WGS Statistics
Organism WGS Record. Vs Total IGHV IGLV IGKV TRAV TRBV TRGV TRDV
Gorilla gorilla gorilla CYUI000000000.3 (CYUI03) 205 47 28 27 41 50 8 4
Gorilla gorilla gorilla CYUI000000000.2 (CYUI02) 187 42 26 24 37 46 8 4
Gorilla gorilla gorilla CABD000000000.3 (CABD03) 207 47 25 30 43 52 6 4
Vgene Table
Organism Vgene Locus contig Contig Pos. AA sequence
Gorilla gorilla gorilla V34 trav CYUI03000010.1 20792355 MMTGTIETMGNISAEKGGSIILQCHLSSTTAQVTQVNWQQQDQLLAVCNADLGWHISPSFKDRVAPGPGLGLTLQSLTTNDTGEYFCIYHTYPDGT
Gorilla gorilla gorilla V267 trbv CYUI03000152.1 3662905 SVFSAVISQKPSRDICQRGTSMTIQCQVNSQVTMMFWYCQQPGQSVTLIATANQGSEATYESRFVIDKFPISCPNLTFSTLTVSNRSPEDSSIYLCSVE
Gorilla gorilla gorilla V317 trbv CYUI03000263.1 4805626 VRSQTIHQWPATLVQPVGSPLSLECTVEGTSNPNLYWYRQAAGRGLQLLFYSAGIGQISSEVPQNLSASRPQDRQFILSSKKLLLSDSGFYLCAWS
Gorilla gorilla gorilla V318 trdv CYUI03000265.1 4815147 RGMLCDKVTQSSPDQTVASGSEVVLLCTYDTVYSNPDLFWYRIRPDYSFQFVFYGDNSGSQAADFTQGRFSVKHILTQKAFHLVISPVRTEDSATYYCAF
Gorilla gorilla gorilla V440 igkv CYUI03000583.1 22668 CNGDIVLTQSPASLAMSPGQRATITCRASECVSFLGINLIHWYQQKPGQPPKLLIYQASNKDIGVPARFSGSGSGTDFTLTINPVEANNTAKYYCLQSKNFP
Gorilla gorilla gorilla V448 trbv CYUI03000631.1 231334 LTEPEVTQTPSHQVTQMGQEVILRCVPISNHLYFYWYRQILGQKVEFLVSFYNNKISEKAEIFDDQFSVERPDGSNFTLKIRSTKLEDSAMYFCASSE
Gorilla gorilla gorilla V449 trbv CYUI03000631.1 238950 PLDTAVSQTPKYLVTQMGNDKSLKCEQNLGHDTMYWYKQDSKKFLKIMFSYNNKELIINETVPNRFSPKSPDKAHLDLHIKSLELGDSAVYFCASS
Gorilla gorilla gorilla V450 trbv CYUI03000631.1 243570 PIDTEVTQTPKHLVMGMTNKKSLKCEQHMGHRAMYWYKQKAKKPPELMFVYSYEKLSVNESVPSRFSPECPNNSLLNLHLHALQPEDSALYLCASSQ
Gorilla gorilla gorilla V451 trbv CYUI03000631.1 251416 PVEAGVTQTPRYLIKTRGQQVTLSCSPISGHRSVSWYQQTLGQGLQFLFEYFGETQRNKGNFPGRFSGRQFSNSRSEMNVSTLELGDSALYLCASSL
Gorilla gorilla gorilla V452 trbv CYUI03000631.1 258663 PVNAGVAQTPKFQVLKTGQSMTLQCAQDMNHNSMYWYRQDPGMGLRLIYYSAAEGTTAKGEVPDGYNVSRLNKREFSLRLESAAPSQTSVYFCASSE
Gorilla gorilla gorilla V453 trbv CYUI03000631.1 275841 PMEMGVTQTPRHLVMGMTNKKSLKCEQHLGHNAMYWYKQSAKKPLELMFVYSLEERVENNSVPSRFSPECPNSSHLFLHLHALQPEDSALYLCASSQ
Gorilla gorilla gorilla V454 trbv CYUI03000631.1 281027 PVDAGVTQTPKFQVLKTGQSMTLQCAQDMNHNYMYWYRQDPGMGLRLIHYSAGEGTTAKGEVPDGYNVSRLNTQNFLLRLELAAPSQTSVYFCATSE
Gorilla gorilla gorilla V455 trbv CYUI03000631.1 312053 PLDTAVSQTPKYLVTQMGKKESLKCEQNLGHNAMYWYKQDSKKFLKTMFIYSNKEPILNETVPNCFSPDSPDKAHLNLHINSLELGDSAVYFCASSQ
Gorilla gorilla gorilla V456 trbv CYUI03000631.1 315500 PMETGVTQTPRHLVMGMTNKKSLKCEQHLGHNAMYWYKQSAKKPLELMFVYSFKEQTENNSVPSRFSPECPNSSHLFLHLHALQPEDSALYLCASSQ
Gorilla gorilla gorilla V457 trbv CYUI03000631.1 323803 PVNAGVTQTPKFHVLKTGQSMTLLCAQDMNHEYMYWYRQDPGMGLRLIHYSVGEGTTAKGEVPDGYNVSRLKKQNFLLGLESAAPSQTSVYFCASSY
Gorilla gorilla gorilla V458 trbv CYUI03000631.1 327490 HTRAGVSQSPSNKVTEKGKDVVFRCDPISGHSVLYWYQQSLGQGLEFLIYFQGNSAPDKSGLPSDRFSAERTGGSVSTLTIQRTQQEDSAMYLCASSL
Gorilla gorilla gorilla V459 trbv CYUI03000631.1 355352 PMIAGITQAPTSQILAAGRSMTLRCTQDMRHNAMYWYRQDLGLGLRLIHYSNTAGTTGKGEVPDGYSVSRANTDDFPLMLASAVPSQTSVYFCASSD
Gorilla gorilla gorilla V460 trbv CYUI03000631.1 359402 HTGAGVSQTPSNKVTEKGKDVELRCDPISGHTALYWYRQSLGQGPEFLIYFQGTGATDDSGLPNDRFFAVRPEGSVSTLKIQRTEQGDSAVYLCASSL
Gorilla gorilla gorilla V461 trbv CYUI03000631.1 364299 PVEAGATQSPTHLLKTRGQQVTLRCSPISGHSSVSWYQKAPGQGPQFIFEYANELRRLEGNFPNRFSGRQFHDYRSEMNVSALELGDSALYLCARSL
Gorilla gorilla gorilla V462 trbv CYUI03000631.1 367031 PVDSGVTQTPKHLITATGQRVTLRCSPRSGDLSVYWYQQSLDQGLQFLIQYYNGEERAKGNILERFSAQQFPDSHSELNLSSLELGDSALYLCASSV
Gorilla gorilla gorilla V463 trbv CYUI03000631.1 375073 MLKKITQSPRHKITETGRQVTLACYQTWNHNNMFWYRQDLGHGLRLSHYSYGVQDTNKGEVSDGCSVSRSNTEDFPLTLESAASSQTSVYFCASSE
Gorilla gorilla gorilla V464 trbv CYUI03000631.1 382807 FSEAEVAQSPRYKITEKSQAVAFWCDPISGHATLYWYRQILGQGPELLVRFQDESVVDDSQLPKDRFSAERLKGVDSTLKIQLAKLEDSAVYLCASSL
Gorilla gorilla gorilla V465 trbv CYUI03000631.1 399818 PVNAGVTQTPKFQVLKTGQSMTLQCAQDMNHDYMYWYRQDPGMGLRLIHYSVGAGITDKGEVPNGYNVSRSNTEDFPLRLQSAAPSQTSVYFCASSY
Gorilla gorilla gorilla V466 trbv CYUI03000631.1 404009 HTGAGVSQSPRYKVAKRGRDVALRCDSISGHVTLYWYRQTLGQGSEVLTYFRSDAQRDKSGRPSGRFSAERPERSVSTLKIQRTEQGDSAVYLCASSL
Gorilla gorilla gorilla V467 trbv CYUI03000631.1 411944 SVETGVTQSPTHLIKTRGQQVTLRCSPQSGHNTVSWYQQALGQGPQLIFQYYREEENGRGNFSPRFSGRQFPNYSSELNVNTLELDDSALYLCASSL
Gorilla gorilla gorilla V468 trbv CYUI03000631.1 418380 PVNAGVTQTPKFRILKIGQSMTLQCAQDMNHNYMSWYQQDPGMGLKLIYYSVTAGITDKGEVPNGYNVSRSTTEDFPLRLESAARSQTSVYFCASSY
Gorilla gorilla gorilla V469 trbv CYUI03000631.1 431348 PVDAGVTQSPTHLIKTRGQQVTLRCSPQSGHNTVSWYQQALGQGPQFIFQYYEKEERGRGNFPDRFSARQFPNYSSELNVNALLLGDSALYLCASSL
Gorilla gorilla gorilla V470 trbv CYUI03000631.1 448820 LVDAGVTQSPTHLIKTRGQQVTLRCSPKSGHDTVSWYQQALGQGPQFIFQYYEEEERQRGNFPDRFSGHQFPNYSSELNVNALLLGDSALYLCASSL
