotis brandtii V669 trbv ANKR01186231.1 16686 VGAQTIHQWPSTKVKLQGSPLSLECTVKGTSNPNLYWYWQAEGGGPQMLFYSISTGKVDSQAPQNLEASRPQDGYFILHSKRLLLSDSGFYLCAWS
Myotis brandtii V674 ighv ANKR01187584.1 2623 VLSQVQLQESGPGLVKPSKTLSLTCSVSGFSITTSSYCWHWICQPPGKGLEWIAKICYEGSTYYSPSLKSRTSITRDMSKNQFSLQLSSVTTEDTAVYYCA
Myotis brandtii V697 iglv ANKR01196932.1 1071 SVSAGSLSQPVLTQPPSLSASLGATARLTCTLRSDVSVVGKAIHWYQQKPGSPPRFLLYYYTGTNLGPGVPSRFSGSKDASANAGLLTISGLQPEDEANYYCMI
Myotis brandtii V699 iglv ANKR01197586.1 4203 SLSQPVLTQPPSLSASLGATARLTCTLKSDISAVNKTIFWFQQEPGSAPRYLLSYSSSPSLGSGVPSRFSGSKDASANAGLLLISGLQPEDEADYYCLI
Myotis brandtii V710 ighv ANKR01202478.1 378 VQCEEQLVESGGGLVQPGGSLRLSCAASGFTFSTYSIDWVRQAPGKGLECVARISEGSSYIYYANSVKGRFTISRDNAKNTLSLKMSSLRAEDMAVYYCSR
Myotis brandtii V719 ighv ANKR01205289.1 677 VLSQVQLQESGPGLVKPLQTLSLTCTVSGFSITTSGYAWSWIRQPPGKGLEWIARIDYDGDTFYNPSLKSRTSISKDTSKNQFSLQLRSVTTEDMAVYYCA
Myotis brandtii V722 ighv ANKR01205606.1 3451 VLSQVQLQESGPGLVKPSQTLSLTCSVSGFSITTTGYAWHWIRQPPGKGLEWIGYITYSGSTNYSPSLKSRTSISRDTSKNQFSLQLSSLNSQDTAVYYCAR
Myotis brandtii V737 ighv ANKR01212571.1 798 VLSQVQLQESGPGLVTPLEALSLICAVSGFSITTSGYCWNWILQVPGKGLEWMGIICPDGSTAYRPSLRSQTSITRDMSKNQFSLQLSSMTTEDTAVYYCA
Myotis brandtii V738 ighv ANKR01212572.1 2522 VQCEVQLVESVGGLVQPGGSLRLSCAASRFTFSDYGMNWVRQAPGKGLEWVASISGDSSNTYYTESVKGRFTISRDNAKNTVYLQMSSLRAEDTAVYYCVR
Myotis brandtii V739 iglv ANKR01213077.1 667 PVASSVVNQPPAVSVAPGQKARITCQGDLVRESYASWYQQKPGQAPVLVVDSDENRTSKIPERFSGSDSGDTDTLTISGAQAQDEADYYCAVWDYSAG
Myotis brandtii V746 ighv ANKR01217673.1 490 VLSQVQLQESGPGLVKPSQTLSLTCTVSGGSVTSSSYWNWIRQPPGKGLQWMGYWSGGISYNPAFQGRISITADTARNQFSLQLSSVTTEDTAVYYCV
Myotis brandtii V747 ighv ANKR01217680.1 761 VQCEEQLVESGGGLVQPGGSLRLSCAASGFSFSSYWMSWVRQAPGKGLEWVAYISNGGGSTNYAHSVKGRFTISRDNAKNSLYLQMNSLRTEDTAVYYCAR
Myotis brandtii V750 ighv ANKR01219954.1 408 VQCEVQLVESGGGLVPPGGSLRLSCAASGFTFSSYGMHWVHQVPGKGLEWLCRMNPDGSTTNYANSVKGRFTISRDNAKNMLHLQMNSLRAEETAMYYCA
Myotis brandtii V757 ighv ANKR01222662.1 1137 VLSQVQLQESGPGLVKPSQTLSLTCAVSGYSITSGSDWSWIRQPQGKELEWMGLINNNGDTYYSPSLKSRTSISRDTSKNQFSLQLSSVTTKDTAVYYCAG
