WGS Statistics
Organism WGS Record. Vs Total IGHV IGLV IGKV TRAV TRBV TRGV TRDV
Rousettus aegyptiacus LOCP00000000.2 (LOCP02) 325 63 158 2 57 32 4 9
Vgene Table
Organism Vgene Locus contig Contig Pos. AA sequence
Rousettus aegyptiacus V151 trbv LOCP02000402.1 424269 SMDTGVTQEPTHLIMGTSSKKSLKCEQRLGHNAMYWYKHSAQKPPELMFAYNYQKMTDNGTVSSRFTPECPDSSHLELHVGALVPADSAVYLCASSR
Rousettus aegyptiacus V152 trbv LOCP02000402.1 426921 PADSGVTQTPSHLVRVRGQTATLRCSFVSGHLSVFWYQQALGQGPEFLVQYYNGELREKGKLPARFSVQPLSKSRSELNISSLEPGDSALYLCASSK
Rousettus aegyptiacus V153 trbv LOCP02000402.1 427760 SVSTGHTGARVSQSPRYRVTERGREVILFCDPISGHASLYWYRQTPGQSLEFLIYFQDEQPLDKSGMPKDRFSADRLKGTNSNLTIQRAEPGDSAVYLCASSK
Rousettus aegyptiacus V154 trbv LOCP02000402.1 429779 SMDTGVTQEPTHLIMGTSSKKSLKCEQRLGHNAMYWYKHSAQKPPELMFAYNYQKMTDNVTVPSRFTPECPDSSHLELHVGALVPADSAVYLCASSR
Rousettus aegyptiacus V155 trbv LOCP02000402.1 432488 SADSDVTQTPSHLVKARGQTASLTCSFFSGTLTVSWYQQALGQGPEFLVQYYRGEERVKGKLPARFSVEPRSNSSSKLNMRSLEPRDTALYLCTSSI
Rousettus aegyptiacus V156 trbv LOCP02000402.1 433942 SVSTGHTGARVSQSPRHRVKERGQEVLLSCDPISGHVSLYWYRQTPGRSLEFLIYFQYEKPLDKSGMPNDRFSATRSGEKNSTLMIQRAEPGDSAVYLCASSK
Rousettus aegyptiacus V157 trbv LOCP02000402.1 435314 PAHSGVTQTPRHLVKARGQTATLRCSPVSGHLYLFWYQQALGQGPEFLVEYYNGEPRQKGKLPARFSVQPLSKSRSELNMHSLEPGDSALYLCASSL
Rousettus aegyptiacus V158 trbv LOCP02000402.1 437654 SVSTGHTGARVSQSPRHRVTERGQEVLRSCDPISGHDVLYWYRQMPGQGPEFLIYFVKKDVTDRSGMPNDRFSATRSGEKNSTLTIQRAESGDSAVYLCASSE
Rousettus aegyptiacus V159 trbv LOCP02000402.1 439029 PADSGVTQTPSHLVMARGQTATLTCSFVSGHLSVSWYQQALGQGPEFLVEYYNGEPREKGKLPARFSVQPLNDSSSELNMGSLEPGDSALYLCASSL
Rousettus aegyptiacus V160 trbv LOCP02000402.1 439869 SVSTGHTGARVSQSPRHKVTERGQEVLLSCDLISGHDVLYWYRQMLGQNLEFLIYFQYEKPLDKSGMPNDRFSATRSGGKNSNLTIQRAEPGDSAVYLCASSE
Rousettus aegyptiacus V161 trbv LOCP02000402.1 441684 SADSGVTQTPSHLVRVRGQTATLRCSFVSGHLSVFWYQQALGQGPEFLVEYYDGKERAKGKLPARFSVQPLSNSRSELNMRSLEPGDSALYLCASSV
Rousettus aegyptiacus V162 trbv LOCP02000402.1 446458 PADSGVTQSPSHLVRARGQTATLTCSFVSGHRSVYWYQQALGQGPEFLVEYYNGEPREKGKLPARFSVQPLNDYRSKLNMSSLEPGDSALYLCASSL
Rousettus aegyptiacus V163 trbv LOCP02000402.1 449157 PADSGVTQSPSHLVRARGQTASLRCSFVSGHLSVFWYQQALGQGPEFLVEYYNGKENVKGKLPARFSVQPLSNSRSELNMHSLEPGDSALYLCASSL
Rousettus aegyptiacus V164 trbv LOCP02000402.1 449982 SVSTGHTGARVSQSPRHRVTERGQEVLLSCDPISGHNALYWYRQSPGWSLEFLIYFQNENAPDSSGMPNDRFSATRSGIKNSTLTIQRAEPGDSAVYLCASSK
Rousettus aegyptiacus V165 trbv LOCP02000402.1 453210 SVDVGVTQSPGHLIRGRGGKAVLKCHPMSGHSSVSWYQQAPGQVPQFLIQYDEMSERVRGNIPDRFSAQQFGNYSSELAVSSLQLADSALYLCASSV
Rousettus aegyptiacus V166 trbv LOCP02000402.1 454608 HTDAEITQSPRYKVTGTEKKVTLSCNQTNNHDYMYWYRQDLGHGLTLIHYSYDTGKTVVGDAPDGYSAARSNTESFLLTLASATPSQTAVYFCASSD
Rousettus aegyptiacus V167 trbv LOCP02000402.1 461911 STDAGVTQTPRHKVTKMEREVTLSCKPNSGHDTLFWYRQTSRQGPELLIYFRNQATIDNRGMPKDRFSAEMANESFSTLNIRATEPGDSATYLCASGS
Rousettus aegyptiacus V168 trbv LOCP02000402.1 464833 HLGAMVTQDPKYQVTRVGKPVTLNCFQDLNHDAMYWYQQKLSQAPKLLFYYYDTQLNKEPDTSDNFQPNRPNASFCSVDIGSPGLGDSATYLCASSR
Rousettus aegyptiacus V169 trbv LOCP02000402.1 466719 SLDAKVTQTPGHLVREKGQTAKMQCDPIKGHDYVYWYRQVLTKEFKFLISFQFRKVYETKIPKEIFSAKCPQNLPCILEIQSTELQDSATYLCASSE
Rousettus aegyptiacus V170 trbv LOCP02000402.1 469306 GPALGAHVTQEPSRAICRSGASLEIRCHVKDFQARTVFWYRQFPQQGFTLMATSNQGYRAKYEQGFTEDEFPISHPNTTFSNLTVASAHPADSGLYLCGAS
Rousettus aegyptiacus V171 trbv LOCP02000402.1 471808 PADSGVMQTPGHLVTARGQTASLRCSPVSGHRSLSWYQQALGQGPEFLVEYFDGKQRQKGKLPARFSVQPLNDSSSELNMGSLEPGDTALYLCASSL
Rousettus aegyptiacus V172 trbv LOCP02000402.1 474536 PTDAQVTQLLRHKVTKRGQEVNLSCEPISGHNALFWYRQPSGQGPKLLIYFNNQAPIDDTGMPQGRFSAEMPNDSFSTLNIRATEPGDSATYLCASGS
Rousettus aegyptiacus V173 trbv LOCP02000402.1 476839 GPALGAHVTQEPSRAIRRSGASLDIRCRAEDFQARTVLWYRQFSQQGLTLMATSTQGASVKYEEGFTKAAFPINHRDLKFFNLTVASAQPADSGLYLCAAS
Rousettus aegyptiacus V174 trbv LOCP02000402.1 487533 GPALGAHVTQEPSRAIRRSGASLEIRCHVKDLQATTVLWYRQFPQQGLTLMATSNLRSSATYEQGFTEAEFPISHPETTFSNLTVARAQPADSSLYLCAAS
Rousettus aegyptiacus V175 trbv LOCP02000402.1 492590 PTSGSVTQDPRHLVVGTGQEAMLKCSPEKGHLYVYWYRRLPREELKFMICLRQEEIMDQSGMPTTRYSAKFPREEPNVFKIEPAEPGDSAVYFCASSL
Rousettus aegyptiacus V176 trbv LOCP02000402.1 516653 SMNPEVTQSPSHLVKGKEQKAKIDCVPIKGHSYVYWYHQKLEEELKFLVYLQNEDIIEKTEVIDTRFLVRCPRNCSLEIQSTEPGDAALYFCASSQ
Rousettus aegyptiacus V177 trbv LOCP02000402.1 520836 TSDAEVIQTPAHLVKGRGQKAKMDCLPHKGHPVVYWYQHIQNEEFKFLIYFQNEDVLDQIELVKKRFSANCSSNSHCSLEIRSSEPGDSALYFCASSQ
Rousettus aegyptiacus V178 trbv LOCP02000402.1 524763 SMDAGVTQTPRNKIAKTGSSITLECSQNKGHDYMCWYRQDPGLGLKLIYDSIEVNNKNKGEASDGYNVSRTEQAKFPLSLTSASPSQTALYFCASSF
Rousettus aegyptiacus V179 trbv LOCP02000402.1 530508 PTEAEVTQTPRYLIAETKKNLTVTCSQNMDHEVMYWYRQDPGLGLKLIYYSINVNIIDEGEVPDGYKVSRRKKENFPLILESASADQTSLYLCASSE
Rousettus aegyptiacus V180 trbv LOCP02000402.1 536324 LMDAEVTQIPTYLVKKVGEKVLIECSQKMGHDRMFWYRQDPGLGLRLLHFSYGMGSKEKGDFPDGYSVSREKKEGFSLTLESASTSQTSVYLCASS
Rousettus aegyptiacus V181 trbv LOCP02000402.1 539906 SVFGAVLSHMPSRDICQRGTSTRIQCQADRQLALMFWYQQLPGQSLTLIATANQGSQATYESGFPKDKFPISRPNLTFSVLTVSNLSPKDSSIYFCSAG
Rousettus aegyptiacus V239 trgv LOCP02000830.1 648560 TQVSSNLEGRKMSVTRPTGLTAVFTCDSLPKSVNYIHWYRYQEGMALQHLLYYHFLSSKVVVEGGISSGKYHAYEGTGRSCKFVLLNLEESDSGVYYCAAWE
Rousettus aegyptiacus V240 trgv LOCP02000830.1 677695 VLGLSKVEQSQMSISTEVKKSVEIRCKISSTNFEKDVIFWYWQKPNQALSYLIHVSSTKFPAQSHKGGKYNKVEARKNSQILTSILTINFIEKEDAAIYYCAGW
Rousettus aegyptiacus V241 trgv LOCP02000830.1 687227 TSGDILITQIITSITKKKGNTAFLECQVKADILKKNVCIHWYRRKPDQPLKRILYISSNKNVVHEQDVSEERYEARKQQSGLLASLRIHRVNEEDAGLYYCACWD
Rousettus aegyptiacus V242 trgv LOCP02000830.1 689033 GDTKVRISQGQLSFTRRTDRTVHISCKLSGVHLENAIVHWYQQKEGEPLRRILYGSTNNYKQDKPNSRLETDKKDNGNFYLIINNVVKSDEATYYCAYWD
Rousettus aegyptiacus V261 igkv LOCP02001062.1 2437 TTGDIVMTQSPASLSLSSGERATFNCRASQSVSSYVNWYQQKPGKTPRLLIYGASTRATDIPARFSGSGSGTEFTLTISNVEPEDFATYYCQQYQSFG
Rousettus aegyptiacus V262 igkv LOCP02001062.1 49294 SRTEIIVTQSPALLSVALGDKVTITCKASQDIDDDMNWYQQKPGEAPKLLIREATTHYSGVPSRFSGSGYGIDFTLTINNMEPEDAAYYFCQQSDAL
Rousettus aegyptiacus V281 trdv LOCP02001425.1 751 SSIAQKVTQGQRAMLVQEKEAVTLDCRYDTSVTSYSLFWYKQPSSGAMIFLIRQDSYNKQNATEDRYSLNFQKANNFANLVISTAQLEDSALYFCALSE
Rousettus aegyptiacus V282 trav LOCP02001425.1 9179 RTRGDSVSQMGGQVTLSEGASLNVSCTYSASGYPALFWYVQYPGEGPQLLLKAQRANEKGREKGFEATYHREANSFHLEKASVQESDSAMYYCALS