Gorilla gorilla gorilla V471 trbv CYUI03000631.1 456109 PANAGVTQTPKFHILKTGQSMTLQCAQDMNHGYMSWYRQDPGMGLRLIYYSAAAGTIDKGEVPNGYNVSRLNTEDFLLRPVSAAPSQTSVYFCASSY
Gorilla gorilla gorilla V472 trbv CYUI03000631.1 469179 PVDAGVTQSPTHLIKMRGQHVTLRCSPISGHTSVSWYQQALGQGPQFIFEYYEKEERGRGNFPDRFSARQFPNYSSELNVNPLLMGDSALYLCASSL
Gorilla gorilla gorilla V473 trbv CYUI03000631.1 478443 HADTGVSQDPRHKITKRGQNVTFRCDPISEHNQLYWYRQTLGQGAEFLTYFQNEAQLEKSRLLSDRFSAERPKGSFSTLEIQRTEQGDSAMYLCASSL
Gorilla gorilla gorilla V474 trbv CYUI03000631.1 484990 SVAAGVIQSPRHLIKEKRETATLKCYPIPRHDTVYWYQQGPGQDPQFLISFYEKMQSDKGSIPDRFSAQQFSDYHSELNMSSLELGDSALYFCASSL
Gorilla gorilla gorilla V475 trbv CYUI03000631.1 494113 HMDAGITQSPRHKVTEIGTPVTLRCHQTENHRYMYWYRQDPGHGLRLIHYSYGVKDTDKGEVSDGYSVSRSKTEDFLLTLESATSSQTSVYFCAISE
Gorilla gorilla gorilla V476 trbv CYUI03000631.1 504792 LIEAGVVQSPRYKIIEKKQPVAFWCNPISGHNTLYWYRQNLGQGPELLIRYENEEAVDDSQLPKDRFSAERLKGVDSTLKIQPAELGDSAVYLCASSL
Gorilla gorilla gorilla V477 trbv CYUI03000631.1 510409 HTDAGVIQSPRHEVTEMGQEVTLRCKPISGHNSLFWYRQTMMRGLELLIYFNNNVPIDDSGMPKDRFSAKMPNASFSTLKIQPSEPRDSAVYFCASSL
Gorilla gorilla gorilla V478 trbv CYUI03000631.1 513721 HTDAGVIQSPRHEVTEMGQEVTLRCKPISGHEYLFWYRQTMMRGLELLIYFNNNVPIDDSAMPKDRFSAKMPNASFSTLKIQPSEPRDSAVYFCASSL
Gorilla gorilla gorilla V479 trbv CYUI03000631.1 531102 LTDAGVTQTPRHKVTEMGQEVTMRCQPILGHNTVFWYRQTMMQGLELLAYFRNRAPLDDSGMPKDRFSAEIPDATLATLKIQPSGPRDSAVYFCASGL
Gorilla gorilla gorilla V480 trbv CYUI03000631.1 538017 HIEAGVTQFPSHSVIEKGQTVTLRCDPISGHDNLYWYRRVMGKEIKFLLHFVKESKQDESGMPNNRFLAERTGGTYSTLKVQPAELEDSGVYFCASSQ
Gorilla gorilla gorilla V481 trbv CYUI03000631.1 543143 HGDAMVIQNPRYQVTQFGKPVTLSCSQNLNHNIMYWYQQKSSQAPKLLFHYYDKDFNNEADTPDNFQSRRPNTSFCFLDISSPGLGDAAMYLCATSR
Gorilla gorilla gorilla V482 trbv CYUI03000631.1 548138 SPGEEVTQTPKHLVRGEGQKAKLYCAPIKGHSYVFWYQQVLKKEFKFLISFQNENVFDETGMPKERFSAKCLPNSPCSLEIQATKLEDSAVYFCASSQ
Gorilla gorilla gorilla V483 trbv CYUI03000631.1 566013 LSNAGVMQNPRHLVRRRGQEARLRCSPMKGHSHVYWYRQLPEEGLKFMVYLQKENIIDESGMPKERFSAEFPKEGPSILRIQQAVRGDSAAYFCAS
Gorilla gorilla gorilla V484 trbv CYUI03000631.1 569142 TVDGGITQSPKYLFRKEGQNVTLNCEQNLNHDAMYWYRQDPGQGLRLIYYSQIVNDFQKGDIAEGYSVSREKKESFPLTVTSAQKNPTAFYLCASSI
Gorilla gorilla gorilla V485 trbv CYUI03000631.1 577001 GSGLGAVVSQHPSRVICKSGTSVKIECRCLDFQATTMFWYRQFPKQSLMLMATSNEGSKATYEQGVEKDKFLINHPNLTLSTLTVTSAHPEDSSFYICSAR
Gorilla gorilla gorilla V486 trbv CYUI03000631.1 586976 STDTKVTQRPRLLVKASEQKAKMDCVPIKGHSYVYWYRKKLEEELKFLVYFQNEEIIQKAEIINERFLAQCSKNSSCTLEIQSTESGDTALYFCASSK
Gorilla gorilla gorilla V487 trbv CYUI03000631.1 596038 SFHAKVTQTPGHLVKGKGQKTKMDCTPEKGHTFVYWYQQNQNKEFMLLISFQNEQVLQETEMHKKRFSSQCPSNTPCSLAILSSEPGDTALYLCASSQ
Gorilla gorilla gorilla V488 trbv CYUI03000631.1 606789 SMDADVTQTPRNRITKTGKRIMLECSQTKGHDRMYWYRQDPGLGLRLIYYSFDVKDINKGEISDGYSVSRQAQAKFSLSLESATPNQTALYFCATSD
Gorilla gorilla gorilla V489 trbv CYUI03000631.1 620826 LMEADIYQTPRYLVIGTGKKITLECSQTMGHDKMYWYQQDPGMELHLIHYSYGVNSTEKGGLSSESTVSRIRTEHFPLTLESARPSHTSQYLCASSE
Gorilla gorilla gorilla V490 trbv CYUI03000631.1 665390 PLEAQVTQNPRYLITVTGKKLTVTCSQNMNHEYMSWYRQDPGLGLRQIYYSINVEAIDKGDVPEGYNVSRKEKRNFPLILESPSPNQTSLYFCASSL
Gorilla gorilla gorilla V491 trbv CYUI03000631.1 670692 LVDVKVTQSSRYLVKRMGEKVFLECVQDMDHENMFWYRQDPGLGLRLIYFSSDVKMKEKGDIPEGYSVSREKKERFSLILESTSTNQTSMYLCASSL
Gorilla gorilla gorilla V492 iglv CYUI03000634.1 469563 SLSQLVLTQSPSASASLGASVKLTCTLSSGHSSYAITWHQQQPEKGPRYLMKLNSDGSHSKGDGIPDRFSGSSSGAERYLTISSLQSEDEADYYCQTW
Gorilla gorilla gorilla V493 iglv CYUI03000634.1 500742 VDSQTVVTQEPSFSVSPGGTVTLTCGLSSGSVSTSYYPSWYQQTPGQAPRMLIYSTNTRSSGVPDRFFGSIIGNKASLTITGAQADDESDYYCVLYMGSGI
Gorilla gorilla gorilla V494 iglv CYUI03000634.1 566886 SLSQPVLTQSSSASASLGSSVKLTCTLSSGHSSYIIAWQQQQPGKAPRYLMRLEGSGSYNKGNGIPDRFSGSSSGADRYLTISNLQSEDEADYYCQTWDS
Gorilla gorilla gorilla V495 iglv CYUI03000634.1 600465 SWANFMLTQPHSVSESPGQTVTISCTRSSGSIASNYVQWYQQRPGSAPTTVIYEDNQRPSGVPDRFSGSIDSSSNSASLTISGLKTEDEADYYCQSYDSS
Gorilla gorilla gorilla V496 iglv CYUI03000634.1 619365 SMVQAGLTQPPSVSKGLRQTATLTCTGNSNNVGNQGAAWLQQHQGHPPKLLSYRNNNRPSGISERFSASRSGNTASLTIIGLQPEDEPDYYCSAWDSSLS
Gorilla gorilla gorilla V504 ighv CYUI03000718.1 17574 VLSQVTLKESGPVLVKPTETLTLTCTVSGFSLSNARMGVSWIRQPPGKALEWLAHIFSNDEKSYSTSLKSRLTISKDTSKSQVVLTMTNMDPVDTATYYCAWI
Gorilla gorilla gorilla V505 ighv CYUI03000718.1 49680 VQCEVQLVESGGGLVQPGGSLRLSCVASGFTFSSYAMSWVRQAPGKGLEWVSTISSTGGSTWYPGSVKGRFTISRDNSKNTLYLQMNSLRAEDTAVYYCAK
Gorilla gorilla gorilla V506 ighv CYUI03000718.1 60615 AQCEVQLVESGGGLVKPGGSLRLSCAASGFTFSNYYMEWVRQAPGKGLEWVGFIRTKAKGGTTEYAASVKGRFTISRDDSKSIAYLQMNSLKTEDTAVYYCTR
Gorilla gorilla gorilla V507 ighv CYUI03000718.1 83432 VQCDVQLVESGGGLVQPGGSLRLSCAASGFTFSSYWMSWVRQAPGKGLEWVSYISSSSSYIYYADSVKGRFTISRDNAKNSLYLQMNSLRAEDTAVYYCAK