Myotis brandtii V762 ighv ANKR01226608.1 2614 VQCEEQLVASGGGLVQPGGSLSLSCSASGFTFSSYEMTWVRQPPGKGLEWVALISTGGSTYYADSVKGRFTISRDNAKNALYLQMSSLRADDTAVYYCA
Myotis brandtii V763 ighv ANKR01226608.1 1637 VQCEEQLVASGGGLVQPGGSLSLSCSASGFTFSSYEMTWVRQPPGKGLEWVARISSGGGSTYYSDSVKGRFTISRDNAKNALYLQMSSLRADDTAVYYCA
Myotis brandtii V766 ighv ANKR01228900.1 1333 VQCEVQLVESGGGLVQPEGSLRFSCATSEFTFSSYHMTWVRQAPGKGLEWVAIIWNDGSQKYYADSVKGRFTISRDNSKNTLYLQMNSLRAQDMAVYYCGK
Myotis brandtii V768 iglv ANKR01229306.1 540 SLSQFVVTQPPSLSASLGATARLTCTLSSDVSIGNKYIYWFQQKPGSPPRYLLRYSSDSDKHQGSGVPSRFSGSKDTSANAGHLLISGLQPEDETDYYCLI
Myotis brandtii V774 ighv ANKR01231817.1 1025 VLSQVQLQESGPGLVKPSQTLSLTCTVSGFSLTSYGVQWTRQVPGKGLEWVGGIWSNGDTYYNPTLKSRLSITRDTSKSQVYLTLNSLRAEDTAVYYCAR
Myotis brandtii V776 ighv ANKR01231912.1 2219 VQCDVQLVESGGGLVQPGGSLRLSCAASGFTFSSYHMTWVRQAPGKGLEWLCGMNPDGSNTNYANSVKGRFTISRDNTKNTLYLQMNSLRTEDMAVYYCAR
Myotis brandtii V780 ighv ANKR01233680.1 10258 VLSQVQLQESGPGLVKPSQTLSLTCAVSGFSITTSGYRWSWIRQPPRKGLEWIGYISYDGNTYYSPSLKSRTSISRDTSKNQFSLQLSSVTTEDMAVYYCAR
Myotis brandtii V781 ighv ANKR01233721.1 975 VQCEEQLVESGGGLVQPGGSLKLSCAASGFTFRDYGMNWVRQAPGKGLEWVAYHYIDSFGSSYIYYADSVKGRFTISRDNTKNTLYLQMSILRAEDTAVYYCAR
Myotis brandtii V784 iglv ANKR01235507.1 9332 SVASYELTQPPSVSVSPGQTARLTCGGNSIGSKSVHWYQQKPGQAPVLVIYRDNNRPSGIPDRFSGTNSGNTATLTISEVQAQDEADYYCAVADGSG
Myotis brandtii V785 iglv ANKR01235507.1 5358 SVASYELTQPPSVSVSPGQTARLTCGGNSIGSKIVHWYQQKPGQAPVLVIYNDNNRPSGIPDRFSGTNSGNTATLTISGAQAQDEADYYCQVWDNSAK
Myotis brandtii V802 trbv ANKR01246256.1 766 PTSASSVIQNPRRLVLGRGQEANLSCNPVKGHIYIYWYRQLLQEGLKFMIYLRREEILDDSGMPTKRFSAEFPKEGPSLFNIQLAELGDSAVYFCASSL
Myotis brandtii V811 ighv ANKR01249864.1 10372 VLSQVQLQESGPGLVKPSQTLSLTCTVSGYSISSGYCWDWIRQPPGKGLEWIAEICSSGSTYYSPSLKSRTSISRDPSKDQFSLQLTSVTTEDTAVYYCA
Myotis brandtii V812 ighv ANKR01249866.1 1594 VLSHVQLQEAGPGLVKPSKTLSLTCTVSGFSITTSGYCWNWICQPLGKGLEWMGSICYEGSTYYSSSLKNQTSISRDMSKNQFSLQLSSVTTEDTAMYYCAR
Myotis brandtii V820 ighv ANKR01251448.1 5501 VLLQVQLLEWGPGLVKPSQTLSLTCADHGVSITTSGYCWSWIRQTPGKGLEWMGCICHDGNTYYSPSLKSRTSISRDTSKNQVSLQLSSVTTGDTAVYYCAR