Rousettus aegyptiacus V283 trav LOCP02001425.1 16949 VIRGEKVDQHPSILSVQEGNRTEISCTYSDSLSSYFPWYKQEAGKGPELIIDIRSNKDEKKDGRFTVTLKKAEKQLSLSIEATQPGDSAVYFCAAS
Rousettus aegyptiacus V284 trav LOCP02001425.1 24467 SSIAQKVTQSHRAMLAQEKEAVTLDCRYDTSESSYSLFWYKQLSSGAMILLIRQDSYNKQNVIEGHYSSNFQKAKNSISLVISAAQLEDSALYLCALRE
Rousettus aegyptiacus V285 trav LOCP02001425.1 33480 GVKGLEVEQSPSFLSLQEGTNATLRCSFSATVYNLQWFRQDPGGRLTSLFFLTSGMKKTRRLTCTLNSKEQYSTLHITDSQLEDSATYLCAWQ
Rousettus aegyptiacus V286 trdv LOCP02001425.1 47161 SSIAQRVTQGQRAMLVQEKEAVTLDCRYDTSDSRYSLFWYKQLSSGAMIFLIRQDSYNKQNATEDRYSFNFQKANNFANLVISTAQLEDSALYFCALSE
Rousettus aegyptiacus V287 trav LOCP02001425.1 51684 RTCGDSVSQMGGQVTLSEGASLNVSCTYSASGYPILFWYVQYPGEGPQLLLKAQRANEKGREKGFEATYHREANSFHLEKASVRESDSAMYYCALN
Rousettus aegyptiacus V288 trav LOCP02001425.1 56224 GVRGLEVEQSPSFLSLQEGTNSTLRCSFSTAMNYVQWFRQDPGGGLTSLFFLSSGMKTNGMLSSTMNFKERKSTLHITDSQLEDSATYLCAGQ
Rousettus aegyptiacus V289 trav LOCP02001425.1 62799 VIRGEKVDQHPSVLSVQEGNSSVITCTYSDSASEYFPWYKQEAGKGPQFIIHIRSNEKEKKDGRVTVTLKKAEKQLFLSIEATQPGDSAVYFCAAS
Rousettus aegyptiacus V291 trav LOCP02001425.1 88429 GTGAQSVTQPDHHVTVSEGTSLELRCTYSTSTSPYLFWYVQYPNQGLQFLLKDISGAALVTGAKDFEAVFRKNETSFHLKKSSAHWSDSATYFCAVS
Rousettus aegyptiacus V292 trav LOCP02001425.1 96229 GTRAQTVTQPEDHISVFEGDSVQVKCNYLYTGSPELFWYVQYPKQGLQLLLKYTSRTSIKGFTADLNKTEASFHLKKPSAQEEDSAMYYCALS
Rousettus aegyptiacus V293 trav LOCP02001425.1 105163 GTCGDSVKQTEGSVTLPEAAFLTLKCTYQTNYSPYLYWYVQYQNKEPELLLKSSLDNEINIRGFQARLDKEDSSFHLKKPSVQMSDTAVYYCALG
Rousettus aegyptiacus V294 trav LOCP02001425.1 106973 SSMTQKVTQAQSAIVVMENEAATLDCVYKTSSYTYYLFWYKQLPSGEMIYLIQQDSYNEQSTTVGQYSLNFQKSASSIDLTITASQVGDSAVYFCALRE
Rousettus aegyptiacus V295 trav LOCP02001425.1 114272 DTNGGDSVTQTEGPVTLLEGAPMILNCNYQTSYSAPFLFWYVQYLNKPLQLLLKSTRENQRTESQGFQAQLVKSDSSFHLQKSSLQMSDSAVYYCVLS
Rousettus aegyptiacus V296 trav LOCP02001425.1 126963 LSGEDKVEQSPQTLKVQEGDSVNLICSYTVSSFRELQWYKQDPGKGPEHLFMLYKVGKKQEKERLTATLLQKESSLHITDPKPEDSATYLCAVE
Rousettus aegyptiacus V297 trav LOCP02001425.1 142054 VRGVQVEQSPPALSLQEGANSTLSCKFSTSVSNVQWFRQNPGGHLGNLFYIPTGTQKKGRLEATTDTKDRHSSLIISSSQTTDSAIYFCAVEAQCSS
Rousettus aegyptiacus V298 trav LOCP02001496.1 18194 VSGTLNVEQSPQSLHVQEGRSTNFTCHFPSSSFYALHWYKWEPAKSPKILFIITSNRDVEAEGRVRATLDITKGYSYLYIKGSQPEDSATYLCAS
Rousettus aegyptiacus V299 trav LOCP02001496.1 25753 TAIDAEITQPNSMEYAEGKDVKLPCSHSTIGGSDYIHWYRQNPNQSLQFIIRGLRNTVNNTMASLIIATDRKSSTLILPQVTLRDSAVYYCSMS
Rousettus aegyptiacus V300 trav LOCP02001496.1 42845 GVRGLDVEQSPLSLSLQEGTNSTLRCKFSIMVTSMQWFRQNPGGGLTSLFYMSSGTKQNERLTSSMNTKERYSTLLITDSQLEDSATYLCAGQ
Rousettus aegyptiacus V301 trav LOCP02001496.1 48220 VIRGEKVDQHPSTLSVQEGNTSIITCTYSDSASRYFPWYKQEAGKGPELIIDILSNKDEKKDRRFTVTLKKAEKQLSLSIEDTQPGDSAVYFCAAS
Rousettus aegyptiacus V302 trdv LOCP02001496.1 57943 SSIAQRVTQGQRAMFVQEKEAVTLDCRYDTSVSSYTLFWYKQPSSGAMIFLIRQDSYNKQNATEDRYSLNFQKANNFANLVISTAQLEDSALYFCALSE
Rousettus aegyptiacus V303 trav LOCP02001496.1 68686 QTRGASVSQMGGQVTLSEGASLNVSCTYSASGYPTLFWYVQYPGEGPQLLLKAQRANEKGREKGFEATYHQEANSFHLEKASVQESDSAMYYCAVS
Rousettus aegyptiacus V304 trav LOCP02001496.1 70968 VIRGEKVDQHPSTLSVQEGNSSVIICTYSDSALIYFLWYKQEAGKGPQFIIDIRSNKDEKKDGRFTVTLKKAEKQFSLSIEATQPGDSAVYFCAAS
Rousettus aegyptiacus V305 trav LOCP02001496.1 78357 SSIAQKVTQGHRAMLAQGKEAVTLDCRYDTSDSSYSLFWYKQLSSGAMILLIRQDSYNKQNVTEGHYSSNFQKAKNSINLVISAAQLEDSALYFCALRE
Rousettus aegyptiacus V306 trav LOCP02001496.1 87379 GVKGLEVEQSPSFLSLQEGTNATLRCSFSATVNILQWFRQDPGGRLTSLFFLTSGMKKNKRLSCTLNSKERYSTLHITASQLKDSATYLCAVE
Rousettus aegyptiacus V307 trav LOCP02001496.1 94493 VIRGEKVDQHPSILSVQEGDSSVITCTYSDSASGYFPWYKQEAGKGPQFIIDIRSNKDEKKDGRVTVTLKKAEKQLSLRIEATQPGDSAVYFCAAS
Rousettus aegyptiacus V308 trav LOCP02001496.1 101314 SSMTQKVTQAQSAIAVMEDEAATLDCVYETSSYIYYLFWYKQLPSGEMTYLIHQESYNEQSTTEGQYSLNFQKSASSIDLTITASQVGDSAVYFCALRE
Rousettus aegyptiacus V309 trav LOCP02001496.1 108631 DTNGGDSVTQTEGPVTLLEGAPMILNCNYQTYYSTPYLFWYVQYLNKPLQLLLKSTRENQRTESQGFQAQLVKSDSSFHLQKSSLQMSDSAVYYCVLS
Rousettus aegyptiacus V310 trav LOCP02001496.1 121547 LSGEDKVEQSPQTLKVQEGDNVNLICSYTVSSFRGLQWYKQDPGKGPEHLFMLYKVGKKQEKERLTATLLQKESSLHITDPKPEDSATYLCAVE
Rousettus aegyptiacus V311 iglv LOCP02001523.1 9464 ADSQAVVIQEPSLSVPPGGNVTLTCDLSSGSVSTSYYPSWYQQTPGQAPRTLIYNTNSRLSEIPDRFSGSISGNKAALTITGAQPEDEADYYCNLYVGTDT
Rousettus aegyptiacus V312 iglv LOCP02001523.1 16128 SWAQSVLTQPSSVSGAPGQSVTISCTGSSSNIGGGYGVQWYQQLPGTAPKTLIYYSSSRPSGVPDRFSGSRSGNSASLTIRGLQAEDEADYYCSAWDNSLKA
Rousettus aegyptiacus V313 iglv LOCP02001523.1 31959 ADSQTVVTQEPSLSVSPGGTVTFTCGLSSGSVSSSNYPYWYQQTPGRAPRTLIYNTNNRLSGIPGRFSGSISGNKAALTITGAQPEDEADYYCSVRLGSA
Rousettus aegyptiacus V314 iglv LOCP02001523.1 44159 SLSQPVLTQPPSLSASPGASARLTCTLSSGFSVGSYWISWLQQKPGGPPRYLLSFYSDSSKHQGSGVPSRFSGSKDASANAGLLLISGLQPEDEADYYCAAYLS
Rousettus aegyptiacus V315 iglv LOCP02001523.1 59899 ADSQTVVTQEPSLSVSPGGTVTLTCGLSSGSVSTSNYPNWYQRTPGRAPRRLIYSTNSRPSGIPDRFSGSISGNKATLTITGAQPEDEAGYHCSLYVGSGI
Rousettus aegyptiacus V316 iglv LOCP02001523.1 68351 GTSQAVVTQEASLSTTPGGTVTLTCGSSAGAVTTSNYADWIQQKPYQVPRGLIGDTNSRVPGVPARFSGSLLGGKAALTITGAQPEDEADYYCVL
Rousettus aegyptiacus V317 iglv LOCP02001523.1 80519 ANSQTVVTQEPSLSVSPGGTVTLTCGLSSGSVSTSNNPGWHQQTPGQAPRALIYNTNSRPSGIPGRFSGSISGNKAALTITGAQPEDEADYYCSLYMGNGI
Rousettus aegyptiacus V318 iglv LOCP02001523.1 85424 SWAQSVLTQPSSVSGAPGQSVTISCTGSSSNIGRGDYVYWYQQLPGTAPKTLIYDIASSLGVPDRFSGSRSGNSASLTIRGLQAEDEADYYCSAWDSLSG
Rousettus aegyptiacus V319 iglv LOCP02001523.1 90444 SLSQPVLTQAPSASVSPGALAKLTCTLSSEHSTYTIEWYQQHPGKAPRYLMQLKSDGSHSKGDGIPDRFSGSSSGADRYLSIANVQSEDEADYICGVCYSGGY
Rousettus aegyptiacus V320 iglv LOCP02001523.1 114464 VNSQTVVTQEPSLSVSPGGTVTLTCGLSSGSVSTGNYPSWYQQTPGQAPRRFIYSTNSRPSGIPGRFSGSILGNKAALTITGAQPEDEADYYCSLYMGSNV
Rousettus aegyptiacus V321 iglv LOCP02001523.1 122246 SWAQSVLTQPSSVSGAPGQSVTISCTGSSSNIGSNYVQWYQQFPGSAPKRLIYGDNELESGVPDRFSGSKSGNSASLTIRGLQAEDEADYYCQTGDSRLNA
Rousettus aegyptiacus V322 iglv LOCP02001523.1 131641 SLSQVLTQPPSLSASLGASARLACTLSSDLSVGGKNIFWYQQKPGGPPRPFLYYYSDSDKELGPGVPSRVSGSKDTSANTAYLLISGLQPEDEADYYCSALDSS
Rousettus aegyptiacus V327 ighv LOCP02001663.1 5846 VHAQVQLVQSGAEVRKPGASVKVSCKASGYSFTGSYMHWVRQAPGQGLEWMGLVIPVFGSTNYAQKFKGRVTITADKSTSTAYMELSSLRPEDTAVYYCAE
Rousettus aegyptiacus V328 ighv LOCP02001663.1 11327 VHAQVQLVQSGAEVRKPGASVKLSCKASGYTFTSYYMHWVRQAPGQGLEWMGWVYPNSGSTVYVQKFQGRVTITADKSTSTAYMELSSLRPEDTATYYCAR