Gorilla gorilla gorilla V508 ighv CYUI03000718.1 200965 VQCEVQLVESGGGLVKPGGSLRLSCVASGFTFSSYSMNWVRQAPGKGLEWVSYISSSSSTIYYADSVKGRFTISRDNAKNSLYLQMNSLKTEDTAVYYCAR
Gorilla gorilla gorilla V509 ighv CYUI03000718.1 219631 VQCEVQLVESGGGLVQPGRSLRLSCVASGFTFDDYAMHWVRQAPGKGLEWVSGISWNSGSTGYADSVKGRFTISRDNAKNSLYLQMNSLRAEDTALYYCAKD
Gorilla gorilla gorilla V510 ighv CYUI03000718.1 265955 VLSQITLKESGPTLVKPTQTLTLTCTFSGFSLSTSGTSVSWIRQPPGKALEWLAAIYSDDDKRYSPSLKSRLTITKDTSKNQVVLTMTNMDPVDTATYYCAHR
Gorilla gorilla gorilla V511 ighv CYUI03000718.1 305792 AHSQVQLVQSGSEVKKPGASVKVSCKASGYTFTSYGMNWVRQAPGQGLEWMGWINTNTGNPTYAQGFTGRFVFSLDTSVSTAYLQISSLKAEDTAVYYCAR
Gorilla gorilla gorilla V512 ighv CYUI03000718.1 318660 VLSQVQLQESGPGLVKPSETLSLICAVSGGSISSSNWWIWVRQSPGKGLEWIGYIYYSGSTYYNPSLKSRVTMSVDTSKNQFSLKLSSVTAADTAVYYCAR
Gorilla gorilla gorilla V513 ighv CYUI03000718.1 325501 AHSQVQLVQSGAEVKKPGASLKVSCKASGYTFTGYAMHWVRQAPGQRLEWMGWINTGNGNTKYSQKFQGRVTITRDTSASTAYMELSSLRSEDTAVYYCAR
Gorilla gorilla gorilla V514 ighv CYUI03000718.1 343020 AHSQVQLVQSGAEVKKPGASVKVSCKASGYTFTGYYMHWVRQAPGQGLEWMGWINPNSGGTNYAQKFQGRVTMTRDTSISTAYMELSRLRSEDTATYYCTR
Gorilla gorilla gorilla V515 ighv CYUI03000718.1 388239 VLSQVQLQQSGPGLVKPSQTLSLTCAISGDSVSSSSAAWNWIRQSPSRGLEWLGRTYYRSKWYNDYAVSVQSRITINPDTSKNQFSLQLNSVTPEDTAVYYCAR
Gorilla gorilla gorilla V519 igkv CYUI03000755.1 54333 SSGDIVMTQTPLSLPVTLGQPASISCRSSQSLVHSDGNTYLNWIQQRPGQPPRLLIYKVSNRFSGVPDRFSGSGAGTDFTLKISRVEAEDVAVYYCTQG
Gorilla gorilla gorilla V520 igkv CYUI03000755.1 70839 SRGEIVLTQSPDFQSVTPKEKVTITCRASQSIGSSLHWYQQKPDQSPKLLIKYASQSISGVPSRFSGSGSGTDFTLTINSLEAEDAATYYCQQSSSL
Gorilla gorilla gorilla V521 igkv CYUI03000755.1 89377 TTGEIVLTQSPATLSSSPGERATLSCRASQSVSSSYLAWYQQKPGQAPRLLIYDASSRATGIPDRFSGSGSGTDFTLTISRLEPEDFAVYYCQQYSNWP
Gorilla gorilla gorilla V522 igkv CYUI03000755.1 103227 SSGDIVMTQTPLSLPVNPGQLASISCRSSQSLLHSNGYTYLHWYLQKPGKSPQLLIYRVSSHFSGVPDRFSGSGSGSDFTLKISWVEAEDVGVYYCMQA
Gorilla gorilla gorilla V523 igkv CYUI03000755.1 120527 SRGDVVMTQSPAFLSVTPGEKVTITCQASEGIGNYLYWYQQKPDQAPKLLIKYASQSISGVPSRFSGSGSGTDFTFAISSLEAEDAATYYCQQGN
Gorilla gorilla gorilla V524 igkv CYUI03000755.1 132375 ARCDIQMTQSPSSLSASVGDRVTITCRASQGISKWLAWYQQKPGKAPKRLIYAASSLESGVPSRFSGSGSGTEFTLTISSLQPEDFATYYCLQYNSYP
Gorilla gorilla gorilla V525 igkv CYUI03000755.1 147036 TTGEIVMTQSPATLSVSPGERATLSCRASQSVSSYLAWYQQKPGQAPRLLIYGASNRATGIPARFSGSGSGTDFTLTISSLEPEDFAVYYCQQYNNWS
Gorilla gorilla gorilla V526 igkv CYUI03000755.1 186465 ARCDIQMTQSPSSVSASVGDRVTITCRASQGISNSLNWYQQKPGKAPKLLIYDASSLQSGVPSRFSGSGSGTDFTLTISSLQPEDFATYYCQQFNSYP
Gorilla gorilla gorilla V527 igkv CYUI03000755.1 192245 ARCDIQMTQSPSSVSASVGDRVTITCRASQGISNYLAWFQQKPGKAPKRLIYAASSLQSGVPSRFSGSGSGTDFTLTISSLQPEDFATYYCLQGYDYP
Gorilla gorilla gorilla V528 igkv CYUI03000755.1 205268 TTGEIVMTQSPATLSLSPGERATLSCRASQSVSSYLAWYQQKPGQAPRLLIYDASNRATGIPARFSGSGSGTDFTLTISSLEPEDFAVYYCQQRSNW
Gorilla gorilla gorilla V529 igkv CYUI03000755.1 242338 ARCDIQMTQSPSSLSASVGDRVTITCRASQGISSYLAWYQQKPGKAPKLLIYYASSLQSGVPSRFSGSGSGTDYTLTISSLQPEDFATYYCQQYNSTP
Gorilla gorilla gorilla V530 igkv CYUI03000755.1 259931 ARCAIRMTQSPSSLSASTGDRVTITCRASQGISSYLAWYQQKPGKAPKLLIYAASTLQSGVPSRFSGSGSGTEFTLTISCLQSEDFATYYCQQYYSYP
Gorilla gorilla gorilla V531 igkv CYUI03000755.1 273849 TTGEIVMTQSPATLSLSPGERATLSCRASQSVSSYLTWYQQKPGQAPRLLIYGASTRATGIPARFSGSGSGTDFTLTISSLQPEDFAVYYCQQHSNWP
Gorilla gorilla gorilla V532 igkv CYUI03000755.1 286289 ARCDIRMTQSPSSLSASVGDRVTITCRASQGIRNDLGWYQQKPGKAPKILIYAASSLQSGVPSRFSGSGSGTDFTLTISSLQPEDFATYYCLQDYNYP
Gorilla gorilla gorilla V542 ighv CYUI03000988.1 102694 VLSQVTLKESGPVLVKPTETLTLTCTLSGFSLSTSGMGMSWIRQPPGKALEWLAHIFSNDKKSYSTSLKNRLIISKGTSKSQVVLTMTNMDPVDTATYYCAWR
Gorilla gorilla gorilla V548 ighv CYUI03001531.1 23795 AQSQVQLVQSGAEVKKPWASVKVACKASGYTFTSYCMHWVRQAHAQGLEWMGLVCPSDGSTSYAQKFQGRVTITRDTSMSTAYMELSSLRSEDTAMYYCVR
Gorilla gorilla gorilla V549 ighv CYUI03001567.1 27261 AHAEGQLVQSGAEVKKPGATVKISCKASGYTFTDYYMHWVQQAPGKGLEWMGRVDPEDGKTIYAEKFQGRVTITADTSTDTAYMELSSLRSEDTAVYYCAT
Gorilla gorilla gorilla V553 igkv CYUI03004804.1 19201 TTGEIVMTQSPATLSLSPGERATLSCRASQSVSSYLTWYQQKPGQAPRLLIYGASTRATGIPARFSGSGSGTDFTLTISSLQPEDFAVYYCQQHSNWP
Gorilla gorilla gorilla V559 ighv CYUI03006539.1 18879 AHAEVQLVQSGAEVKKPGATVKISCKASGYTFTDYYMHWVQQAPGKGLEWMGRVDPEDGKTIYAEKFQGRVTITADTSTDTAYMELSSLRSEDTAVYYCAT
Gorilla gorilla gorilla V884 trbv CYUI03000263.1 4908696 SVFSAVISQKPSRDICQRGTSLTIQCQVDSQVTMMFWYRQQPGQSLTLIATANQGSEATYESGFIIDKFPISRPNLTFSTLTVSNMSPEDSSIYLCSVE
Gorilla gorilla gorilla V886 trdv CYUI03000265.1 4862062 VMSAIELVPEHQTVTVSMGVPATLRCSMKGEAIGNYYINWYRKTQGNTMTFIYREKDIYGPGFKDNFQGDIDIAKNLAVLKILAPSERDEGSYYCAC
Gorilla gorilla gorilla V895 trav CYUI03000282.1 1457254 TSDEEFQVNQPQTLVSVNPGDVLTLACNMSALSPEGPVLWFKSTGPGQQLIYSFNGSHFPRVTPVENTMVDQTDYSIRISDVLPEDAGTYYCVKLRV
Gorilla gorilla gorilla V909 trgv CYUI03000319.1 2445961 SQKSSNLEGRTKSVIRQTGSSAEITCDLDGGSTGYIHWYLHQEGKAPQRLQYYDSYNSKVVLESGVSPGKYYTYTSTRKNLRLILRNLIENDSGVYYCATWD