Myotis brandtii V821 ighv ANKR01251448.1 1330 VQCDVQLVESGGDLVQPGGSLRLSCAASGFTFSSYWMHWVRQAPGEGLEWVSLINPDGSTTYYADSVKGRFTISRDNAKNTLYLQMNSLRAEDTALYYCST
Myotis brandtii V822 ighv ANKR01251449.1 3245 SLSPGVLSQVQLQESGPGLVKPLQTLSLTCTVSGFSLTSYGVHWTRQAPGKSLEWVGAVCTDGSTTYNPTLKSRLSITRDTSKSQVYLTLNSMRAEDTAVYFCA
Myotis brandtii V823 ighv ANKR01251454.1 4172 GLCQVQLVESGGGVVPPGGSLSLSCKASGFTFTNYSMDWVRQAPGKGLQWVARVSKPKGTTQLYAPAVQGRFTIFRDNPISTVSLEITKLTSEDTALYYCTR
Myotis brandtii V824 ighv ANKR01251456.1 28137 AQCEVQLMESGGDLVQPGGSLRLSCAASGFTFSSSWMNWVRQAPGKGLEWVSYINPDGSSTYYANSVKGRFTMSRDNARNTLYLQMSSLKAEDMALYYCTT
Myotis brandtii V825 ighv ANKR01251456.1 1910 VLSQVQLQGWGPGLVKPSQTLTLTCAVYGFSITTSSYDWSWIRQPPGKGLEWMGCINHNGDTKYSPSLKSRISISRDTSKNQFSLQLSSVTTEDTALYYCV
Myotis brandtii V826 ighv ANKR01251457.1 1877 LMLLVPRCPVPGAAAGLMKPSQTLSRTCSFSGLSLRSIGVHWTHQAPGKGLEWIGVIGSAGDAYYNPTLKSRFSISRDTSKSQVYLSLTSLRAEDTAMYYCV
Myotis brandtii V827 ighv ANKR01251459.1 7340 VQCEVQLVESGGGLGKPEGTLRLSCAASGYTSSSYYMNWVRQTPGKGLEWICAITGNGDSTYYADSVKGHFTISRDNAKNTIYLQMNSLKSEDTAVYYCAT
Myotis brandtii V844 iglv ANKR01256730.1 889 SRSQDVVTPEPAITVSPGVTVTLTCGSSTGAVVNGHYPHWIQQKPGQVPKALIYNTDNRHSWTPRFSSGSIQGGKAVLTLSGAQPEDEAEYYCLLWFADY
Myotis brandtii V851 iglv ANKR01258700.1 796 SGAEPVLTQPSSVLGAPGERVTISCTDSSSKIGSNYVYWYQQLPGKAPKCIIYDNSNRYSGVPRFSGSRSGNSATLTITGLQAEDEADYYCSAWDDSLKA
Myotis brandtii V854 iglv ANKR01260467.1 15773 CGPQPMLDQPPSVSSPLGTTIRLACTLSRDHDVSIYSIYWYQQRPGHPPRFLLRYFSHSDKRQGPKVPPRFSGSKDVAENTGYLSISGLQPEDEAMYYCAV
Myotis brandtii V855 ighv ANKR01260683.1 510 VLSQVQLQESGPGLVKPSQTLSLTCSFSGFSITTSGYYWNWICQPPGKGLEWIGRICSSGDTAYSPSLKSRTSISRDTSKNQFSLQLSSVTTEDTALYYCAR
Myotis brandtii V858 iglv ANKR01261330.1 1260 VDSQTVVTQEPSVSISPGGTVTLTCGLSSGAVSTGNYPAWYQQKPGKAPHMLIYSTNNRPSGVPDRFSGSISGNKAALTISGAQPEDEADYYCGLDMGSYV
Myotis brandtii V860 iglv ANKR01264221.1 883 SWAQSVLTQPSSVSGSPGERVTISCKGSSSNIGGGYDVHWYQQLPGKAPKLIIYDNSKRPSGVPDRFSGSKSGSSGSLTITGLQAEDEADYFCQSYDSSLGA
Myotis brandtii V861 iglv ANKR01264228.1 1832 SVSAGSLSQPVLTQPPSLSASLGATARLTCTLRSDVSVVGKAIHWFQQKPGSPPRFLLYYYTGTNLGPGVPSRFSGSKDASANAGLLTISGLQPEDEANYYCMI