Rousettus aegyptiacus V329 ighv LOCP02001663.1 23962 VLSQVQLQESGPGQVKTLQTLSLTCTVSGFSLTSYGVQWSRQAAGKGLEWVGGIWSGGSTNYNPALKSRLSITRDTSKSQVFLTLNSMTSEDTAVYYCAR
Rousettus aegyptiacus V330 ighv LOCP02001663.1 29211 VHAQVQLVQSGAEVRKPGASVKVSCKASGYTFTSYYMHWVRQAPGQGLEWMGRVYPNSGSTSYAQKFQGRVTITADKSTSTAYMELSSLRPEDTATYYCAR
Rousettus aegyptiacus V331 ighv LOCP02001663.1 34610 RCSWWSLGEASCSPGGGVSATLLCGSGFSFSSSYMHWVRQAPGKGLEWVSYISTDGSSTSYADSVKGRFTISRDNAKNTLYLQMGSLKAEDMAVYYCAA
Rousettus aegyptiacus V332 ighv LOCP02001663.1 38667 VLSQVTLKESGPGLMRPAQTLTLTCSFSGFSLSTSGMGVGWVRQPPGKAPEWLANIWWDDDKYYSPSLKSRLTISKDTSKSQVVLTMTSMDPADTATYYCARK
Rousettus aegyptiacus V333 ighv LOCP02001663.1 48590 VQSEVQLVESGGGVVRPGGSLRLSCVASGFTFSSYWMSWVRQAPGKGLEWVSSISSSGSSTYYADSVKGRFTISRDNAKNTLYLQMGSLKAEDTAVYYCAR
Rousettus aegyptiacus V334 ighv LOCP02001663.1 65921 VLSQVQLVESGGDVVRPGGSLSLSCKASGFTFTDYAMDWVRQAPGKGLEWVATVSQPTGKNQWYAPSVQGRFTISRDNPTSTTSLKMSNLKSEDTAVYYCTR
Rousettus aegyptiacus V335 iglv LOCP02001680.1 20650 SAASSSLSQPPAVSVSPGQTATITCQGELVKKYYPLWFQQKPGQAPVTVIYGENERPPGIPDRFSALHSGDTNTLTISGVQAEDEADYYCAAWDGSVK
Rousettus aegyptiacus V336 iglv LOCP02001681.1 18979 SWAQSVLTQPSSVSGAPGQSVTISCTGSSSNIRGYCVQWVQQLPGTTPKALIYCDSSRVSGVPDRFSGSKSGNSASLTIRGLQAEDEADYYCSAWDNSLNA
Rousettus aegyptiacus V337 iglv LOCP02001681.1 30672 ADSQTVVTQEPSLSVSPGGTVTLTCGLSSGSVSTSNYPGWYQQTPGRAPRTLIYNTNSRPSGIPGRFSGSISGNKAALTITGAQPEDEADYYCSLVMSGDT
Rousettus aegyptiacus V338 ighv LOCP02001689.1 26238 VHAQVQLVQSGAEVRKPGASVKLSCKASGYSFTSYAMHWVRQAPGQGLEWMGRVIPIVGSTNYAQKFQGRVTITADQSTSTAYMELSSLRTEDTAVYYCAK
Rousettus aegyptiacus V339 ighv LOCP02001689.1 31407 VLSQVQLQESGPGQVKPSQTLSLTCTVSGGSVTSSNYWNWIRQRPGKGLEWMGYWTGSTSYNPAFQGRISITADTSRNQFSLQLNSVTTEDTAVYYCAR
Rousettus aegyptiacus V340 ighv LOCP02001689.1 48668 VLSQVQLQESGPGQVKPSQTLSLTCTVSGFSLTSYGVHWTRQAAGKGLEWVGVIWSGGSTNYNPALKSRLSITRDTSKSQVFLTLNSLTSEDTAVYYCA
Rousettus aegyptiacus V341 ighv LOCP02001689.1 53299 VHTQVQLVQSGAEVRKPGASVKLSCKASGYTFTSYYMHWVRQAPGQGLEWMGRVYPNSGSTVYAQKFQGRVTITADKSISTAYMELSSLRPEDTATYYCAR
Rousettus aegyptiacus V342 ighv LOCP02001689.1 58737 AAGGVWGRRVRPGGSLRLSCVASGFSFSSSYMHWVRQAPGKGLEWVSYISTDGSSTSYADSVKGRFTISRDNAKNTLYLQMGSLKAEDMAVYYCAA
Rousettus aegyptiacus V343 iglv LOCP02001706.1 23419 ANSQTVVTQEPSLSVSPGGTVTLTCGLSSGSVSTSNYPSWYQQTPGRAPRRLIYNTNSRASGIPGRFSGSILGNKAALTITGAQPEDEADYYCFLYVGSN
Rousettus aegyptiacus V344 iglv LOCP02001706.1 32376 GTSQAVVTQEASLSTTPGGTVTLTCGSSAGAVTSGNYPTWVQQKPYQVPQGLVSNTNSRVPGVPARFSGSLLGGKAALTITGAQPEDEADYYCVL
Rousettus aegyptiacus V345 iglv LOCP02001706.1 51197 SWAQSVLTQPSSVSGAPGQSVTISCTGSSSNIGDGYSVQWFQQLPGSAPKTVIYGTNSRPSGVPDRFSGSRSGNSASLTIRGLQAEDEADYYCETYDSSLDA
Rousettus aegyptiacus V347 iglv LOCP02001721.1 9584 SWAQSVLTQPSSVSGAPGQSVTISCTGSSSNIGLGNDVQWYQQLPGTAPKLLIYGDNELESGVPDRFSGSKSVNSASLTIRGLQAEDEADYYCQTYDSSLDA
Rousettus aegyptiacus V348 iglv LOCP02001721.1 25602 SWAQSVLTQPSSVSGAPGQSVTISCTGSSSNIGYGYVQWLQQLPGSAPKTLIYGTSSRPSGVPDRFSGSRSGSSASLTISGLQAEDEADYYCQHDKSLSA
Rousettus aegyptiacus V349 iglv LOCP02001721.1 33263 SWAQSVLTQPSSVSGAPGQSVTISCTGSSSNVGYGYLQWFQQLPGSAPKTLIYGTSSRASGVPDRFSGSRSGNSASLTIRGLQAEDEADYYCSALDSSLNA
Rousettus aegyptiacus V350 iglv LOCP02001721.1 38680 ADSQAVVIQEPSLSVPPGGNVTLTCDLSSGSVSTSYYPSWYQQTPGQAPRTLIYNTNSRLSEIPDRFSGSISGNKAALTITGAQPEDEADYYCNLYVGTDT
Rousettus aegyptiacus V351 iglv LOCP02001721.1 51051 SLSQPVLTQPPSLSASPGASARLTCTLSSGFSVGSYSIFWYQQKPGSPPRYLLSFYSDSSKHQGSGVPSRFSGSKDTSANAGLLLISGLQPEDEADYYCLV
Rousettus aegyptiacus V352 iglv LOCP02001775.1 5127 ANSQTVVTQEPSLSVSPGGTVTLTCGLSSGSVSTSNDPGWYQQTPGQAPRTLIYNTNSRPSGIPGRFSGSISGNKAALTITGAQPEDEADYYCSLDMGSYT
Rousettus aegyptiacus V353 iglv LOCP02001775.1 10163 SWAQSVLTQPSSVSGAPGQSVTISCTGSSSNIGKYNVRWFQQLPGSAPKTLIYGSSSRPSGVPDRFSGSRSGNSASLTIRGLQAEDEADYYCET
Rousettus aegyptiacus V354 iglv LOCP02001775.1 30029 SWAQSVLTQPSSVSGAPGQSVTISCTGSSSNIRGYCVQWVQQLPGTTPKALIYCDSSRVSGVPDRFSGSKSGNSASLTIRGLQAEDEADYYCSAWDNSLKA
Rousettus aegyptiacus V355 iglv LOCP02001775.1 44172 ADSQTVVTQEPSLSVSPGGTVTLTCGLSSGSVSTSNYPGWYQQTPGRAPRTLIYNTNNRPSGIPGRFSGSISGNKAALTITGAQPEDEADYYCSLG
Rousettus aegyptiacus V356 ighv LOCP02001785.1 6068 VQCEVQLVESGGGVVRPGGSLRLSCAASGFTFSSYDMTWVRQAPGKGLEWVSYINSGGSSTYYADSVKGRFTISRDNAKNTLYLQMGSLKTEDTAMYYCTS
Rousettus aegyptiacus V357 ighv LOCP02001785.1 17240 VQSEVQLVESGGGVVRPGGSLRLSCVASGFTFSSYGMHWVRQAPGKGLEWVSAISSGGGSTYYADSVKGRFIISRDNAKNTLYLQMGSLKAEDTAVYYCAK
Rousettus aegyptiacus V358 ighv LOCP02001785.1 34774 VQSEVQLVESGGGVVRPGGSLRLSCVASGFNFGSYWMYWVRQAPGKGLEWVSYIRSDGSSTYYADSVKGRFTISRDNAKNTLYLQLGSLKAEDTAVYYCAR
Rousettus aegyptiacus V359 ighv LOCP02001785.1 38039 VLSQVQLQESGPGQVKPSQTLLLTCTVSGFSLTSNSVYWTRQAAGKGLEWVGVICSGGGTDYNPALKSRLSITRDTSKSQVFLTLNSVTSEDTAVYYCAR
Rousettus aegyptiacus V360 iglv LOCP02001791.1 8523 SLSQPVLTQAPSASVSPGATAKLTCTLSSEHSTYIIEWYQQHPGKAPRYLMQLKSDGSHSKGDGIPDRYSGSSSGADRYLSIANVQSEDEADYICGVGYSGRY
Rousettus aegyptiacus V361 iglv LOCP02001791.1 14433 SWAQSVLTQPSSVSGAPGQSVTISCTGSSSNIGGGYGVQWYQQFPGSAPKLLIYADNILESGVPDRFSGSNSGNSASLTISGLQAEDEADYYCQSYDDSLDA
Rousettus aegyptiacus V362 iglv LOCP02001791.1 18474 SLSQPVLTQPPSLSASPGASARLTCTLSSGFSVGDYRIYWYQQKPGSPPRYLLRFKSDSDKHQGSGVPSRFSGSKDASANAGLLLISGLQPEDEADYYCLV
Rousettus aegyptiacus V363 iglv LOCP02001791.1 31778 VHSQTAVTQEPSLSVSPGGTVTLTCGLSSGSVSTSNYPDWYQQTPGQAPRTLIYSTNNRPSGIPGRFSGSILGNKAALTITGAQPEDEADYYCSLEMGSN
Rousettus aegyptiacus V364 iglv LOCP02001791.1 40664 ADSQTVVIQEPSLSVSPGGTVTLTCGLSSGSVSTSNYPAWFQQTPGRAPRTLIYNTNNRPSGIPGRFSGSISGNKAALTITGAQPEDEADYYCSLGMGSYT
Rousettus aegyptiacus V365 iglv LOCP02001791.1 50579 SWAQSVLTQPPSVSGAPGQSVTISCTGSSSNIGSTFVNWYQQLPGTAPKLLIYVNSNRASGVPDRFSGSKYGNSASLTIRGLQAEDEADYYCSAWYSSLN
Rousettus aegyptiacus V366 iglv LOCP02001791.1 60830 SISPFVLTQPPSLSASPGTSARLSCTLSSDLSVRGENIFWYQQKPGGPPRLFLYYYSDTDKKLGPGVPSRVSGSKDTSANTAYLLISGLQPEDEADYYCQVYES
Rousettus aegyptiacus V367 iglv LOCP02001791.1 64410 GTSQTVVTQEASLSTTPGGTVTLTCGSSAGAVTTSNYASWVQQNPYQVPRGLIGDTNNRVPGVPARFSGSLLGGKAALTITGAQPEDEADYYCVL
Rousettus aegyptiacus V368 iglv LOCP02001799.1 6731 ANSQTVVTQEPSLSVSPGGTVTLTCGLSSGSVSTSNNPGWHQQTPGQAPRALIYNTNSRPSGIPGRFSGSISGNKAALTITGAQPEDEADYYCSLWLGSA
Rousettus aegyptiacus V369 iglv LOCP02001799.1 30037 ANSQTVVTQEPSLSVSPGGTVTLTCGLSSGSVSTSKEPGWHQQTPGRAPRTVIYNTNSRPSGIPGRFSGSISGNKAALTITGAQPEDEADYYCSL
Rousettus aegyptiacus V370 iglv LOCP02001819.1 1359 SAASPNPSQPLALSVAIGQTASITCQGEIVKNYYPGWYQQKPGQAPLTVIYDKNKRPSGIPDRFSGSHSGDTSTLTISGVQAEDEADYYCSAWSYSVK