Gorilla gorilla gorilla V910 trgv CYUI03000319.1 2441617 SQKSSNLEGRTKSVTRQTGSSAEITCDLTVTNTFYIHWYLHQEGKAPQRLLYYDVSTARDVLESGLSSGKYYTHTPRRWSWILRLQNLIENDSGVYYCATWD
Gorilla gorilla gorilla V911 trgv CYUI03000319.1 2436839 SQKSSNLEGRTKSVIRQTGSSAEITCDLAEGSTGYIHWYLHQEGKAPQRLLYYDSYTSRVVSESGISPGKYDTYGSTRKNLRLILRNLIENDSGVYYCATWD
Gorilla gorilla gorilla V912 trgv CYUI03000319.1 2427744 SQKSSNLEGRTKSVTRQTGSSAEITCDLTVTNAFYIHWYLPQEGKAPQRLLYYDVSTARDVLESGLSSGKYYTHTPRRWSWILRLQNLIENDSGVYYCATWD
Gorilla gorilla gorilla V913 trgv CYUI03000319.1 2413051 SQKSSNLEGRTKSVTRPPGSSAVITCDLPVENAAYIHWYLHQEGKAPQRLLYYDSYNSRVVLESGISREKYHTYASTGKSLKFILENLIEHDSGVYYCATWD
Gorilla gorilla gorilla V914 trgv CYUI03000319.1 2398888 HLEQPQISSTKTLSKTARLECVVSGVTISATSVYWYRERPGEVIQFLVSISHDGTVRKESGIPSGKFEVDRIPEMSTSTLTIHNVEKQDIATYYCALWE
Gorilla gorilla gorilla V915 trgv CYUI03000319.1 2365037 TSGENLITQLVTSVTKKKGNTAFFECQIKSSTFKKNVCIHWYHQKPDRSLKRILYISSNENVVHEQGVSEERYEARKWQSDLSSSLRIHRVAEEDAGIYYCACW
Gorilla gorilla gorilla V916 trgv CYUI03000319.1 2363038 GDTKMRVSQDQLSSTRRQDRTVHKRCKLSGVPLENTVVHWYQQQEGEPLRRILYGSAKNYKQDRPNPRLEADDKHDGIFYLIINNVAKSDEATYYCACWDLIM
Gorilla gorilla gorilla V987 ighv CYUI03000529.1 1277421 AQCEVQLVESGGGLVQPGGSLRLSCAASGFTFSNHYTSWVLQAPGKGLEWVSYISGDSDYTNYADSVKGRFTISRDNAKNSLYLQMNSLRAEDTAVYYCV
Gorilla gorilla gorilla V989 trav CYUI03000532.1 752934 TAGQSLEQPSEVTAVEGATVQINCTYQTSGFYGLSWYQQHDGGAPTFLSYNALDGLEETGHFSSFLSRSDSYGYLLLQELQMKDSASYFCAVR
Gorilla gorilla gorilla V990 trav CYUI03000532.1 731883 MYLVLGTTGQNTDQPTEMTATEGAIVQINCTYQTFGFNGLFWYQQHAGKAPTFLSYNVLDGLEEKGRFSSFLSRSKVYSYLLLKELQMKDAASYLCAVR
Gorilla gorilla gorilla V991 trav CYUI03000532.1 642554 GLRAQSVAQPEDQVTVAEGNPLTVKCTYSVSGNPYLFWYVQYPNQGLKFLLKYITGDNLVKGSYGFEAEFNKSQTSFHLKKPSALVSDSALYFCAVR
Gorilla gorilla gorilla V992 trav CYUI03000532.1 629956 TLSLAKTTQPISMDSYEGQEVNITCSHNNIATNDYITWYQQFPSQGPRFIIQGYKTNVTNEVASLFIPADRKSSTLSLPRVSLSDTAVYYCLVG
Gorilla gorilla gorilla V993 trav CYUI03000532.1 617245 MSRGEDVEQSLFLSVQEGDSSIIKCTYTDSSSTYLYWYKQEPGAGLQLLMYIFSNMDMKQDQRLTVLLNKKDKHLSLRIADTQTGDSAIYFCAES
Gorilla gorilla gorilla V994 trav CYUI03000532.1 597628 VKSQKIEQNSEALNIQEGKTATLTCNYTNYSPAYLQWYRQDPGRGPVFLLLIRENEKEKRKERLKVTFDTTLKQSLFHITASQPADSATYLCAL
Gorilla gorilla gorilla V995 trav CYUI03000532.1 583263 ANGENQVEHSPHFLGPRQGDIASMSCTYSVSRFNNLPWYRQNTGMGPKHLLSMYSAGYEKQKGRLNATLLKNGSSLYITAVQPEDLATYFCAVD
Gorilla gorilla gorilla V996 trav CYUI03000532.1 569043 DARAQSVSQHNHHVILSEAASLELRCNYSYGGTVNLFWYVQYPGQHLQLLLKYFSGDPLVKGIKGFEAEFIKSKFSFNLRKPSVQWSDTAEYFCAMN
Gorilla gorilla gorilla V997 trav CYUI03000532.1 554911 GINGDSVVQTEGQVLLSEGDSLIVNCSYETTQYPSLFWYVQYPGEGPQLLLKAMKANDKGRNKGFEATYHKETTSFHLEKDSVQESDSAVYFCALS
Gorilla gorilla gorilla V998 trav CYUI03000532.1 541405 GSGKNQVEQSPQSLIILEGKNCTLRCNYTVSPFNNLRWYKQDTGRGPVSLTIMTFSENTKSNGRYTATLDADTKQSSLHITASQLSDSASYICVVS
Gorilla gorilla gorilla V999 trav CYUI03000532.1 525651 VWSQRKEEVEQDPGPFNVPEGATVAFNCTYSNSASQSFFWYRQDCRKEPKLLMSVYSSGNEDGRFTAQLNRASQYISLLIRDSQLSDSATYLCAV
Gorilla gorilla gorilla V1000 trav CYUI03000532.1 520207 GTRAQSVTQLDSHVSVSEGTPVLLRCNYSSSYSPSLFWYVQHPNKGLQLLLKYTSRATLVKGINGFEAEFKKSETSFHLTKPSAHMSDAAEYFCAVS
Gorilla gorilla gorilla V1001 trav CYUI03000532.1 514448 TARAQSVTQPDIHITVSEGASLELRCNYSYGATPYLFWYVQSPGQGLQLLLKYFSGDTLVQGIKGFEAEFKRSQSSFNLRKLSVHWSDAAEYFCAVG
Gorilla gorilla gorilla V1002 trav CYUI03000532.1 497765 VNGENVEQHPSTLSVQEGDSAVIKCTYSDSASNYFPWYKQELGKGPQLLIDIRSNVGEKKDQGITVTLNKTAKHFSLHITETQPEDSAVYFCAAS
Gorilla gorilla gorilla V1003 trav CYUI03000532.1 478435 VWSQQKEVEQNSGPLSVPEGAIASLNCTYSDRRSQSFFWYRQYSGKSPELIMSIYSNGDKEDGRFTAQLNKASQYVSLLIRDSQPSDSATYLCAV
Gorilla gorilla gorilla V1004 trav CYUI03000532.1 465306 LKFLSFVLCPFISQASQNLGKIEKNLCDYRGRFPDTATPSLFWHVQSPGQGLQLLLKYFSGDTLVQGIEGFEAEFKRSQSSFNLRRPSVHWSDAAEYFCAVG
Gorilla gorilla gorilla V1005 trav CYUI03000532.1 451133 VSRGESEGLHLPTLSVQEGDNSIINCAYSNSASDYFIWYKQESGKGPQFIIDIRSNMDKRQGQRVTVLLNKTVKHLSLQIAATQPGDSAVYFCAEN
Gorilla gorilla gorilla V1006 trav CYUI03000532.1 445206 PGIAQKITQTQPGMFVQEKEAVTLDCTYDTSDQSYGLFWYKQPSSGEMIFLIYQGSYDQQNATEGRYSLNFQKARKSANLVISASQLGDSATYFCAMRE
Gorilla gorilla gorilla V1007 trav CYUI03000532.1 428388 RTRGDSVTQMEGPVTLSEEAFLTINCTYTATGYPSLFWYVQYPGEGLQLLLKATKADDKGSNKGFEATYRKETTSFHLEKDSVQASDSAVYFCALS
Gorilla gorilla gorilla V1008 trav CYUI03000532.1 404026 VWSQQKEVEQDPGPLSVPEGAIASLNCTYSNSAFQYFMWYRQYSRKGPELLMYTYSSGNKEDGRFTVQVDKSSKYISLFIRDSQPSDSATYLCAMS
Gorilla gorilla gorilla V1009 trav CYUI03000532.1 391047 GTRAQSVTQLDSQVPVFEEAPVELRCNYSSSVSVYLFWYVQYPNQGLQLLLKYLSGSTLVKGINGFEAEFKNSETSFHLRKPSVHISDVAEYFCAVS
Gorilla gorilla gorilla V1010 trav CYUI03000532.1 373197 GTRAQRVTQPEKLLSVFKGAPVELKCNYSYSGSPELFWYVQYPRQRLQLLLRHISRESIKGFTADLNKGETSFHLKKPFAQEEDSAMYYCALS