Myotis brandtii V862 iglv ANKR01264232.1 6803 SWAQSVLTQQSSVSGALGERVTISCTGSSSNIGGGYAVSWYQQLPGKAPKCIIYDNSNRPSGVPDRFSGSKSGSSASLTITRLQAEDEADYYCSAWDSSLKA
Myotis brandtii V863 iglv ANKR01264232.1 2997 SWAQSVLTQPSSVSGSPGERVTISCTGSSTNVGSGNGVQWYQQLPGNAPKLIIYGTSTRPSGVPDRFSGSRSGNSATLTITGLQAEDEADYYCSAWDSSLKA
Myotis brandtii V867 ighv ANKR01267308.1 6133 VQCEVQLVESGGGLVQPGGSLRLSCAASGFTFSDYCMNWVRQAPGKGLEGVAYTSYGDGNHIYYAASVKGRFTISRDYAKNTLFLQLNSLRAKDTAVYYCAR
Myotis brandtii V868 ighv ANKR01267308.1 1880 VQCEEQLVDSGGGVVQPGGSLRLSCAASGFTFSSYWMSCVRQAPGKGLVWVALISYSGGNILRRLCEGPLHHLQRQRLEHAVLQMSSLRAEDTAVYYCAR
Myotis brandtii V869 iglv ANKR01268485.1 529 SLSQPVLTQPPSLSASPGATARLTCTLRSDISVGGKNIYWYQQKPGSRPRYLLYFSSSTSLGSGVPSRFSGSKDASANAGLLTISELQPEDEADYYCMIWNSG
Myotis brandtii V870 ighv ANKR01268695.1 2414 VLSQVQLQESGLGLVKPLQTLSLTCSVSGYSITSNSCWHWIRQPPGKGLEWTGRICYNGATYYSPSLKSRTSISRDTSKHQFPLQLSSLTTEDTAMYYCA
Myotis brandtii V901 ighv ANKR01287111.1 6801 VQCEVQLVESGGGLVQPGGSLRLSCAASGFTFSSYWMGWVRQAPGKGLEWVSFITDYGGSIYYANAVKGRFTISRDNTKNTLYLQMNSLTAEDMAVYYCA
Myotis brandtii V902 ighv ANKR01287112.1 7360 VQCEVQLVESGGDLVPPGGSRRLSCAASGFTLNSHWIGWVRQAPGRGLEWLCRMNPDGSTTNYANAVKGRFTISRDNAKNTLYLQMNSLRATDMALYYCG
Myotis brandtii V903 ighv ANKR01287112.1 1306 VLSQVQLQESGYTVVQPSQTLSLTCAISGDSVSSNSAAWNWVRQPPGKGLRCLGRTFNSKCYREYVPSLQSRLFMDPDTSKNQFSLQLRSVTTENTALYYCAR
Myotis brandtii V929 trdv ANKR01297860.1 17705 VMSAIVLVSQDQVVTMSLGMSATLRCSLKGETISNYYISWYRQTQGNTMTFIHREGGMYGSGFFGKFRANINDSSNEAELEILKASERDEGIYYCASD
Myotis brandtii V930 trdv ANKR01297861.1 2374 VSLDIILESDTQTLTVLVGEAATFHCRVTGADLKNYQMSWYKKHEDNSLTLVYRLSNNSNDHLRSNIKGKIDILKKQYILDIQKATTKDVGTYYCGSD
Myotis brandtii V931 trav ANKR01297865.1 40002 VNGKNGVEQSPQHLSAQEGEVITINCSYSIGMTTLHWMRQNPGGGIVSLFMLSLEMKKKGRISATINTKESRSALHISAAQPRDSAVYLCAVE
Myotis brandtii V932 trav ANKR01297870.1 5352 SSGAQKVTQPQPEMSVQEAETATVACTYDTSWTDYYLFWYKQPPSGELIFIIRQEAFKQQNATDNRFSVNFQKATKNFSLRISDCQLEDAAVYFCVLSE
Myotis brandtii V963 ighv ANKR01317224.1 3556 VLSQVQLQESGPGLVKPSQTLSLTCSVSGFSITTSGYCWDWIRQPPGKGLEWIAEICSGGSTYYSPSLKSRTSISRDTSKNQFSLQLSSVTTKDTAVYYCA