Rousettus aegyptiacus V371 iglv LOCP02001819.1 11496 SVASYELTQLPSLSVALGQTATITCEGNDIGNKYSYWYQQKPGQAPVTVIYSDSNRPSGIPDRFSGSNSGNTATLTISGAQAEDEADYYCATWDSSDN
Rousettus aegyptiacus V372 iglv LOCP02001819.1 21924 SVASYELTQPPSLSVAPGQTARITCEGNNIGSKNAYWYQQKPGQAPVLVIYQDSKRPSGIPDRFSGSNSGNTATLTISGARAEDEADYYCQVWDGNN
Rousettus aegyptiacus V373 iglv LOCP02001819.1 33439 SAASSNLSQPPAVSVSPGQTASITCQGELVKKYYANWIQQKPGQAPVTVIYGKNEQPPGIPDRFSASDSEDTNTLTISGVQAEDEADYYCDIYDNSDN
Rousettus aegyptiacus V375 iglv LOCP02001826.1 7216 SWAQSVLTQPSSVSGAPGQSVTISCTGSSSNIGGGNNVYWYQQFPGTAPKTIIYSSSNRASGVPERFSGSKSGNSASLTISGLQAEDEADYYCSAWDDSLNA
Rousettus aegyptiacus V376 iglv LOCP02001826.1 14670 SWAQSVLTQPSSVSGAPGQSVTISCTGSSSNIGRGDYVQWYQQLPGTAPKTLIYDTSRRASGVPDRFSGSRSGNSASLTIRGLQAEDEADYYCSAWDNSLSA
Rousettus aegyptiacus V377 iglv LOCP02001826.1 20060 CGDPGAIAVSASRRNVTLTCDLSSGSVSTSYYPSWYQQTPGQAPRTLIYNTNSRLSEIPDRFSGSISGNKAALSITGAQPEDEADYYCNLYVGTDT
Rousettus aegyptiacus V378 ighv LOCP02001845.1 4867 VLSQVQLQESGPGQVKPSQTLSLTCTVSGFSLTSYGVQWSRQAAGKGLEWVGAMWSGGGTDYNPALKSRLSITRDTSKSQVFLTLNSVTSEDTAVYYCAR
Rousettus aegyptiacus V379 ighv LOCP02001845.1 24359 VQCEVQLVESGGGVVRPGGSLRLSCVASGFTFSSYDMTWVRQAPGKGLEWVSDISSGGSTYYADSVKGRFTISRDNAKNTLYLQMGSLKAEDTAMYYCTS
Rousettus aegyptiacus V380 ighv LOCP02001845.1 33591 VHAQVQLVQSGAEVRKPGASVKVSCKASGYSFTGYYMHWVRQAPGQGLEWMGRVYPNDGDTDYTQKFQGRVTITADMSTSTAYMELSSLKPEDTATYYCAK
Rousettus aegyptiacus V381 ighv LOCP02001845.1 38991 VQSEVQLVESGGGVVRPGGSLRLSCVASGFTFSSYWMSWVRQAPGKGLEWVSYINTDGSSTYYADSVKGRFTISRDNAKNTLYLQMGSLKAEDTAVYYCAR
Rousettus aegyptiacus V382 ighv LOCP02001845.1 43437 AAAGVGPRTGEALADLSLTCTVSGFSLTSDGVHWTRQAAGKGLEWVGGIWSGGGTDYNPALKSRLSITRDTSKRQVFFKLNSVTSEDRAVYYCA
Rousettus aegyptiacus V383 ighv LOCP02001845.1 55035 VQCEVQLVESGGGVVRPGGSLRLSCVASGFNFGSYAMSWVRQAPGKGLEWVSYINTDGSSTYYADSVKGRFTISRDNAKNTLYLQLGSLKAEDTAVYYCA
Rousettus aegyptiacus V384 iglv LOCP02001853.1 951 GLTQPPSLSASLGASARLSCTLSSDLSVGGKNIFWYQQKPGGPPRPFLYYYSDSDKELGPGVPSRVSGSKDTSANTAYLLISGLQPEDEADYYCSALDSS
Rousettus aegyptiacus V385 iglv LOCP02001853.1 18203 TWAQSGLRQEASVSGAVGQKVTLSCTGNSNNVGSSGAGWYQQTPGAAPKTVMLGSSRPSGVPDRFSGSRSGNTAYLSITGLQPGDEADYYCSTWDCSISD
Rousettus aegyptiacus V386 iglv LOCP02001853.1 32334 SWAQSVLTQPSSVSGAPGQSVTISCTGSSSNIGDGYSVQWYQQLPGTAPKTLIYSTSSRPSGVPDRFSGSRSGSSASLTIRGLQAGDEADYYCQSYDKSLSA
Rousettus aegyptiacus V387 iglv LOCP02001856.1 2375 SWAQSVLTQPSSVSGAPGQSVTISCTGSSSNIGRGEYVQWYQQLPGSAPKTVIYGTNSRPSGVPDRFSGSRSGNSASLTIRGLQAEDEADYYCGTYDSSLDA
Rousettus aegyptiacus V388 iglv LOCP02001856.1 13756 SLSQPVLTQPPSLSASLGASARLTCTLSSGFSVGSYTIYWYQQKPGSPPRYLLYYYSDSSKHQGSGVPSRFSGSKDASANAGLLLISGLQPEDEADYYCLV
Rousettus aegyptiacus V389 iglv LOCP02001856.1 25027 SLSQPVLTQPPSLSASARLTCTLSSGFSVGSHWIYWYQQKQGSPPRYLLRLYSDSNKHQGSGGPSRFSGSKDASANAGLLLISGLQPEDEADYYCNTWDDSS
Rousettus aegyptiacus V390 iglv LOCP02001856.1 31195 ADSQTVVTQEPSLSVSPGGTVTLTCGLSSGSVSTSNYPGWYQQTPGQAPRRVIYNTNSRPSGIPGRFSGSISGNKAALTITGAQPEDEADYYCNLYMGSYT
Rousettus aegyptiacus V391 ighv LOCP02001864.1 3649 VQSEVQLVESGGGVVRPGGSLRLSCVASGFNFGSYSMSWVRQAPGKGLEWVSYIYDDGSRTSYADSVKGRFTISRDNAKNTLYLQMGSLKAEDTAVYYCAR
Rousettus aegyptiacus V393 ighv LOCP02001864.1 17561 VLSQVQLQESGPGQVKPSQTLSLTCTVSGGSVTSSNYWNWIRQRPGKGLEWMGYWTGSTRYNPAFQGRISITADTSRNQFSLQLNSVTSEDTAVYYCAR
Rousettus aegyptiacus V394 ighv LOCP02001864.1 21824 VLSQVQLQESGPGQVKPSQTLSLTCTVSGGSVTSSNYWNWICQRPGKRLEWMGYWTGSTSYKPAFQGRISITADTSRNQFSLQLNSVTTEDTAVYYCAR
Rousettus aegyptiacus V395 ighv LOCP02001864.1 32514 AAGAVWGRGEEAWGSVKLSCKASGYTFTGYYMHWVRQAPGQGLEWMGRVNTNSSSTSYAQKFQGRVTITADTSTRTAYMELSILRPEDTATYYCA
Rousettus aegyptiacus V396 iglv LOCP02001916.1 1569 ADSQTVVTQEPSLSVSPGGTVTLTCGLSSGSVSSSNYPYWYQQTPGRAPRMLIYNTNNRLSGIPGRFSGSISGNKAALTITGAQPEDEADYYCSLYMGSNI
Rousettus aegyptiacus V397 iglv LOCP02001916.1 17472 LGADSQTVVTQESSLLVPLGGTVTLTCGLSSGSVSISNSPGWYQQTPGRAPHTLIYYTNYRSSGIPDRFSGSIFGNKAALTITRAQPEDEANYYCSLITGSET
Rousettus aegyptiacus V398 iglv LOCP02001916.1 25510 SWAQSVLTQPSSVTGALGQSVTISCTGSSSNIGGGYYVQWYQQFPGSAPKLLIYGDNELESGVPDRFSGSKSGNSASLTIRGLQAEDEADYYCQTGQQSRC
Rousettus aegyptiacus V399 ighv LOCP02001918.1 11875 VHAQVQLVQSGAEVRKPGASVKVSCKASGYSFTGSYMHWVRQAPGQGLEWMGLVIPVFGSTNYAQKFKGRVTITADQSTSTAYMELSSLRPEDTAVYYCAE
Rousettus aegyptiacus V400 ighv LOCP02001918.1 17380 VHAQVQLVQSGAEVRKPGASVKLSCKASGYTFTSYYMHWVRQAPGQGLEWMGRVYPNSGSTVYAQKFQGRVTITADKSTSTAYMELSSLRPEDTATYYCA
Rousettus aegyptiacus V401 ighv LOCP02001918.1 22863 VQCEVQLVESGGGVVRPGGSLRLSCVASGFNFGSYWMNWVRQAPGKGLEWVSYISSNGGSTYYADSVKGRFTISRDNAKNTLYLQLGSLKAEDTAVYYCAT
Rousettus aegyptiacus V402 iglv LOCP02001929.1 12690 ANSQTVVTQEPSLSVSPGGTVTLTCGLSSGSVSTSNYPGWYQQTPGQPPRMLIYHTNSRPSGIPGRFSGSILGNKAALTITGAQPEDEADYYCNLYMGSNI
Rousettus aegyptiacus V403 iglv LOCP02001929.1 24445 SWAQSVLTQPSSVSGAPGQSVTISCTGSSSNIGRCNDVQWCQQLPGTAPKLLIYGDNELESGVPDRFSGSKSVNSASLTIRGLQAEDEADYYCQTYDSSLDA
Rousettus aegyptiacus V404 iglv LOCP02001971.1 1770 SWAQSVLTQPSSVSGAPGQSVTISCTGSSSNIGSTFVNWYQQLPGTAPKLLIYVNSNRASGVPDRFSGSKSGNSASLTIRGLQAEDEADYYCSAWYSSLN
Rousettus aegyptiacus V405 iglv LOCP02001971.1 16265 SLSQPVLTQPPSLSASPGASARLTCTLSSGFSVGSYRIYWFQQKPGSPPRYLLMFYTDSNKHQGSGVPSRFSGSKDASANAGLLLISGLQSEDEADYYCSV
Rousettus aegyptiacus V406 iglv LOCP02001979.1 9961 ANSQSVVTQEPSLSVSPGGTVTLTCGLSSGSVSTSNYPGWYQQTPGQAPRTLIYNTNSRPSGIPGRFSGSILGNKAALTITGAQPEDEADYYCSLYMGSGI
Rousettus aegyptiacus V409 iglv LOCP02002076.1 3202 SWAQSVLTQPSSVSGAPGQSVTISCTGSSSNIGGNCVQWVQQLPGTTPKTLIYCDSSRVSGVPERFSGSKSGNSASLTISGLQAEDEADYYCSAWDNSLR
Rousettus aegyptiacus V410 iglv LOCP02002076.1 8869 SLSQLVLTQPPSLSASPGASARLTCTLSSGFSVGNYYIYWFQQKPGSPPRYLLRFKSDSDKHQGSGVPSRFSGSKDASANAGLLLISGLQPEDEADYYCLV
Rousettus aegyptiacus V411 ighv LOCP02002171.1 4159 VLSQVQLQESGPGQVKPSQTLSLTCTVSGFSLTSYGVQWSRQAAGKGLEWVGGIWSGGSTDYNPALKSRLSITRDTSKSQVLLTLNSVTSEYTAVYYCAR
Rousettus aegyptiacus V412 ighv LOCP02002171.1 12989 VQSEVQLVESGGGVVRPGGSLRLSCVASGFNFGSYSMNWVRQAPGKGLEWVSYISYFGGSTYYADSVKGRFTISRDNAKNTLYLQLGSLKAEDTAVYYCAK
Rousettus aegyptiacus V413 iglv LOCP02002247.1 9575 SLSQPVLTQPPSLSASLGASARLTCTLSSDFSVGDYTIRWFQQKPGYLLRFKSDSDKHQGFQGPQPLLWIQRRLGQRRASAHLGLQPEDEADYYCNVWDGNSK
Rousettus aegyptiacus V414 iglv LOCP02002254.1 996 SWAQSVLTQPSSVSGAPGQSVTISCTGSSSNIGGGYGVQWYQQLPGTAPKTLIYGSSSRPSGVPDRFSGSRSGNSASLTIRGLQAEDEADYYCETYDSSLSA
Rousettus aegyptiacus V415 iglv LOCP02002254.1 5044 ADSQTVVIQEPSLSVSPGGMVTLTCGLSSGSVSSSNNPSWHQQTPGQAPRTLIYDTNSRPSGIPGRFSGSISGNKAALTITGAQPEDEADYYCSLDMGSYT