Gorilla gorilla gorilla V1011 trav CYUI03000532.1 365953 VNSQQGEEDPQALSIQEGENATMNCSYKTSINNLQWYRQNSGRGLVHLILIRSNEREKHSGRLRVTLDTSKKSSSLLITASRAADTASYFCATD
Gorilla gorilla gorilla V1012 trdv CYUI03000532.1 355890 SSMAQKVTQTQNEISVVEKEDVTLDCVYETRDTTYYLFWYKQPPSGELVFLVRQNSFDEQNEISGRYSWNFQKSTSSFNFTITASQVVDSAVYFCALSE
Gorilla gorilla gorilla V1013 trav CYUI03000532.1 323116 LSGEDQVTQSPEALRLQEGESSSLNCSYTVSGLRGLFWYRQDPGKGPEFLFTLYSAGEEKEKERLKATLTKKESFLHITAPKPEDSATYLCAVQ
Gorilla gorilla gorilla V1014 trav CYUI03000532.1 292900 VRGIQVEQSPPDLILQEGANSTLRCNFSDSVNNLQWFHQNPWGQLINLFYIPSGTKQNGRLSATTVATERYSLLYISSSQTTDSGVYFCAVEPQCSP
Gorilla gorilla gorilla V1015 trdv CYUI03000532.1 268551 SSVAQKVTQAQSSVSTSVRKAVTLNCLYETSQWSYYIFWYKQLPSKEMIFLIRQGSAEQNAKSGRYSVNFKKAAKSVALTISALQLEDSAKYFCALWE
Gorilla gorilla gorilla V1016 trav CYUI03000532.1 259251 VNSILNVGQSPQSLHVQEGDSTNFTCSFPSSNFYALHWYRWETAKSPEALFVMTLNGDEKKKGRISATLNTKEGYSYLYIKGSQPEDSATYLCAF
Gorilla gorilla gorilla V1017 trav CYUI03000532.1 251834 VNGQQVMQIPQYQHVQEGEDFTTYCNSSTTLSNIQWYKQRPGGHPVFLIQLVKNGEVKKQKRLTFQFGEAKKNSSLHITATQTTDVGTYFCA
Gorilla gorilla gorilla V1018 trav CYUI03000532.1 241453 TIIDAKTTQPTSMDCAEGRAANLPCNHSTISGNEYVYWYRQIHSQGPQYIIHGLKNNETNEMASLIITEDRKSSTLILPHATLRDTAVYYCIVRV
Gorilla gorilla gorilla V1019 trav CYUI03000532.1 232793 GTRAQSVTQLDGHITVSEEAPLELKCNYSYSGVPSLFWYVQYSSQSLQLLLKDLTEATQVKGIKGFEAEFKKSETSFYLRKPSTHVSDAAEYFCAVG
Gorilla gorilla gorilla V1020 trav CYUI03000532.1 217156 VSTQLLEQSPRFLSIQEGENLTVYCNSSSVFSSLQWYRQEPGEGPVLLVTVVTGGEVKKLKRLTFQFGDARKDSSLHITAAQPGDTGLYLCAG
Gorilla gorilla gorilla V1021 trav CYUI03000532.1 197101 VRSQQPVQSPQAVILREGEDAVINCSSSKALYSVHWYRQKHGEAPVFLMILLKGGEQKGHDKISASFNEKKQQSSLYLMASQLSYSGTYFCGAE
Gorilla gorilla gorilla V1022 trav CYUI03000532.1 162777 IMGDAKTTQPNSMESYEEEPVHLPCNHSTISGTDYIHWYRQLPSQGPEYVIHGLTSNVNRMASLTIAEDRKSSTLILHRATLRDAAVYYCILR
Gorilla gorilla gorilla V1023 trav CYUI03000532.1 158013 VSSQELEQSPQSLIVQEGKNLTINCTSSKTLYGLYWYKQKYGEGLIFLMMLQKGGEEKSHEKITAKLDEKKQQSSLHITASQPSHAGIYLCGA
Gorilla gorilla gorilla V1024 trav CYUI03000532.1 140394 VSGQQLNQSPQSMFIQEGEDVSMNCTSSSIFNTWLWYKQDPGEGPVLLIALYKAGELTSNGRLTAQFGITGKDSFLNISASIPSDVGIYFCAG
Gorilla gorilla gorilla V1025 trav CYUI03000532.1 135622 VSSEDKVVQSPLSLVVHEGDTVTLNCSYEVTNFRSLLWYKQEKKAPTFLFTLTSSGIEKKSGRLSSILDKKELFSILNITATQTRDSAIYLCAVE
Gorilla gorilla gorilla V1026 trav CYUI03000532.1 90286 SGTAQTVTQSQPEMSVQEAETVTLSCTYDTSESNYYLFWYKQPPSRQMILVIRQEAYKQQNATENRFSVNFQKAAKSFSLKISDSQLGDTAMYFCAFM
Gorilla gorilla gorilla V1027 trav CYUI03000532.1 81094 FSMAQTVTQSQPEMSVQEAETVTLSCTYDTSESDYYLFWYKQPPSRQMILVIRQEAYKQQNATENRFSVNFQKAAKSFSLKISDSQLGDAAMYFCAYR
Gorilla gorilla gorilla V1028 trav CYUI03000532.1 58267 LSGELKVGQNPLFLSTQEGKNYTIYCNYSTTSDRLYWYKQDPGKSLESLFVLLSNGAVKQEGRLMASLDTKARLSSLHITAAVHDLSATYFCAV
Gorilla gorilla gorilla V1029 trav CYUI03000532.1 41570 VSAAKNEVEQSPQDLTAQEGEFITINCSYSVGISVLHWLQQYPGGGIVSLFMLSSGKKKHGRLIATINIQEKHSSLHITASHPRDSAIYICAV
Gorilla gorilla gorilla V1033 igkv CYUI03000561.1 133699 ARCDIQVTQSPSSLSASVGDRVTITCRASQGISNELSWYQQKPGQAPTLLIYAASSLQSGVPSRFSGSGSGTDFTLTISSLQPEDIATYYCLQDYTTP
Gorilla gorilla gorilla V1034 igkv CYUI03000561.1 116590 SSGNIVMTQTPLSLPVTLGEPASISCRSSQSLKDSDHGFIYLYWYLQKPGQSPQLLIYFVSYRASGVPDRFSGSGSGTDFTLEISRVEAEDVGVYYCMQSRELP
Gorilla gorilla gorilla V1035 igkv CYUI03000561.1 104346 SSGDIVMTQTPLSLPVTPGQPASISCRSSQSLLHSNGYTYLDWYLQKPGQSPQLLIYTLSYRASGVPDRFSGSGSGTDFTLKISRVEAEDVGVYYCMQALQTP
Gorilla gorilla gorilla V1036 igkv CYUI03000561.1 77024 SSGDIVMTQTPLSLPVTPGQPASISCRSSQSLLDSDDGNTYLYWYLQKPGQSPQLLIYEVSNRASGVPDRFSGSGSGTDFTLKISRVEAEDVGVYYCMQSRELP
Gorilla gorilla gorilla V1037 igkv CYUI03000561.1 66552 ARCDIQMTQSPSSLSASVGDRVTITCRASQSVSNYLSWYQQKPGKAPKLLIYAASSLQSGVPSRFSGSGSGTDFTLTISSLQPEDFATYYCQHGYGTP
Gorilla gorilla gorilla V1038 igkv CYUI03000561.1 47946 ARCDIQLTQSPTSLSASVGDRVTITCRASQGISNNLAWYQQKPGKVPKLLIYSASSLQSGVPSRFSGSGSGTDFTLTISSLQPEDVATYYCQRTYNAP
Gorilla gorilla gorilla V1039 igkv CYUI03000561.1 16271 ARCDIQMTQSPSSLSASVGDRVTITCRASQSISSYLNWYQQKPGKAPKLLIYAASSLQSGVPSRFSGSGSGTDFTFTISSLQPEDIATYYCQQYDNLP
Gorilla gorilla gorilla V1042 iglv CYUI03000580.1 972297 SWAQSVLTQPPSVSAAPGQKVTISCSGSSSNIGNNYVSWYQQLPGTAPKILIYDNNKRPSGISDRFSGSKSGTSATLGITGLQTGDEADYYCGTWDSSLSA
Gorilla gorilla gorilla V1043 iglv CYUI03000580.1 966444 SWAQSVLTQPPSVSGAPGQRVTISCTGSSSNIGAGYDVHWYQQLPGTAPKLLIYENNKRPSGVSDRFSGSKSGTSASLAITGLQSEDEADYYCEAWDNSLN
Gorilla gorilla gorilla V1044 iglv CYUI03000580.1 918575 SNSQAVVTQEPSLTVSPGGTVTLTCGSSTGAVTSGHYPYWFQQKPGQAPRTLIYDTSNKHSWTPARFSGSLLGGKAALTLSGAQPEDEAEYYCW
Gorilla gorilla gorilla V1045 iglv CYUI03000580.1 907349 SWAQSVLTQPPSASGTPGQRVTISCSGSSSNIGSNTVNWYQQLPGTAPKLLIYSNNQRPSGVPDRFSGSKSGTSASLAISGLQSEDEADYYCAAWDDSLNG