Myotis brandtii V964 ighv ANKR01317372.1 861 VQCEVQLVESGGGLVPPGGSLRLSCAASGFTFTDYEMNWARQAPGKGLEWVSGITNTGGSTHYANSVKGRFIISRDNTKNMLYLQMKSLRAEDRAVYYCTT
Myotis brandtii V965 ighv ANKR01317374.1 7642 VQCEEQLVESGGGLVPPGGSLRLSCAASGFTFSSYHMNWVRQAPGKGLEWVSLINPDGSSTSYANSVKGRFTISRDNSKNTLYLQMNSLRAEDMAVYYCTA
Myotis brandtii V966 ighv ANKR01317375.1 34158 VQCEVQLVETGGGLVPPGGSLRLSCAASGFTFSSYWMSWVHQAPGKGLEWLGEINPDGSTTNYANAVKGRFTISRDNAKNTLYLQMNSLSTQDMAMYYCTS
Myotis brandtii V968 ighv ANKR01317375.1 8648 VQCEVQLVESGGGLVRPGGTLRLSCAASGFTFSSYHMNWVRQPPGKGLERICAINGNGGSTHYADSVKGRFTISRDNAKNTLYLQMNSLRAEDTAVYYCARE
Myotis brandtii V969 ighv ANKR01317378.1 2290 VQCEVQLVESGGGLVQPGGSLRLSCAASGFTFSDYEMDWVRQAPGKGLEWVSGITNTGGSTHYSNSVKGPFTISRDNAKNTLYLQMNSLRAQDKAVYYCTA
Myotis brandtii V970 ighv ANKR01317379.1 3481 VQCEVQLVESEGGLVLPGGSLRLSCAASGFTFSSYWMGWVRQAPGKGLEWVSLITNTGGSTYYADSVKGRFSISRDNAKNMLYLQMNSLRAKDMAVYYCLR
Myotis brandtii V971 ighv ANKR01317381.1 16877 VLSQVQLQESGPGLVQPSQTLSLTCTVSGLSLTSIGVHWTRQALGKGLEWIGVIGSAGDAYYNPTLKSRLSTSRDTSKSQVYLSLTSLTAEDTAVYYCA
Myotis brandtii V972 ighv ANKR01317382.1 39009 VLSQVQLQELGPGLVKPSQTLSLSCAVYGVSITTSGYDWNWIRQPLGKGLEWIGRINFDGDIYYSPSLKSRTSISRDTSKNQFSMKLSSVIMEDTAMYYCVR
Myotis brandtii V973 ighv ANKR01317382.1 25260 VLSEVQLQESGPGLVTPSQTLSLTCTVSGFSITISSCWSWIRQPPGKGLEWMGYTCSSGNTNYSPSLKSRTSISRDMSKNQFSLQLSSVTTEDTAVYYCTG
Myotis brandtii V974 ighv ANKR01317387.1 1396 VQCEVQLVESGGGLGKPEGTLRLSCAASGYTSSSYYMNWVRQTPGKGLEWICAITGNGDSTYYADSVKGHFTISRDNAKNTIYLQMNSLKSEDTAVYYCAT
Myotis brandtii V975 ighv ANKR01317394.1 1932 VQCEVQLVESGGGLVLPGGSRRLSCAASGFTFSSSWMSWVRQAPGKGLEWLGEINPDGSTTNYANAVKGRFTISRDNTKNTLYLQMNSLRATDMALYYCG
Myotis brandtii V976 ighv ANKR01317398.1 7507 VQCEVQLVESGGDLVQPGGSLRLSCAASGFTFNEYEMNWVRQAPGKALEWVSYINGGGGTAYYATSVKGRFITSRDNAKNTLYLQMNSLRAQDTAVYYCTTDK
Myotis brandtii V977 ighv ANKR01317398.1 5472 VQCEVQLVESGGGLVPPGGSLRLSCATSGFTFSGYWISWARQAPGKKVEWVSDINGDSSTTYYAASVMGRFTISRDNAKNMLYLQMNSLRAEDTALYYCARET
Myotis brandtii V978 ighv ANKR01317399.1 2455 VECEVQLVEFGGGLVQPGGSLRLSCAASGFTFSSYWMGWVRQAPGKGLEWLCRMNPDGSTTNYANSVKGRFTISRDNAKNTLYLQMNSMRAEDTAMYYCGT