Rousettus aegyptiacus V416 iglv LOCP02002254.1 10071 SWAQSVLTQPSSVSGAPGQSVTISCTGSSSNIRDNNVQWYQQLPGSAPRLLIYDDNELDSGVPERFSGSRSGNSASLTIRGLQAEDEADYYCSDMGQS
Rousettus aegyptiacus V417 ighv LOCP02002263.1 1970 VLSQVQLVESGGDVVRPGGSLSLSCKASGFTFTDYGMAWVRQAPGKGLEWVATVSQPTGKNQWYAPSVQGRFTISRDNPTSTTSLKMSNLKSEDTAVYYCTR
Rousettus aegyptiacus V418 ighv LOCP02002263.1 5283 VLSQVQLQESGPGQVKPSQTLSLTCTVSGFSLTSYGVQWSRQAAGKGLEWVGAMWSGGGTDYNPALKSRLSITRDTSKSQVFLTLNSVSSEDTAVYYCAR
Rousettus aegyptiacus V419 ighv LOCP02002375.1 3738 VHAQVQLVQSGAEVRKPGASVKLSCKASGYSFTGYYMHWVRQAPGQGLEWMGRVYPNDGDTNYAQKFQGRVTITADKSTSTAYMELSSLRPEDTAVYYCAK
Rousettus aegyptiacus V420 iglv LOCP02002385.1 5203 SWAQSVLTQPSSVSGAPGQSVTISCTGSSSDVGYGYLQWFQQLPGSAPKTLIYGTSSRASGVPDRFSGSRSGNSASLTISGLQAEDEADYYCSA
Rousettus aegyptiacus V421 iglv LOCP02002419.1 2931 SVASYEVTQPPSLSVALGQTATITCDGNNIGSKYTYWYQQKPGQAPVTVIYRDSNRPSGIPDRFSGSSSGNRATLTISGAQAEDEADYYCSTGDSSDK
Rousettus aegyptiacus V422 ighv LOCP02002439.1 4501 VHAQVQLVQSGAEVRKPGASVKVSCKASGYTFTSYGMNWVRQAPSQGLEWMGWINTNTGKPTYAQGFSGRFVFSLDTSASTAFLQINGLRSEDTATYYCAR
Rousettus aegyptiacus V506 trdv LOCP02000171.1 2374776 TRTQVVQVNDSMYGFIGTDVVLHCSFANPLPGVKITQVTWQKATNGSKQNVAIYNPAMGVSVLAPYRERVEFLRPSFTDGTIRLSRLELEDEGVYICEF
Rousettus aegyptiacus V579 trbv LOCP02000402.1 582864 VRAQTIHQELPTKVQVVGSSLSLKCTVKGTSNPNLYWYRQDLGGALHLLFYSYSVNQTESEAPQNFTASRPKDSLFILSSKKLLLSDSGFYLCAWS
Rousettus aegyptiacus V616 trav LOCP02000571.1 180959 MCLLIGTTGQGVQQPAELVAMEGASVQVNCMYQTFGFNGLSWYQQHDGRAPIFLSYNVLDGLEKRGHFFSFLSRSDTYSYLLLKELQMKDSASYLCAVR
Rousettus aegyptiacus V617 trav LOCP02000571.1 135611 GLRAQSVTQPDYQVTVTEGDPLTVKCTYSFSGSPYLFWYVQYPNRGLQFLLKYITGDKLVKGNFGFEAEFDKQQTSFHLKKLSALVTDSAVYFCVGS
Rousettus aegyptiacus V618 trav LOCP02000571.1 126809 TLSLGKTTQPIFMDSYEGQEVNISCDHANIVTNEYILWYRQFPNQGPQFLIQGYKTNTANELVSLFIPHDRKSSTLSLPWTSLGDTAVYYCIVS
Rousettus aegyptiacus V619 trav LOCP02000571.1 123131 VSSQKVEQNPQTLSIQEGEEAILTCNYANISPVLVQWYRQDLGRGLVFLLLVRENEGKREMERLRATFNTAIKQSSFHITASQPADSATYFCAA
Rousettus aegyptiacus V620 trav LOCP02000571.1 118573 GARAQTVTQPDSHIAVSEGASLELRCKYVYTGTPYLFWYVQYPSQGLQLLLKYYSGNTLVKGENDFVAEFRKDDSSFNLKKHFAHWSDSAEYFCAVS
Rousettus aegyptiacus V621 trav LOCP02000571.1 109836 RSSGDSVTQAQGQLTLTEGASLNVSCIYSSSSYPTLFWYVQYPGEGPQPLLKATRSGDKASNQGFKATYRKEPNSFNLEKASVQESDSAMYYCALS
Rousettus aegyptiacus V622 trav LOCP02000571.1 99416 DARAQTVTQPDSHISVSEGASLELSCKYEYSGIPSLFWYVQYPSKGLQLLLKYYSGNALVKGDNDFVAEFRRNEFSFNLQKSSARLSDSAVYFCVLS
Rousettus aegyptiacus V623 trav LOCP02000571.1 89086 RSNGDSVNQAQSQVTLTEGASLTMNCYYESQQYPTLFWYVQYPGEGPRVLLKAARDNEKGSDKGFEATYRKESNSFHLEKTSVRESDSAMYYCALS
Rousettus aegyptiacus V624 trav LOCP02000571.1 82038 DSRAQTVTQPDSHISVSEGASLELRCKYDYGATPSLFWYVQYPSKGLQLLLKYYSGNTLVKGENDFVAEFRRNDFSFNLKKSSARLSDSAVYFCAVS
Rousettus aegyptiacus V625 trav LOCP02000571.1 67632 VIRGEKVDQHPSTLSVQEGNTSIITCTYSDSASNYFPWYKQEAGKGPQFIIDIRSNKDEKKDGRVTVTLKKAEKQLSLSIEATQPGDSAVYFCAAS
Rousettus aegyptiacus V626 trav LOCP02000571.1 58681 SSIAQKVTEGHRAVLVQEKGAVTLDCRYDSSFTTYSLFWYKQPSGGAMIFLISQSSYNQQNSTEGHYSLNFQKANNSVNLVISVAQLKDSALYFCAPSE
Rousettus aegyptiacus V627 trav LOCP02000571.1 50336 DVRGLELEQSPSLLSVQEGTNCTLRCEFSKTITAMQWFRQNPGGGLINLFYLTSGSKRNERLSSTMNFKEHYGILHITSSQVQDSATYLCAGQ
Rousettus aegyptiacus V628 trav LOCP02000571.1 45922 DARAQTVTQPDSHISVSEGASLELRCKYEYGVTPYLFWYVQYPGEGLQLLLKYYSGNALVKGDNDFVAEFRKNEFSFNLQKSSARLSDSAVYFCVLS
Rousettus aegyptiacus V629 trav LOCP02000571.1 30923 VIRGEKVDQHPSTLSVQEGNGSVITCTYSDSNSEYFSWYKQELGKGPQFIIGILSNKVENQVRRFTVTLKKAEQKFFLSIEDTQPGDSAVYFCAAR
Rousettus aegyptiacus V630 trav LOCP02000571.1 12729 GVRGLEVEQSPSSLSLQEGTNCTLRCNFPTTVTSIQWFQQNPGGSLISLFFLTSGTKRNERLSCTLNSKERYSTLLITASQLEDSATYFCAVE
Rousettus aegyptiacus V631 trav LOCP02000571.1 7004 VIRGEKVDQHPSTLSVQEGNVSIITCTYSDSASNYFPWYKQEAGKGPELIIDIFSNKDETKDRRFTVTLKKAEKKLSLSIEATQPGDSAVYFCAAS
Rousettus aegyptiacus V680 iglv LOCP02000863.1 136925 SWAQSVLTQPSSVSGAPGQSVTISCTGSSSNIGGNYVQWYQQFPGSAPKTSSMVLAVESGVPDRFSGSKSGNSASLTISGLQAEDEADYYCQTYDSSLSA
Rousettus aegyptiacus V681 iglv LOCP02000863.1 119839 SWAQSVLTQPSSVSGAPGQSVTISCTGSSSNIGHSTYGDYVYWYQQLPGTAPKTLIYDTSRRASGVPDRFSGSKSGNSASLTISGLQAEDEADYYCSAWDKSLNA
Rousettus aegyptiacus V682 iglv LOCP02000863.1 114414 ADSQAVVIQEPSLSVPPGGNVTLTCDLSSGSVSTSYYPSWYQQTPGQAPRTLIYNTNSRLSEIPDRFSGSISGNKAALTITGAQPEDEADYYCNLYVGTDT
Rousettus aegyptiacus V683 iglv LOCP02000863.1 95605 SLSQPVLTQPPSLSASPGASARLPCTLSSDLSVGGKNIYWYQQKPGGPPRFFLYYYSDTNKKLGPGVPSRVSGSKDTSANTAYLLISGLQPEDEADYYCHVYES
Rousettus aegyptiacus V684 iglv LOCP02000863.1 92025 GTSQTVVTQEASLSTTPGGTVTLTCGSSAGAVTTSNYADWIQQKPYQVPRGLIGDTNNRVPGVPARFSGSLLGGKAALTITGAQPEDEADYYCALWYNNH
Rousettus aegyptiacus V685 iglv LOCP02000863.1 28371 SWAQTALTQPSSMSGAPGQTVTLSCAGSSNDIGSSNYVSWYQQRSGTAPKLLIYYVSSRPSGIPDRFSGSKSGNTASLTISGLQPEDEADYYCV
Rousettus aegyptiacus V686 iglv LOCP02000863.1 13876 SWAQTALTQPSSMSGAPGQTVTLSCAGSSNDIGSYNDVSWYQQRSGTAPKLLIYYVSSRASGIPDRFSGSKSGNTASLTISGLQPEDEADYYCCSYRSGGT
Rousettus aegyptiacus V687 iglv LOCP02000863.1 7909 SWAQSALTQPSSASGAPGQTVTLSCAGSSNDIGSYNDVSWYQQRSGTAPKLLIYGVSSRASGIPDRFSGSKSGNTASLTISGLQPEDEADYYCSSYAGS
Rousettus aegyptiacus V688 iglv LOCP02000863.1 3992 SWAQTALTQPSSVSGAPGQTVTLSCAGSSNDIGRYNDVSWYQQRSGTAPKLLIYSVNTRPSGIPDRFSGSKSGNTALLIISRLQPEDEADYHCSSYAGS
Rousettus aegyptiacus V689 iglv LOCP02000872.1 71164 SWAEIVLTQPRSVSGSPGQKAIISCARSSGSISSYYVHWYQQRPGSAPITVIYEYNKRPSGVPDRFSGSTDSSSNSAYLTISGLQPEDEADYYCQSYDSGSN
Rousettus aegyptiacus V690 iglv LOCP02000872.1 30479 ADSQTVVTQEPSLSVSPGGTVTLTCGLSSGSVSTGNYPGWYQQTPGRAPRMLIYHTNNRPSGIPGRFSGSISGNKAALTITGAQPEDEADYYCSV
Rousettus aegyptiacus V691 iglv LOCP02000872.1 18202 CVTQPPSLSASPGASARLTCTLSSGFSVGSNINWYQQKPGSPPRYLLWFYSDSSKHQGSGVPSRFSGSKDASANAGLLLISGLQPEDEADYYCAAYLS
Rousettus aegyptiacus V692 iglv LOCP02000872.1 9469 ANSQSVVTQEPSLSMSPGGTVTLTCGLSSGSVSTSNYPGWYQQTPGQAPRTLIYNTNSRPSGIPGRFSGSILGNKAALTIMGAQPEDEADYYCSLYMGSGI
Rousettus aegyptiacus V693 iglv LOCP02000872.1 4495 SWAQSVLTQPSSVSGAPGQSVTISCTGSNSNIGSNYVSWYQQFPRSAPKLLIYWDSDRASGVPDRFSGSKSGNSASLTISGLQAEDEADYYCQTGDSSLNA
Rousettus aegyptiacus V705 trav LOCP02000961.1 549096 DTNGGDSVTQTEGPVTLLEGAPMILNCNYQTSYSAPFLFWYVQYLNKPLQLLLKSTRENQRTESQGFQAQLVKSDSSFHLQKSSLQMSDSAVYYCVLS
Rousettus aegyptiacus V706 trav LOCP02000961.1 502093 TAIDAEITQPNSMEYAEGKDVKLPCSHSTIGGTDYIHWYRQNPNQSPQFILRGLRNTVNNTMASLIIATDRKSSTLILPQVTLRDSAVYYCSMS