Gorilla gorilla gorilla V1046 iglv CYUI03000580.1 744920 SWAQSALTQPPFVSRAPGQSVTISCTGTSSDVGDYDHVFWYQKRLSTTSRLLIYNVNTQPSGISDLFSGSKSGNMASLTISGLKSEVEANYHCSLYSSS
Gorilla gorilla gorilla V1047 iglv CYUI03000580.1 664061 SVASYELTQPSSVSVSPGQTARITCSGDVLAKKYARWFQQKPGQAPVLVIYKDSERPSGIPERFSGSSSGTTVTLTISGAQVEDEADYYCYSAADNN
Gorilla gorilla gorilla V1048 iglv CYUI03000580.1 645778 SEASYELTQPPSVSVSPGQTARITCSGDALPKQYAYWYQQKPGQSPVLVIYKDSERPSGIPERFSGSSSGTTVTLTISGVQAEDEADYYCLSADSSGTY
Gorilla gorilla gorilla V1049 iglv CYUI03000580.1 640799 SWAQSALTQPSSVSGSPGQSVTISCTGTSTDIGSYNTVSWYQQHPGKAPKLMIYDVRWRPSGVPDRFSGSKSGNTASLTISGLQAEDEADYYCCSYAGS
Gorilla gorilla gorilla V1050 iglv CYUI03000580.1 634413 SVASYELTQPSSVSVSPGQTARITCSGDVLAKNYAGWYQQKPGQAPVLVIYKDSERPSGIPERFSGSSSGTTVMLTISGVQAEDEADYYCLSADSSGNH
Gorilla gorilla gorilla V1051 iglv CYUI03000580.1 623313 SWAQSALTQPSSVSGSPGQSVTISCTGTSSDVGGYNYVSWYQQHPGKAPKLMIYEVSKRPSGVSNRFSGSKSGNTASLTISGLQAEDEADYYCSSYRSGET
Gorilla gorilla gorilla V1052 iglv CYUI03000580.1 616895 SVASCELTQLPSVSVSPGQTARITCSGDVLGENYADWYQQKPGQAPELVTYEDSERPPGIPERFSGSTSGNMTTLTISRVLTEDEADYYCLSRDEDN
Gorilla gorilla gorilla V1053 iglv CYUI03000580.1 600596 SVVSSELTQDPAVSVALGQTVRITCQGDSLRSYYASWYQQKPGQVPVLIIYGKNNRPSGIPDRFSGSSSGNTASLTITGAQEEDEADYYCNSWDSSGNH
Gorilla gorilla gorilla V1054 iglv CYUI03000580.1 584597 SWAQSALTQPPSVSGSPGQSVTISCTGTSSDIGGYNRASWYQQHPGKAPKLMIYEVSKRPSGVSNRFSGSKSGNTASLTISGLQAEDEADYYCSSYTSS
Gorilla gorilla gorilla V1055 iglv CYUI03000580.1 571784 SEASYELTQPPSVSVSLGQTARITCSGEELPKKYAYWYQQKPGQSPVLVIYKDSERPSGIPERFSGSSSGTTVTLTISGVQAEDEADYYCLSADSSDTY
Gorilla gorilla gorilla V1056 iglv CYUI03000580.1 560568 SWAQSALTQPASVSGSPGQSITISCTGTSSDVGGYNYVSWYQQHPGKAPKLMIYYVSNRPSGVSNRFSGSKSGNTASLTISGLQAEDEADYYCSSYTSS
Gorilla gorilla gorilla V1057 iglv CYUI03000580.1 557371 SVASYELTQPPAVSVSPGQTARISCSGDVLRDNYADWYLQQPGQAPVLVIYKDGERPSGIPESFSGSTSGNTTTLTISRVLTKGRADYYCFSGD
Gorilla gorilla gorilla V1058 iglv CYUI03000580.1 547366 SATSYELTQPHSVSVATAQTARITCGGNNIGSKAVHWYQQKPGQDPVLVIYSDSNRPSGIPERFSGSNSGNTATLTISRIEAGDEADYYCQVWDSSSDH
Gorilla gorilla gorilla V1059 iglv CYUI03000580.1 527032 SWAQSALTQPRSVSGSPGQSVTISCTGTSSDVGGYNYVSWYQQHPGTAPKLMIYEVSNRPSGVPDRFSGSKSGNTASLTISGLQAEDEADYYCCSYAGSYS
Gorilla gorilla gorilla V1060 iglv CYUI03000580.1 507656 SEASYELTQSPSVSVSPGQTARITCSGDALPKKYAYWYQQKPGQAPVLVIYEDSKRPSGIPERFSGSSSGTMATLPISGAQVEDEADYYCYSTDSSGNH
Gorilla gorilla gorilla V1061 iglv CYUI03000580.1 500176 SVASYELTQPLSVSVALGQTARITCGGNNTGSKNVHWYQQKPGQAPVLVIYRDSNRPSGIPERFSGSNSGNTATLTISRAQAGDKADYYCQVWDS
Gorilla gorilla gorilla V1062 iglv CYUI03000580.1 496662 SWAQSALIQPPSASGSPGQSVTISCTGTSSDIGGYNYVSWYQRHPGKAPKLMIYEVSNRPSGVPNLFSGSKSGNTASLTISGLQAEDEADYYCCSYAGSNN
Gorilla gorilla gorilla V1063 iglv CYUI03000580.1 448278 LCALPVLTQPPSASASLGASVKLTCTLSSEHSTYTIEWYQQRPGRSPQYIMKVKSDGSHSKGDGIPDRFMGSSSGADRYLTISNLQSDDEAEYHCGE
Gorilla gorilla gorilla V1064 iglv CYUI03000580.1 438990 SVASYELTQPPSVSVSPGQTASITCSGDKLGDEYACWYQQKPGQSPVLVIYQDSKRPSGIPERFSGSNSGNTATLTISGTQAMDEADYYCQAWDS
Gorilla gorilla gorilla V1065 igkv CYUI03000583.1 40598 TRAETTLTQSPAFVSATPGDKVTISCKASQDIDDDMNWYQQKPGEAAIFIIQEATTLVSGIPPRFSGSGYGTDFTLTINNIESEDAAYYFCLQDDNFP
Gorilla gorilla gorilla V1088 ighv CYUI03000786.1 231046 VQCEVQLVESGGGLVQPGGSLRLSCAASGFTFSSYHMSWVRQAPGKGLEWVSVIYSDGSSTYYAASVKGRFTISRDNSKNTLYLQMNSLRAEDTAVYYCAR
Gorilla gorilla gorilla V1089 ighv CYUI03000786.1 213821 VQCEVQLVESGGGLVQPGGSLRLSCAASGFTFSSYAMHWVRQAPGKGLEWVSAIYSGGSTYYADSVKGRFTISRDNSKNTLYLQMGSLRAEDTAVYYCAR
Gorilla gorilla gorilla V1090 ighv CYUI03000786.1 195126 VLSQVQLQESGPGLVKPSQTLSLTCTVSGGSISSSDYYWSWIRQPAGKGLEWIGRIYTSGSTNYNPSLKSRVTISVDTSKNQFSLKLSSVTASDTAVYYCAR
Gorilla gorilla gorilla V1091 ighv CYUI03000786.1 160321 VLSQVQLQESGPGLVKPSQTLSLTCTVSGGSISSGSYYWSWIRQPPGKGLEWIGYIYYSGSTNYNPSLKSRVTISVDTSKNQFSLKLSSVTAADTAVYYCAR
Gorilla gorilla gorilla V1092 ighv CYUI03000786.1 155536 AHSQVQLVQSGPEVKKPGASVKVSCKASGYTFTSSAMQWVRQAPGQGLEWIGWIIVGSGNTNYAQKFQGRVTITRDTSTSTAYMELSSLRSEDMAVYYCAA
Gorilla gorilla gorilla V1093 ighv CYUI03000786.1 139512 ILSQVQLQESGPGLVKPSETLSLTCAVSGDSISSGNWWIWVRQPPGKGLEWIGEINHSGSTYYNPSLKSRITMSVDTSKNQFSLKLSSVTAADTAVYYCAR
Gorilla gorilla gorilla V1094 ighv CYUI03000786.1 124750 VQCEVQLVESGGGVVQPGRSLRLSCAASGFTFSSYWMHWVRQAPGKGLEWVSAIYSDGSSTYYAASVKGRFTISRDNSKNTLYLQMNSLRAEDTAVYYCAR
Gorilla gorilla gorilla V1095 ighv CYUI03000786.1 110833 VCAEVQLVQSAAEVKRPGESLRISCKGSGYSFTSYWIGWVRQMPGKGLEWMGIIYPGDSDTRYSPSFQGQVTISADKSISTAYLQWSSLKASDTAMYYCA
Gorilla gorilla gorilla V1096 ighv CYUI03000786.1 89183 VQCEVQLVESGGGLVKPGGSLRLSCTASGFTFGDYTMSWVRQAPGKGLEWVGFIRSKAYGGTTEYAASVKSRFTISRDDSKSIAYLQMNSLKTEDTAVYYCTT
Gorilla gorilla gorilla V1097 ighv CYUI03000786.1 70148 VQCEVQLVESGGGLVKPGGSLRLSCAASGFTFSSYGMSWVRQAPGKGLEWVSVISSSGRTTYYADSVKGRFTISRDNAKNSLYLQMNSLRAEDTAVYYCGE