Myotis brandtii V979 ighv ANKR01317401.1 2470 VQCEVQLVESEGGLVQPGGSLRLSCAASGFTFSSYNMNWVRQAPGKGLEWVSRITNSGGSSYYADYVKGRFTISRDNAKNTLYLQMNSLRVEDTAMYYCTT
Myotis brandtii V980 ighv ANKR01317408.1 40914 GLCQVQLVESGGGMVVPGGSLSLSCKASGFTFTDYSMHWVRQAPGKGLQWVARVSKPTGDTQWYAPEVQGRFTISRDNPTSTVSLKMTKLTSEDTAVYYCT
Myotis brandtii V981 ighv ANKR01317408.1 37355 VHSQVQLVQSGAEVRKPGASVKVSCKASGYTFTSYAMNWVRQAPGKGLQYMGWINTETGKPTYAQGFSERFVFSMDTSVSTAYLQINGLKSEDTAVYYCA
Myotis brandtii V982 ighv ANKR01317408.1 28029 VQCEVQLVESGGGLVLPGGSQRLSCAASGFSFSSYWMHWVFQAPGKGLEWLCGMDPNGSTTNYANSVKGRFTISRDNAKDMLFLQMNSLRAEDTAVYYCTT
Myotis brandtii V983 ighv ANKR01317408.1 15566 VHSQVQLVQSGAEVRKPGASVKVSCKASGYTFTSYAMHWVIQAPEKGLKYMGWINTNTGKPTYAQGFSERFVFSMDTSVTTAYLQINGLKSEDTAVYYCAR
Myotis brandtii V984 ighv ANKR01317410.1 38530 VQCEVQLVESGGGLVQPGGSLRHSCAASGFTFSSNWMHWVRQAPGKGLEWLCRMNPDGSTTNYANSVKGRFTISRDNAKNTLYLQMNSLRAEETAMYYCTT
Myotis brandtii V985 ighv ANKR01317410.1 34934 VLLQVQLLEWGPGLVKPSQTLSLTCADHGVSITTSGYCWSWIRQTPGKGLEWMGCICHDGNTYYSPSLKSRTSISRDTSKNQVSLQLSSVTTGDTAVYYCAR
Myotis brandtii V986 ighv ANKR01317410.1 6476 VQCEVQLVESGGGLVLPGGSLRLSCTASGFTFSSYWMQWVRQAPGKGLEWLGEIKTDGSITNYGTSVKGQFTISRDNDKNMLYLQMNSLRAEDTAVYYCST
Myotis brandtii V987 ighv ANKR01317417.1 29322 VHSQVQLVQSGAEVRKPGAYLKVSCKFSGYTFTSYWIQWVRQTPGQGLEWMGEVNPSNGNTNYAQKFQGRVSITRDMSINTAYMELSSLRAKDRAMYYCA
Myotis brandtii V988 ighv ANKR01317417.1 25562 VLSQVQLQELGPGLVKPSQTLSLTCTVSGFSITTSSYDWTWIRQTPVKGLEWMGCINNNGNTYYSPSLKSRTSISRDTSKNQFSLQLSSVTTEDTAVYFCA
Myotis brandtii V989 ighv ANKR01317417.1 17792 GLCQVQLVESGGGMVPPRTSLSISCKAPGFTFTDYHMYWVHLAPRKGLQWVAKVSQPTGDKQWYAPAVQGRFTIFRDNPMSTVSLKMTKLTSEDTALYYCTR
Myotis brandtii V990 ighv ANKR01317417.1 8831 GLCQVQLVESWGGVVLPGGNMSLSCKASGFTFTDYTMNWVHQAPGKGLQWVATVSQPTGKDQWYAPAVQGRFTISRDNPTSTVSLKMTKLTSEDTAVYYCT
Myotis brandtii V991 ighv ANKR01317419.1 19013 VHSQVQLVQSGAEVRKPGASMKVFCKPSWYTFTSYWMHWVRQTPGQGHEWVGWFYPKNGNTNYAQKFQGRVSMTRDTSMSTAYMELSSLRAQDTAMYYCAK
Myotis brandtii V992 ighv ANKR01317420.1 7917 AVQLMESGGGLVQPGGSLRLSCAASGFTFSSYRMNWVRQAPGKGLEWVSYINEDGSSTYYANSVKGRFTISRDNDKNTLYLQMNSLRSQDTAVYYCLR