Rousettus aegyptiacus V707 trav LOCP02000961.1 491494 VRSLEVQQSPQSMIIQEGEDVTITCKSSETLYFLHWYHQKHGKGPVFLMMLQKGGEEKNHDKIVATFNENKQQSFLHITASQPTHSGTYFCGVE
Rousettus aegyptiacus V708 trav LOCP02000961.1 483096 IMGDAKSTQPEAVASTEEEPVHLPCNHPTITGAEYIYWYRQIPGQGPEYVIHSLKDNVSHGMTSLIIATDRKSSTLVLAKVTLRDSAVYYCILR
Rousettus aegyptiacus V709 trav LOCP02000961.1 475379 QQQVKQHSPTLSVQEGGISILNCDYNNNMFDYFSWYKKYPAKGPAFLISISSGMNKKNKDERVTVYLNVSVKHLSLHIADSQPGDSALYLCAAR
Rousettus aegyptiacus V710 trav LOCP02000961.1 471079 VRSQEVQQSPQSMIIQEGEDVTITCKSSKTLYSLHWYLQKHEEGPIFLMMLQKGGEEKNLDKIVATFNENKQQSSLHITTSQPSHSGTYFCGVE
Rousettus aegyptiacus V711 trdv LOCP02000961.1 464272 FSMTRSVTQPQNMVTGQEGEAVTMDCTYETTSGYYYLYWYKRPPSGEMVFLIRQYSSSSSNAKEDRYSVNLQKEKKIISLTISSLQLADSAKYFCTLD
Rousettus aegyptiacus V712 trdv LOCP02000961.1 460562 FSMTERVTQAQTTVTRREGEAVTMDCTYETTSSYYDFYWYQQLPSGEMVFLIHQYSASSNAKGDRYSVNLQKEKKIISLTISSLQLADSAKYFCALD
Rousettus aegyptiacus V713 trav LOCP02000961.1 454478 IIGDAKSTQPDAVESTEEGPVHLPCNHPTIIGREYIHWYRQIPGQGPEYLIHGLKENVSDGMMSLIIATDRKSSTLVLAQVTLRDSAVYYCILR
Rousettus aegyptiacus V714 trav LOCP02000961.1 446654 KNSDQQQVKQHSPSLSVQEGRIAILNCDYNNNMFDYFAWYKKYPAKGPALLISISSGMDKKNKDERVTVYLNVSVKHLSLHIVDSRPGDSALYLCAAS
Rousettus aegyptiacus V715 trdv LOCP02000961.1 438117 FSMTQRVTQAQTTVTQREGEAVTMDCTYETTSSYYNFYWYQQPPSGEMVFLIHQYSASSNAKGDRYSVNLQKEKKIISLTISSLQLADSAKYFCALD
Rousettus aegyptiacus V716 trav LOCP02000961.1 432383 QRQVKQHSPTLSVQEGGISILNCDYNNNAFDYFSWYKKYPAKGPALLISISSGMDKKNKDERVTVYLNVSVKHLSLHIADSQPGDSALYLCTAS
Rousettus aegyptiacus V717 trav LOCP02000961.1 427568 VRSLEVQQSPRSMIIQEGEDVTITCESSETLYSLHWYLQKPEEGPIFLMMLRKVGEEKNHDKIVATFNENKQQSSLNIMASQPSHSGTYFCGVV
Rousettus aegyptiacus V718 trav LOCP02000961.1 415088 IMGDAKSTQPDAVASTEEEPVLLPCNHPTISGAESIHWYRQIPGQGPEHMIHGLKGNVSRGMTSLIIATDRKSSTLVLAQVTLRDSAVYYCILRE
Rousettus aegyptiacus V719 trav LOCP02000961.1 397906 VFSDDKVIQSPPSLVVHEGDNATLNCNYEVTNFQSLHWYKQEEKTPTSLFVLISSGIDKHSGRLRGTLDKKERLSTLHITATQTRDSITYFCAVE
Rousettus aegyptiacus V720 trav LOCP02000961.1 378829 SSVAQTVTQPQPEMSVQETETVTLACTYDTSDSNYYLFWYKQPPSGEMIFIIRQESYKQQNAKNDRFSVNFQKATKHFSLRISDSKLEDAATYFCALMK
Rousettus aegyptiacus V721 trdv LOCP02000961.1 289183 VLLDINLEPDTKNLTVRVGEPVTFCCRVTGADLKNYQMSWYKKNEDNSLTLVYRLSNNSDHNLIRSNFKGKIDALKSQYILDIQKATAKDAGIYYCGCD
Rousettus aegyptiacus V722 trdv LOCP02000961.1 269229 AMSVHVLVPQDQVVTVSMGESVTFRCSMKGDSITKFYFSWYRKTQGNTMTFIHREENIYGPGFQDRFQGKTDILNNQAILEVLKVSEGDEGSYYCASD
Rousettus aegyptiacus V723 trav LOCP02000961.1 172094 GTRAQTVTQPEDHISVFEGDSVQVKCNYLYTGSPELFWYVQYPKQGLQLLLKYTSRTSIKGFTADLNKTEASFHLKKPSAQEEDSAMYYCALS
Rousettus aegyptiacus V734 ighv LOCP02001446.1 137944 VHAQVQLVQSGAEVRKPGASVKVSCKASGYSFTSYYMNWVRQAPGQGIEWIGRIVPENSKTTYAQKFHGRVNITADKSTTTAYMELSSLRPEDTATYYCAR
Rousettus aegyptiacus V739 iglv LOCP02001508.1 119006 TWAQRGLRQEASVLESVGQKVTLSCTWNSNNVESCGAGWYQQMPGAAPKTRMRGSSRPSGVPDRFSGSWSSNMAYLSIAGLQPGDETDYYCSPWDGSSSD
Rousettus aegyptiacus V740 iglv LOCP02001508.1 116180 SLSQLVVTQPPSLSASPGASARLTCTLSSGFSVGGHRINWYQQKAGSPPWYLLSFYTDSSKHQGSGVPSRFSGSKDASANAGLLLISGLQPEDEADYYCSV
Rousettus aegyptiacus V741 iglv LOCP02001508.1 103936 SWAQSVLTQPSSVSGAPGQSVTISCTGSSSNIGYGYVQWFQQLPGSAPKTLIYGTSSRASGVPDRFSGSRSGNSASLTISGLQAEDEADYYCSA
Rousettus aegyptiacus V742 iglv LOCP02001508.1 98529 ADSQAVVIQEPSLSVPPGGNVTLTCDLSSGSVSTSYYPSWYQQTPGQAPRTLIYNTNSRLSEIPDRFSGSISGNKAALSITGAQPEDEADYYCNLYVGTDT
Rousettus aegyptiacus V743 iglv LOCP02001508.1 91954 SWAQSVLTQPSSVSGAPGQSVTISCTGSSSNIGGGYGVQWYQQLPGTAPKTLIYGDSSRASGVPDRFSGSRSGNSASLTIRGLQAEDEADYYCSAWDNSLNA
Rousettus aegyptiacus V744 iglv LOCP02001508.1 90279 TWAQRGLRQEASVLESVGQKVTLSCTWNSNNVGSCGAGWYQQTPGAAPKTRMRGSSRPSGVPDRFSGSRSSNTAYLSIAGLQPGDEADYYCSPWDGSSSD
Rousettus aegyptiacus V745 iglv LOCP02001508.1 65029 ANSQTVVTQEPSLSVSPGGTITLTCGLSSGSVSTSNYPGWFQQTPGRAPRLLIYDTNNRPSGIPGRFSGSISGNKAALTITGAQPEDEADYYCLV
Rousettus aegyptiacus V746 iglv LOCP02001508.1 60540 SWAQSVLTQPSSVSGAPGQSVTISCTGSSSNIGHSTYGYYVQWFQQLPGSAPKTLIYDTSSRASGVPDRFSGSRSGNSASLTISGLQAEDEADYYCSAWDNSLS
Rousettus aegyptiacus V747 iglv LOCP02001508.1 44584 ADSQTVVTQEPSLSVSPGGTVTLTCGLSSGSVSSSNYPYWHQQTTGRAPRTLIYNTNSRPSGIPGRFSGSISGNKAALTITGAQPEDEADYYCSLVMSGDT
Rousettus aegyptiacus V748 iglv LOCP02001508.1 38346 SLSQPLLTQPPSASASLGGPAKLTCTLIIGYNSYSVDWYQQGPGKGPRFLMRVGTSGVIGSKGDGVPDRFSGSGSGLDRYLTIQNIQAEDEADYYCGVKDGSE
Rousettus aegyptiacus V749 iglv LOCP02001508.1 27687 ANSQTVVTQEPSLSVSPGGTVTLTCGLSSGSVSTSNYPGWYQQTPGQAPRTLIYHTNSRPSGIPGRFSGSISGNKAALTITGAQPEDEADYYCSLDMGSYT
Rousettus aegyptiacus V750 iglv LOCP02001508.1 10034 ADSQAVVIQEPSLSVPPGGNVTLTCDLSSGSVSTSYYPSWYQQTPGQAPRTLIYNTNSRLSEIPDRFSGSISGNKAALTITGAQPEDEADYYCNLYVGTDT
Rousettus aegyptiacus V751 iglv LOCP02001508.1 1957 SWAQSVLTQPSSVSGAPGQSVTISCTGSSSNIGGGYYVQWYQQFPGSAPKLLIYGDNELESGVPDRFSGSKSGNSASLTIRGLQAEDEADYYCQTGDSSLDA
Rousettus aegyptiacus V755 iglv LOCP02001635.1 99291 SWAQSVLTQPSSVSGAPGQSVTISCTGSSSNIGRSGYVQWYQQLPGTAPKTLIYGTSRRASGVPDRFSGSRSGNSASLTIRGLQAEDEADYYCSAWDNSLNA
Rousettus aegyptiacus V756 iglv LOCP02001635.1 93891 ADSQAVVIQEPSLSVPPGGNVTLTCDLSSGSVSTSYYPSWYQQTPGQAPRTLIYNTNSRLSEIPDRFSGSISGNKAALTITGAQPEDEADYYCNLYVGTDT
Rousettus aegyptiacus V757 iglv LOCP02001635.1 85860 SWAQSVLTQPSSVSGAPGQSVTISCTGSSSNIGGGYYVQWYQQFPGSAPKLLIYGDNELESGVPDRFSGSKSGNSASLTIRGLQAEDEADYYCQTGDSSLDA
Rousettus aegyptiacus V758 iglv LOCP02001635.1 61805 LGADSQTVVTQESSLLVPLGGTVTLTCGLSSGSVSISNSPGWYQQTPGRAPHTLIYYTNYRSSGIPGRFSGSIFGNKAALTITRAQPEDEANYYCSLITGSET
Rousettus aegyptiacus V759 iglv LOCP02001635.1 43241 ANSQTVVTQEPSLSVSPGGTVTLTCGLSSGSVSTSNYPSWYQQTPGQAPRTLIYRTNSRPSGIPGRFSGSISGNKAALTITGAQPEDEADYYCSLYMGSNV
Rousettus aegyptiacus V760 iglv LOCP02001635.1 38385 SWAQSVLTQPSSVSGAPGQSVTISCTGSSSNIGVWLCAVVPAAPGIGPQTLIYGTSSRASGVPDRFSGSKSGNSASLTISGLQAEDEADYYCSAWDKQSQC
Rousettus aegyptiacus V761 iglv LOCP02001635.1 34349 ADSQTVVTQEPSLSVSPGGTVTLTCGLSSGSVSTSNYPGWYQQTPGRAPRMLIYNTNNRPSGIPGRFSGSISGNKAALTITGAQPEDEADYYCSLGMGSYT
Rousettus aegyptiacus V762 iglv LOCP02001635.1 24088 SWAQSVLTQPSSVSGAPGQSVTISCTGSSSNIGSTFVNWYQQLPGTAPKLLIYVNSNRASGVPDRFSGSKSGNSASLTIRGLQAEDEADYYCSAWDSSLN
Rousettus aegyptiacus V763 iglv LOCP02001635.1 19418 SLSQLVLTQPPSLSASPGASARLTCTLSSGFSVGNYYIHWYQQKPGSPPRYLLWFYSDSNKHQGPGVPSRFSGSKDASTNAGLLLISGLQPEDEADYYCSV
Rousettus aegyptiacus V764 iglv LOCP02001635.1 7031 SLSQPVLTQPPSLSASPGASARLTCTLSSGFSVGSYYINWYQQKPGSPPRYLLWFYSDSSKHQGSGVPSRFSGSKDASANAGLLLISGLQPEDEADYYCAAYLS