Gorilla gorilla gorilla V1098 ighv CYUI03000786.1 49236 AQCEVQLVESGGGLVQPGGSLRPSCAASGFAFSSYVLHWVRRAPGKGLEWVSAIGTGGDTYYADSVMGRFTISRDNAKKSLYLQMNSLIAEDMAVYYCAR
Gorilla gorilla gorilla V1099 ighv CYUI03000786.1 41707 AHSQVQLVQSGAEVKKPGASVKVSCKASGYTFTSYYMHWVRQAPGQGLEWMGIINPSGGSTSYAQKFQGRVTMTRDTSTSTVYMELSSLRSEDTAVYYCAR
Gorilla gorilla gorilla V1100 ighv CYUI03000786.1 37596 AHSQMQLVQSGAEVKKTGASVKVSCKASGYTFTYRSLHWVRQAPGQALEWMGWITPYNGNTNYAQKFQDRVTITRDRSMSTAYMELSSLRSEDTAVYYCAR
Gorilla gorilla gorilla V1101 ighv CYUI03000801.1 139676 VLSQVQLQESGPGLVKPSETLSLTCVVSGGSISSSNWWSWVRQPPGKGLEWIGEIYHSGSPNYNPSLKSRVTISVDKSKNQFSLKLSSVTATDTAVYYCAR
Gorilla gorilla gorilla V1102 ighv CYUI03000801.1 115344 AHSQVQLVQSGAEVKKPGASVKVSCKASGYTFTDYYMHWVRQAPGQGLEWMGRINPNSGGTNYTQKFQGRVTMTRDTSISTAYMELSRLRSEDTATYYCAR
Gorilla gorilla gorilla V1103 ighv CYUI03000824.1 117032 TYSQVQLVQSGHEVKQPGASVKVSCKASGYSFTSYGMNWVRQAPGQGLEWMGWFNTYTGNPTYAQGFTGRFVFSMDTSVSTAYLQISSLKAEDTAMYYCAR
Gorilla gorilla gorilla V1104 ighv CYUI03000824.1 115209 VLSQVQLQEWGPGLVKPSEALSLTCAVSGDSISSGNWWSWVRQSPGKGLEWIGYIYYSGRSYYNPSLKSRVTMSVDTSKNQFSLKLSSVTAADTAVYYCAR
Gorilla gorilla gorilla V1105 ighv CYUI03000824.1 53321 VQCEVQLLESGGGLVQPGGSLRLSCAASGFTFSSYWMHWVRQAPGKGLEWVSRINSDGSSTSYADSVKGRFTISRDNAKNTLYLQMNSLRAEDTAVYYCAR
Gorilla gorilla gorilla V1106 ighv CYUI03000824.1 45602 VQCEVQLVESGGGLVQPGGSLRLSCAASGFTFSGSAMHWVRQASGKGLEWVGRIRSKANSYATAYAASVKGRFTISRDDSKNTAYLQMNSLKTEGTAVYYCTA
Gorilla gorilla gorilla V1107 ighv CYUI03000824.1 17105 VQCEVQLVESGGGLVQPGGSLRLSCAASGFTFSNYYKSWVCQAPGKGLEWVRFIRNKANGGTTEYTTSVKGRFTISRDDSKSITYLQMNSLKTEDTAVYYCSR
Gorilla gorilla gorilla V1109 trbv CYUI03000832.1 142038 SMDTKVTQRPRLLVKANEQKAKMDCVPIKRHSYVYWYHKTLEEELKFLIYFQNEEIIQKAEIINERFSAQCPQNSPCTLEIQSTESGDTARYFCANSK
Gorilla gorilla gorilla V1110 trbv CYUI03000832.1 133112 CFHAKVTQTPGYLVKGKGRKTKMYCTPENGHTFVCWYQQNQNKEFMFLISFQNEQVLQETEMHKKRFSPQCPKNPPCSLAILSSEPGDTALYLCASSP
Gorilla gorilla gorilla V1111 trbv CYUI03000832.1 108968 LMEAEIYQTPRYHVIGTGKKITLECSQTMGHDKMYWSRSRNGITPHPPFPWVNSTEKGDLSSESTVSRIRIEHFPLTLESASPSHTSQYLCASSE
Gorilla gorilla gorilla V1113 ighv CYUI03000977.1 59662 VLSQVQLQQWGAGVVKPSETLSLTCAVYGGSFSGYYWNWIRQPPGKGLEWIGHISYDGSTNYNPSLKSRVTISVDTSKNQFSLKLSSVTAADTAVYYCAR
Gorilla gorilla gorilla V1114 ighv CYUI03000977.1 47159 VQCEVQLVESGGGVVQPGRSLTLSCAASGFTFSSYGMHWVRQAPGKGLEWVAVIWNDGSNKYYADSVKGRFTISRDNSKNTLYLQMNSLRAEDTAVYYCAK
Gorilla gorilla gorilla V1115 ighv CYUI03000977.1 22976 VQCQVQLVESVGGVVQPGRSLTLSCAASGFTFSSYGMHWVRQAPGKGLEWVAVIWNDASNKYYADSVKGRFTISRDNSKNTLYLQMNSLRAEDTAVYYCAK
Gorilla gorilla gorilla V1116 igkv CYUI03001367.1 20787 ARCDIQLTQSPSSLSASVGDRVTITCRASQGISNRLNWYQQKPGKAPRLLIYDASSLESGVPSRFSGSGSGTDFTLTISSLQPEDFATYYCQQFNSYP
Gorilla gorilla gorilla V1117 igkv CYUI03001367.1 15029 SRCDIQMTQSPSSLSASVGDRVTITCRASQGISSWLAWYQQKPGKAPKLLIYAASSLESGVPSRFSGSGSGTDFTLTISSLQPEDFATYYCQQANSFP
Gorilla gorilla gorilla V1118 ighv CYUI03001378.1 4540 VLSQVTLKESGPVLVKPTETLTLTCTLSGFSLSTSGMGMSWIRQPPGKALEWLAHIFSNDKKSYSTSLKNRLIISKGTSKSQVVLTMTNMDPVDTATYYCAWR
Gorilla gorilla gorilla V1119 ighv CYUI03001447.1 25909 AAGGVWGGLVQPGGSLRLSCAASGFTFSNHYTSWVLQAPGKGLEWVSYISGDSDYTNYADSVKGRFTISRDNAKNSLYLRMNSLRAEDTAVYYCV
Gorilla gorilla gorilla V1120 ighv CYUI03001557.1 32893 VLSQVTLKESGPALVKPTQTLTLTCTFSGFSLSTSGMSVGWIRQPPGKALEWLALIYWDDDKYYSPSLKSRLTISKDTSKNQVVLTMTNMDPVDTATYYCARI
Gorilla gorilla gorilla V1121 ighv CYUI03001557.1 23861 VHSQVQLVQSGAEVKKPGSSVKVSCKASGGTFSSYAISWVRQAPGQGLEWMGGIIPILGTANYAQKFQGRVTITADESTSTAYMELSSLRSEDTAVYYCAR
Gorilla gorilla gorilla V1122 igkv CYUI03001565.1 12350 AKCDIQMTQSPSTLSASVGDRVTITCRASQGISKWLAWYQQKPGKAPKLLIYAASSLESGVPSRFSGSGSGTEFTLTISSLQPDDFATYYCQQHSSTP
Gorilla gorilla gorilla V1124 ighv CYUI03002185.1 9947 VLSQVQLQQWGTGLVKPSETLSLTCAVYGGSISSDGYYWSWIRQPPGKGLEWIGYIYYSGSTYYNPSLKSRVTISVDTSKNQFSLKLSSVTAADTAVYYCAR
Gorilla gorilla gorilla V1125 ighv CYUI03002304.1 10303 VLSQLQLQESGPGLVKPSETLSLTCTVSGGSISSGSYYWSWIRQPPGKGLEWIGSIYYSGGTYYNPSLKSRVTISVDTSKNQFSLKLSSVTAADTAVYYCAR
Gorilla gorilla gorilla V1127 ighv CYUI03002502.1 9665 VQCEVHLVQSGGGLVQPGGSLRLSCAGSGFTFSSHAMHWVRQAPGKGLEWVSAIGTGGGTYYADSVKGRFTISRDNAKNSLYLQMNSLRAEDMAVYYCAR
Gorilla gorilla gorilla V261 trbv CYUI02000278.1 12255 SVFSAVISQKPSRDICQRGTSMTIQCQVNSQVTMMFWYCQQPGQSVTLIATANQGSEATYESRFVIDKFPISCPNLTFSTLTVSNRSPEDSSIYLCSVE
Gorilla gorilla gorilla V312 trbv CYUI02000484.1 4803981 VRSQTIHQWPATLVQPVGSPLSLECTVEGTSNPNLYWYRQAAGRGLQLLFYSAGIGQISSEVPQNLSASRPQDRQFILSSKKLLLSDSGFYLCAWS
Gorilla gorilla gorilla V313 trdv CYUI02000487.1 4813001 RGMLCDKVTQSSPDQTVASGSEVVLLCTYDTVYSNPDLFWYRIRPDYSFQFVFYGDNSGSQAADFTQGRFSVKHILTQKAFHLVISPVRTEDSATYYCAF
Gorilla gorilla gorilla V438 igkv CYUI02000983.1 22653 CNGDIVLTQSPASLAMSPGQRATITCRASECVSFLGINLIHWYQQKPGQPPKLLIYQASNKDIGVPARFSGSGSGTDFTLTINPVEANNTAKYYCLQSKNFP