Rousettus aegyptiacus V765 iglv LOCP02001666.1 60369 SWAQSVLTQPSSVSGAPGQSVTISCTGSNSNIGSNYVSWYQQFPRSAPKLLIYWDSDRASGVPDRFSGSKSGNSASLTISGLQAEDEADYYCQTGDSSLNA
Rousettus aegyptiacus V766 iglv LOCP02001666.1 17635 ANSQTVVTQEPSLSVSPGGTVTLTCGLSSGSVSTSNDPGWYQQTPGQAPRTLIYNTNSRPSGIPGRFSGSISGNKAALTITGAQPEDEADYYCSLDMGSYT
Rousettus aegyptiacus V767 iglv LOCP02001666.1 12686 SWAQSVLTQPSSVSGAPGQSVTISCTGSSSNIRDNYVSWYQQFPGSAPKLLIYDDNELESGVPDRFSGSKSGNTATLTISGLQAEDEADYYCQTYDDSLDV
Rousettus aegyptiacus V768 iglv LOCP02001666.1 2639 SWAQSVLTQPSSVSGAPGQSVTISCTGSSSNIGDNYVQWYQQLPGIGPKTLIYYSSRVSGVPDRFSGSKSGNSASLTIRGLQAEDEADYYCSAWDNSLS
Rousettus aegyptiacus V771 ighv LOCP02001701.1 49777 VHAQVQLVQSGAEVRKPGASVKLSCKASGYTFTSYYMNWVRQAPGQGLESIGWVNPNDGSTGYTQKFQGRVTMTADKSTSTAYMELSSLRPEDTATYYCA
Rousettus aegyptiacus V772 ighv LOCP02001701.1 44373 VQCEVQLVESGGGVVRPGGSLRLSCVASGFTFGSYWMYWVRQAPGKGLEWVSSISSDGSSTYYADSVKGRFTISRDNAKNTLYLQMGSLKAEDTAVYYCAR
Rousettus aegyptiacus V773 ighv LOCP02001701.1 30948 VQSEVQLVESGGGVVRPGGSLRLSCVASGFTFSSYWMIWVRQAPGKGLEWVSYINTGGSSTYYADSVKGRFTISRDNAKNTLYLQLGSLKAEDTAVYYCAR
Rousettus aegyptiacus V774 ighv LOCP02001701.1 26851 VLSQVQLVESGGDVVRPGGSLSLSCKASGFTFTDYGMAWVRQAPGKGLEWVATVSQPTGKTQWYAPSVQGRFTISRDNPTSTTSLKMSNLKSEDTAVYYCTR
Rousettus aegyptiacus V775 ighv LOCP02001701.1 23521 VLSQVQLQESGPGQVKPSQTLSLTCTVSGFSLTSYSVQWSRQAAGKGLEWVGAMWSGGGTDYNPALKSRLSITRDTSKSQVFLTLNSVTSEDTAVYYCAR
Rousettus aegyptiacus V776 ighv LOCP02001701.1 18785 VHTQVQLVQSGAEVRKPGASVKVSCKASGYTFTSYGMNWVRQAPSQGLEWMGWINTYTGKPTYAQGFSGRFVFSLDTSASTAFLQINGLRSEDTATYYCAR
Rousettus aegyptiacus V777 ighv LOCP02001701.1 14304 VQCEVQLSESGGDLRQPGGTLRLSCQGSGFTFSDHYMSWIRQTPGQSLEWVGFIRNKAKGHTTEYAASVKGRFTISRDDSKSVAYLQMSSLKAEDTAVYYCAT
Rousettus aegyptiacus V778 ighv LOCP02001701.1 4889 VHAQVQLVQSGAEVRKPGASVKVSCKASGYSFTSYYMHWVRQEPDQGLEWIGLVYPNDGSRVYAQNFKGRVTMTADKSTSTAYMELSSLRPEDTATYYCAR
Rousettus aegyptiacus V779 iglv LOCP02001702.1 56693 ADSQTVVIQEPSLSVSPGGTVTLTCGLSSGSVSTSNYPGWYQQTPGRAPRMLIYNTNNRPSGIPGRFSGSISGNKAALTITGAQPEDEADYYCSLYG
Rousettus aegyptiacus V780 iglv LOCP02001702.1 46583 SWAQSVLTQPSSVSGAPGQSVTISCTGSSSNIGSNSVNWYQQLPGTAPKRLIYGTSNRHSGVPNRFSGSKSGSSGSLTISGLQDEDEADYYCSGWDNSLN
Rousettus aegyptiacus V781 iglv LOCP02001702.1 29642 ANSQTVVTQEPSMSVSPGGTVTLTCGLSSGSVSSSNNPGWYQQTPGRAPRRLIYHTNSRPSGIPGRFSGSISGNKAALTITGAQPEDEADYYCSLYMGSN
Rousettus aegyptiacus V782 iglv LOCP02001702.1 22106 SWAQSVLTQPSSVSGAPGQSVTISCTGSSSNIGGGNSVYWYQQFPGTAPKTIIYSSSNRASGVPERFSGSKSGNSASLTISGLQAEDEADYYCSAWDDSLNA
Rousettus aegyptiacus V783 iglv LOCP02001723.1 41597 ANSQTVVTQEPSLSVSPGGTVTLTCGLSSGSVSTGNYPGWYQQTPGRAPRMLIYHTNNRPSGIPGRFSGSISGNKAALTITGAQPEDEADYYCSLAVV
Rousettus aegyptiacus V784 iglv LOCP02001723.1 28527 SFSQAVLTQPPSHSTSQGSTARLSCTLISGFNVGGYVISWYQQKPGSPPQYLLWFKSDSQKHQGSGVPSRFSGSKDASANAGLLLISGLQPEDEADYYCAT
Rousettus aegyptiacus V785 iglv LOCP02001723.1 23214 SLSQPVLTQAPSASVSPGAPAKLTCTLSSEHSTYTIEWYQQHPGKAPRYLMQLNSDGSHSKGDGIPDRFSGSSSGADRYLSIANVQSEDEADYICGVSYSGGY
Rousettus aegyptiacus V786 iglv LOCP02001723.1 17326 SWAQSVLTQPSSVSGAPGQSVTISCTGSSSNIGYGNSVQWLQQLPGTTPKTLIYCSSSRVSGVPDRFSGSKSGNSASLTIRGLQAEDEADYYCSAWDNSLR
Rousettus aegyptiacus V787 iglv LOCP02001723.1 11674 SLSQPVLTQPPSLSASPGASARLTCTLSSGFSIGSYGTYWFQQKPGSPPRYLLYYHTDSYKHQGSGVPSRFSGSKDASANAGLLLISGLQPEDEADYYCLV
Rousettus aegyptiacus V788 iglv LOCP02001723.1 539 SLSQPVLTQPPSLSASPGASARLTCTLSSGFSVGSYRIYWYQQKPGSPPRYLLGFYSDSDKHQGSGVPSRFSGSKDTSANTGLLLISGLQPEDEADYYCAA
Rousettus aegyptiacus V789 iglv LOCP02001726.1 48614 SLSQPVLTQPPSLSASPGASARLTCTLSSGFSVGSYRIYWYQQKPGSPPRYLLSFYSDSNKRQGSGVPSRFSGSKDASANAGLLLISGLQPEDEADYYCAA
Rousettus aegyptiacus V790 iglv LOCP02001726.1 40964 SWAQSVLTQPSSVSGAPGQSVTISCTGSSSNIGGGYGVQWYQQLPGTAPKTLIYDDSSRASGVPDRFSGSRSGNSASLTIRGLQAEDEADYYCSAWDNSLKA
Rousettus aegyptiacus V791 iglv LOCP02001726.1 39271 WPEQEASVLESVGQKVTLSCTWKQQQRGSCGAGWYQQTPGAAPKTVMRGSSRPSGVPDRFSGSRSSNTAYLSIAGLQPGDEADYYCSPWDGSSSD
Rousettus aegyptiacus V792 iglv LOCP02001726.1 36491 SLSQLVLTQPPSLSASPGASARLTCTLSSGFSVGSYYINWYQQKPGSPPRYLLSFYSDSNKHQGPGVPSRFSGSKDASTNAGLLLISGLQPEDEADYYCSV
Rousettus aegyptiacus V793 iglv LOCP02001726.1 13060 SWAQSVLTQPSSVSGAPGQSVTISCTGSSSNIRGYCVQWVQQLLGTTPKTLIYCDSSRVSGVPDRFSGSKSGNSASLTIRGLQAEDEADYYCSAWDNSLKA
Rousettus aegyptiacus V794 iglv LOCP02001726.1 1513 ANSQTVVTQEPSLSVSPGGTVTLTCGLSSGSVSTSNYPGWYQQTPGQAPRTLIYNTNSRPSGIPGRFSGSISGNKAALTITGAQPEDEADYYCSLYMGSYT
Rousettus aegyptiacus V795 iglv LOCP02001731.1 42859 SVASYELTQLPSLSVAPGQTARITCEGNNIGSRSVRWYQQKPGQAPVLVIYSDSSRPSGIPDRFSGSNSGNTAALTISGARAEDEADYYCQVQDGNN
Rousettus aegyptiacus V796 iglv LOCP02001731.1 31273 SAASSNLSQPPAVSVAIGQTAKITCQGELVKKYYPNWFQQKPGQAPVLVINGKNERPSGIPDRFSAPHSGDTNTLTISGVQAEDEADYYCAEWDDSVK
Rousettus aegyptiacus V797 iglv LOCP02001731.1 22892 SVASYEVTQLPSLSVAPGQTARITCEGNNIGSKSVHWYQQKPGQAPVLVIYSDSSRPSGIPDRFSGSNSGNTAALTISGAQAEDEADYYCQVWDGNN
Rousettus aegyptiacus V798 iglv LOCP02001731.1 13793 SVASSTLSQPPAVSVAIGQTASITCQGEIVKKYYPSWFQQKPGQAPVLVIYGNNQRPSGIPDRFSGSHSGDTGTLIISGVQAEDEADYYCASWDDSDK
Rousettus aegyptiacus V799 iglv LOCP02001734.1 43785 CADPAVLSVWGPGQSVTISCTGSSSNIGDNNVQWYQQLPGSAPRLLIYDDNELDSGVPDRFSGSRSGNSASLTIRGLQAEDEADYYCQTYDDSLDA
Rousettus aegyptiacus V800 iglv LOCP02001734.1 34071 GTSQTVVTQEASLSTTPGGTVTLTCGSSAGAVTTSNYASWVQQNPYQVPRGLIGDTNNRVPGVPARFSGSLLGGKAALTITGAQPEDEADYYCVL
Rousettus aegyptiacus V801 iglv LOCP02001734.1 15790 SWAQSVLTQPSSVSGAPGQSVTISCTGSSSNIGYSTQGYHVQWFQQLPGSAPKTLIYYTSSRASGVPDRFSGSKSGNSASLTISGLQAEDEADYYCCIIVSVL
Rousettus aegyptiacus V802 iglv LOCP02001734.1 5906 SFSQAVLTQPPSHSTSQGSTARLSCTLISGFNVGGYVISWYQQKPGSPPQYLLWFKSDSQKHQGSGVPSRFSGSKDASANAGLLLISGLQPEDEADYYCAT
Rousettus aegyptiacus V803 iglv LOCP02001739.1 51197 SWAQTALTQPSSASGALGQTVTLSCAGSSNDIGRYNEVSWYQQRSGTAPKLLIYGVNRRPSGIPDRFSGSKSGNTASLTISGLQPEDEADYYCCSYVGS
Rousettus aegyptiacus V804 iglv LOCP02001739.1 36566 SWAQTALTQPSSMSGAPGQTVTLSCAGSSNDIGSYDAVSWYQQRSGTAPKLLIYGVNRRPSGIPDRFSGSKSGNTASLTISGLQPEDEADYYCCSYAGS
Rousettus aegyptiacus V805 iglv LOCP02001739.1 23053 SWAQTALTQPSSMSGAPGQTVTLSCAGSSNDIGSYNDVSWYQQRSGTAPKLLIYSVSSRPSGIPDRFSGSKSGNTASLTISGLQPEDEADYYCCSYAGST
Rousettus aegyptiacus V806 iglv LOCP02001739.1 19140 SWAQTALTQPSSVSGAPGQTVTLSCAGSSNDIGRYNDVSWYQQRSGTAPKLLIYSVNTRPSGIPDRFSGSKSGNTALLIISRLQPEDEADYHCSSYAGS
Rousettus aegyptiacus V807 iglv LOCP02001739.1 9954 SAASPNPSQPLALSVAIGQTASITCQGEIVKNYYPGWYQQKPGQAPLTVIYDKNKRPSGIPDRFSGSHSGDTSTLTISGVQAEDEADYYCSAWSYSVK
Rousettus aegyptiacus V808 iglv LOCP02001788.1 37450 SWAQTALTQPSSMSGAPGQTVTLSCAGSSNDIGSYNDVSWYQQRSGTAPKLLIYIVNTRPSGIPDRFSGSKSGNTASLTISGLQPEDEADYYCGFYRSRGT
Rousettus aegyptiacus V809 iglv LOCP02001788.1 31481 SWAQTALTQPSSMSGAPGQTVTLSCAGSSNDIGRYNDVSWYQQRSGTAPKLLIYSVNTRPSGIPDRFSGSKSGNTALLIISRLQPEDEADYHCSSYAGS
Rousettus aegyptiacus V810 iglv LOCP02001788.1 22297 SAASPNPSQPLALSVAIGQTASITCQGEIVKNYYPGWYQQKPGQAPLTVIYDKNKRPSGIPDRFSGSHSGDTSTLTISGVQAEDEADYYCSAWSYSVK
Rousettus aegyptiacus V812 iglv LOCP02001835.1 14521 ANSQTVVTQEPSLSVSPGGTVTLTCGLSSGSVSTSNYPEWYQQTPGRAPRTLIYSTNSRPSGIPGRFSGSISGNKAALTITGAQPEDEADYYCSL
Rousettus aegyptiacus V813 trav LOCP02001840.1 10767 TAIDAEITQPNSMEYAEGKDVKLPCSHSTIGGSDYIHWYRQNPNQSLQFIIRGLRNTVNNTMASLIIATDRKSSTLILPQVTLRDSAVYYCSCE
Rousettus aegyptiacus V814 ighv LOCP02001863.1 53600 VLSQVQLQESGPGQVKPSQTLSLTCTVSGFSLISYGVHWTRQAAGKGLEWVGVIWSGGSTNYNPALKSRLSITRDTSKSQVFLTLNSLTSEDTAVYYCAR
Rousettus aegyptiacus V815 ighv LOCP02001863.1 48845 VHAQVQLVQSGAEVRKPGASVKVSCKASGYTFTSYGMNWVRQAPSQGLEWMGWINTYTGKPTYAQGFSGRFVFSLDTSASTAFLQINGLRSEDTATYYCAR
Rousettus aegyptiacus V816 ighv LOCP02001863.1 44331 VQCEVQLSESGGDLRQPGGTLRLSCQGSGFTFSDHYMSWIRQTPGQSLEWVGFIRNKAKGHTTEYAASVKGRFTISRDDSKSVAYLQMSSLKAEDTAVYYCTT
Rousettus aegyptiacus V817 ighv LOCP02001863.1 40126 VLSQVQLQESGPGQVKPSQTLSLTCTVSGFSLTGNSVQWSRQAAGKRLEWVGAMWSGGGTDYNPALKSRLSITRDTSKSQVFLTLNSVTSEDTAVYYCA
Rousettus aegyptiacus V818 ighv LOCP02001863.1 35591 VHTQVQLVQSGAEVRKPGASVKLSCKASGYTFTDYDMEWVRQAPGQGLEWMGDIDPENSKTSYAQKFQGRVTITADTSTSTAYMELSNLRPEDTATYYCAT
Rousettus aegyptiacus V819 ighv LOCP02001863.1 22483 VQSEVQLVESGGGVVRPGGSLRLSCVASGFTFSSYWMGWVRQAPGKGLEWVSYILHDSGSTYYADSVKGRFTISRDNAKNTLYLQMGSLKAEDTAVYYCAR
Rousettus aegyptiacus V820 ighv LOCP02001863.1 19633 VLSQVQLQESGPGQVKPSQTLSLTCADYKVSLTSSGYCWHWIRQPPEKELEWMGRICYNGNTYYSPSLKSRTSISRDTSKSQFSLQLNSVTSEDTAVYYCAR
Rousettus aegyptiacus V821 ighv LOCP02001863.1 6936 VQCEVQLVESGGGVVRPGGSLRLSCVASGFTFSSYSMYWVRQAPGKGLEWVSYIYDDGSSTSYADSVKGRFTISRDNAKNTLYLQLGSLKAEDTAVYYCTT
Rousettus aegyptiacus V822 iglv LOCP02001887.1 30999 ADSQAVVIQEPSLSVPPGGNVTLTCDLSSGSVSTSYYPSWYQQTPGQAPRTLIYNTNSRLSEIPDRFSGSISGNKAALTITGAQPEDEADYYCNLYVGTDT
Rousettus aegyptiacus V823 iglv LOCP02001887.1 22928 SWAQSVLTQPSSVSGAPGQSVTISCTGSSSNIGGGYYVQWYQQFPGSAPKLLIYGDNELESGVPDRFSGSKSGNSASLTIRGLQAEDEADYYCQTGDSSLDA
Rousettus aegyptiacus V824 iglv LOCP02001887.1 10581 SLSQPVLTQPPSLSASPGASARLSCTLSSDLSVGGKNIYWYQQKPGGPPRSFLYYYSDTDKKLGPGVPSRVSGSKDTSANTAYLLISGLQPEDEADYYCHVYES
Rousettus aegyptiacus V825 iglv LOCP02001887.1 7036 GTSQTVVTQEASLSTTPGGTVTLTCGSSAGAVTTSNYASWVQQNPYQVPRGLIGDTNNRVPGVPARFSGSLLGGKAALTITGAQPEDEADYYCVL
Rousettus aegyptiacus V827 ighv LOCP02001910.1 27209 VHTQVQLVQSGAEVRKPGASVKLSCKASGYTFTDYYMDWVRQAPGQGLEWMGGIDPENSKTSYAQKFQGRVTITADTSTSTAYMELSNLRPEDTATYYCAT
Rousettus aegyptiacus V828 ighv LOCP02001910.1 19305 VHTQVQLVQSGAEVRKPGASVKLSCKASGYSFTGYYMHWVRQAPGQGLEWMGRVYPNYGDTNYAQKFQGRVTITADKSTSTAYMELSSLRPEDTAVYYCAK
Rousettus aegyptiacus V829 ighv LOCP02001910.1 14165 VLSQVQLQESGPGQVKPSQTLSLTCTVSGGSVTSSNYWNWICQRPGKRLEWMGYWTGSTSYKPAFQGRISITADTSRNQFSLQLNSVTTEDTAVYYCAR
Rousettus aegyptiacus V830 ighv LOCP02001910.1 6764 VLSQVQLQESGPGQVKPSQTLSLTCTVSGFSLTSYGVHWTRQAAGKGLEWVGVIWSGGSTNYNPALKSRLSITRDTSKSQVFLTLNSLTSEDTAVYYCAR
Rousettus aegyptiacus V831 ighv LOCP02001910.1 2015 VHAQVQLVQSGAEVRKPGASVKVSCKASGYTFTSYGMNWVRQAPSQGLEWMGWINTYTGKPTYAQGFSGRFVFSLDTSASTAFLQINGLRSEDTATYYCAR
Rousettus aegyptiacus V832 iglv LOCP02001917.1 21327 ANSQTVVTQEPSLSVSPGGTVTLTCGLNSGSVSTGNYPHWHQQTPGRAPRRLIYNTNNRPSGIPGRFSGSISGNKAALTITGAQPEDEADYYCSLWLGSA
Rousettus aegyptiacus V833 iglv LOCP02001925.1 23135 GTSQAVVTQEASLSTTPGGTVTLTCGSSAGAVTTGNYPTWVQQKPYQVPQGLVSNTNSRVPGVPARFSGSLLGGKAALTITGAQPEDEADYYCFC
Rousettus aegyptiacus V834 iglv LOCP02001925.1 11046 ANSQTVVTQEPSLSVSPGGTVTLTCGLSSGSVSTSNNPGWHQQTPGQAPRALIYNTNSRPSGIPGRFSGSISGNKAALTITGAQPEDEADYYCSLYMGSY
Rousettus aegyptiacus V835 iglv LOCP02001925.1 6279 SWAQSVLTQPSSVSGAPGQSVTISCTGSSSNIGYGYLQWYQQLPGTAPKTLIYDTSRRASGVPDRFSGSRSGNSASLTIRGLQAEDEADYYCSAWDNSLNA
Rousettus aegyptiacus V836 iglv LOCP02001925.1 899 ADSQAVVIQEPSLSVPPGGNVTLTCDLSSGSVSTSYYPSWYQQTPGQAPRTLIYNTNSRLSEIPDRFSGSISGNKAALTITGAQPEDEADYYCNLYVGTDT
Rousettus aegyptiacus V837 iglv LOCP02001926.1 25033 ANSQTVVTQEPSLSVSPGGTVTLTCGLSSGSVSTSNNPGWHQQTPGQAPRTLIYNTNSRPSGIPGRFSGSISGNKAALTITGAQPEDEADYYCSLYMGNGI
Rousettus aegyptiacus V838 iglv LOCP02001926.1 20059 SWAQSVLTQPSSVSGAPGQSVTISCTGSSSDIGGGYGVQWYQQLPGTAPKLLIYYDNELESGVPDRFSGSKSGNTASLTISGLQAEDEADYYCQTYDDSLDA
Rousettus aegyptiacus V839 iglv LOCP02001926.1 15039 SLSQPVLTQAPLASASPGSPAKLTCTLRSEHSTYIIEWYQQHPGKAPRYLMQLKSDGSHSKGDGIPDRFSGSSSGADRYLSIANVQSEDEADYICGVGYSGRY
Rousettus aegyptiacus V840 iglv LOCP02001928.1 53632 CGDPGAITVVSPGGTVTLTCGLSSGSVSTSNYPGWYQQTPGRAPRTLIYNTNNRPSGIPGRFSGSISGNKAALTITGAQPEDEADYYCSLGSIL
Rousettus aegyptiacus V841 iglv LOCP02001928.1 43485 SWAQSVLTQPSSVSGAPGQSVTISCTGSSSNIGSTFVNWYQQLPGTAPKLLIYVNSNRASGVPDRFSGSKSGNSASLTIRGLQAEDEADYYCSAWYSSLN
Rousettus aegyptiacus V842 iglv LOCP02001928.1 32588 ANSQTVVTQEPSLSVSPGGTVTLTCGLSSGSVSTSNYPCWYQQTPGQAPRTVIYNTNSRPSGIPGRFSGSILGNKAALTITGAQPEDEADYYCNLYMGSNI
Rousettus aegyptiacus V843 ighv LOCP02002043.1 19769 VHAQVQLVQSGAEVRKPGASVKVSCKASGYTFTSYYVYWVRQAPGQGLECMGWVYPNSGSTNYAQNFKDRVTMTTEKSISTAFMELSSLRPEDTATYYCAL
Rousettus aegyptiacus V844 ighv LOCP02002043.1 3884 VLSQVQLQESGPGQVKPSQTLSLTCTVSGFSLTSYGVQWSRQAAGKGLEWVGVIWSGGGTNYNPALKSRLSITRDTSKSQVFLTLNSVTSEDTAMYYCAR
Rousettus aegyptiacus V845 iglv LOCP02002115.1 5404 ADSQTVVIQEPSLSVSPGGTVTLTCGLSSGSVSTSNYPGWYQQTPGRAPRMLIYNTNNRPSGIPGRFSGSISGNKAALTITGAQPEDEADYYCSLGGSIL
Rousettus aegyptiacus V846 ighv LOCP02002388.1 4220 VLSQVQLQESGPGQVKPSQTLSLTCTVSGFSLTSYGGQWSRQAAGKGLESVGGIWSGGGTYYNPALKSRLSITRDTSKSQVLTLNSVTSEDAAVYYCAS
Rousettus aegyptiacus V847 ighv LOCP02002410.1 4082 AAGAVWGRGEEAWGLREVSCKASGYSFTGSYMHWVRQAPGQGLEWMGLVIPVFGSTNYAQKFKGRVTITPPTPVHQQAYMELSSLRPEDTAVYYCAE
Rousettus aegyptiacus V848 iglv LOCP02002423.1 5602 SWAQSVLTQPSSVSGAPGQSVTISCTGSSSNIGHSTYGYYVQWFQQLPGLAPKTLIYDTSSRVSGVPDRFSGSRSGNSASLTISGLQAEDEADYYCSAWDNSLS
Rousettus aegyptiacus V849 ighv LOCP02002467.1 3831 VQCEVQLVESGGGVVRPGGSLRLSCVASGFNFGSYAMSWVRQAPGKGLEWVSSISSSGSSTYYADSVKGRFTISRDNAKNTLYLQLGSLKAEDTAVYYCAK