Gorilla gorilla gorilla V444 trbv CYUI02001058.1 231214 LTEPEVTQTPSHQVTQMGQEVILRCVPISNHLYFYWYRQILGQKVEFLVSFYNNKISEKAEIFDDQFSVERPDGSNFTLKIRSTKLEDSAMYFCASSE
Gorilla gorilla gorilla V445 trbv CYUI02001058.1 238828 PLDTAVSQTPKYLVTQMGNDKSLKCEQNLGHDTMYWYKQDSKKFLKIMFSYNNKELIINETVPNRFSPKSPDKAHLDLHIKSLELGDSAVYFCASS
Gorilla gorilla gorilla V446 trbv CYUI02001058.1 243448 PIDTEVTQTPKHLVMGMTNKKSLKCEQHMGHRAMYWYKQKAKKPPELMFVYSYEKLSVNESVPSRFSPECPNNSLLNLHLHALQPEDSALYLCASSQ
Gorilla gorilla gorilla V447 trbv CYUI02001058.1 251290 PVEAGVTQTPRYLIKTRGQQVTLSCSPISGHRSVSWYQQTLGQGLQFLFEYFGETQRNKGNFPGRFSGRQFSNSRSEMNVSTLELGDSALYLCASSL
Gorilla gorilla gorilla V448 trbv CYUI02001058.1 258534 PVNAGVAQTPKFQVLKTGQSMTLQCAQDMNHNSMYWYRQDPGMGLRLIYYSAAEGTTAKGEVPDGYNVSRLNKREFSLRLESAAPSQTSVYFCASSE
Gorilla gorilla gorilla V449 trbv CYUI02001058.1 275710 PMEMGVTQTPRHLVMGMTNKKSLKCEQHLGHNAMYWYKQSAKKPLELMFVYSLEERVENNSVPSRFSPECPNSSHLFLHLHALQPEDSALYLCASSQ
Gorilla gorilla gorilla V450 trbv CYUI02001058.1 280895 PVDAGVTQTPKFQVLKTGQSMTLQCAQDMNHNYMYWYRQDPGMGLRLIHYSAGEGTTAKGEVPDGYNVSRLNTQNFLLRLELAAPSQTSVYFCATSE
Gorilla gorilla gorilla V451 trbv CYUI02001058.1 311917 PLDTAVSQTPKYLVTQMGKKESLKCEQNLGHNAMYWYKQDSKKFLKTMFIYSNKEPILNETVPNCFSPDSPDKAHLNLHINSLELGDSAVYFCASSQ
Gorilla gorilla gorilla V452 trbv CYUI02001058.1 315364 PMETGVTQTPRHLVMGMTNKKSLKCEQHLGHNAMYWYKQSAKKPLELMFVYSFKEQTENNSVPSRFSPECPNSSHLFLHLHALQPEDSALYLCASSQ
Gorilla gorilla gorilla V453 trbv CYUI02001058.1 323667 PVNAGVTQTPKFHVLKTGQSMTLLCAQDMNHEYMYWYRQDPGMGLRLIHYSVGEGTTAKGEVPDGYNVSRLKKQNFLLGLESAAPSQTSVYFCASSY
Gorilla gorilla gorilla V454 trbv CYUI02001058.1 327354 HTRAGVSQSPSNKVTEKGKDVVFRCDPISGHSVLYWYQQSLGQGLEFLIYFQGNSAPDKSGLPSDRFSAERTGGSVSTLTIQRTQQEDSAMYLCASSL
Gorilla gorilla gorilla V455 trbv CYUI02001058.1 355211 PMIAGITQAPTSQILAAGRSMTLRCTQDMRHNAMYWYRQDLGLGLRLIHYSNTAGTTGKGEVPDGYSVSRANTDDFPLMLASAVPSQTSVYFCASSD
Gorilla gorilla gorilla V456 trbv CYUI02001058.1 359261 HTGAGVSQTPSNKVTEKGKDVELRCDPISGHTALYWYRQSLGQGPEFLIYFQGTGATDDSGLPNDRFFAVRPEGSVSTLKIQRTEQGDSAVYLCASSL
Gorilla gorilla gorilla V457 trbv CYUI02001058.1 364157 PVEAGATQSPTHLLKTRGQQVTLRCSPISGHSSVSWYQKAPGQGPQFIFEYANELRRLEGNFPNRFSGRQFHDYRSEMNVSALELGDSALYLCARSL
Gorilla gorilla gorilla V458 trbv CYUI02001058.1 366889 PVDSGVTQTPKHLITATGQRVTLRCSPRSGDLSVYWYQQSLDQGLQFLIQYYNGEERAKGNILERFSAQQFPDSHSELNLSSLELGDSALYLCASSV
Gorilla gorilla gorilla V459 trbv CYUI02001058.1 374930 MLKKITQSPRHKITETGRQVTLACYQTWNHNNMFWYRQDLGHGLRLSHYSYGVQDTNKGEVSDGCSVSRSNTEDFPLTLESAASSQTSVYFCASSE
Gorilla gorilla gorilla V460 trbv CYUI02001058.1 382659 FSEAEVAQSPRYKITEKSQAVAFWCDPISGHATLYWYRQILGQGPELLVRFQDESVVDDSQLPKDRFSAERLKGVDSTLKIQLAKLEDSAVYLCASSL
Gorilla gorilla gorilla V461 trbv CYUI02001058.1 399664 PVNAGVTQTPKFQVLKTGQSMTLQCAQDMNHDYMYWYRQDPGMGLRLIHYSVGAGITDKGEVPNGYNVSRSNTEDFPLRLQSAAPSQTSVYFCASSY
Gorilla gorilla gorilla V462 trbv CYUI02001058.1 403851 HTGAGVSQSPRYKVAKRGRDVALRCDSISGHVTLYWYRQTLGQGSEVLTYFRSDAQRDKSGRPSGRFSAERPERSVSTLKIQRTEQGDSAVYLCASSL
Gorilla gorilla gorilla V463 trbv CYUI02001058.1 411766 SVETGVTQSPTHLIKTRGQQVTLRCSPQSGHNTVSWYQQALGQGPQLIFQYYREEENGRGNFSPRFSGRQFPNYSSELNVNTLELDDSALYLCASSL
Gorilla gorilla gorilla V464 trbv CYUI02001058.1 418198 PVNAGVTQTPKFRILKIGQSMTLQCAQDMNHNYMSWYQQDPGMGLKLIYYSVTAGITDKGEVPNGYNVSRSTTEDFPLRLESAARSQTSVYFCASSY
Gorilla gorilla gorilla V465 trbv CYUI02001058.1 448604 LVDAGVTQSPTHLIKTRGQQVTLRCSPKSGHDTVSWYQQALGQGPQFIFQYYEEEERQRGNFPDRFSGHQFPNYSSELNVNALLLGDSALYLCASSL
Gorilla gorilla gorilla V466 trbv CYUI02001058.1 468961 PVDAGVTQSPTHLIKMRGQHVTLRCSPISGHTSVSWYQQALGQGPQFIFEYYEKEERGRGNFPDRFSARQFPNYSSELNVNPLLMGDSALYLCASSL
Gorilla gorilla gorilla V467 trbv CYUI02001058.1 478224 HADTGVSQDPRHKITKRGQNVTFRCDPISEHNQLYWYRQTLGQGAEFLTYFQNEAQLEKSRLLSDRFSAERPKGSFSTLEIQRTEQGDSAMYLCASSL
Gorilla gorilla gorilla V468 trbv CYUI02001058.1 484771 SVAAGVIQSPRHLIKEKRETATLKCYPIPRHDTVYWYQQGPGQDPQFLISFYEKMQSDKGSIPDRFSAQQFSDYHSELNMSSLELGDSALYFCASSL
Gorilla gorilla gorilla V469 trbv CYUI02001058.1 493890 HMDAGITQSPRHKVTEIGTPVTLRCHQTENHRYMYWYRQDPGHGLRLIHYSYGVKDTDKGEVSDGYSVSRSKTEDFLLTLESATSSQTSVYFCAISE
Gorilla gorilla gorilla V470 trbv CYUI02001058.1 504568 LIEAGVVQSPRYKIIEKKQPVAFWCNPISGHNTLYWYRQNLGQGPELLIRYENEEAVDDSQLPKDRFSAERLKGVDSTLKIQPAELGDSAVYLCASSL
Gorilla gorilla gorilla V471 trbv CYUI02001058.1 510179 HTDAGVIQSPRHEVTEMGQEVTLRCKPISGHNSLFWYRQTMMRGLELLIYFNNNVPIDDSGMPKDRFSAKMPNASFSTLKIQPSEPRDSAVYFCASSL
Gorilla gorilla gorilla V472 trbv CYUI02001058.1 530862 LTDAEVTQTPRHKVTEMGQEVTMRCQPILGHNTVFWYRQTMMQGLELLAYFRNRAPLDDSGMPKDRFSAEIPDATLATLKIQPSGPRDSAVYFCASGL
Gorilla gorilla gorilla V473 trbv CYUI02001058.1 542903 HGDAMVIQNPRYQVTQFGKPVTLSCSQNLNHNIMYWYQQKSSQAPKLLFHYYDKDFNNEADTPDNFQSRRPNTSFCFLDISSPGLGDAAMYLCATSR
Gorilla gorilla gorilla V474 trbv CYUI02001058.1 547897 SPGEEVTQTPKHLVRGEGQKAKLYCAPIKGHSYVFWYQQVLKKEFKFLISFQNENVFDETGMPKERFSAKCLPNSPCSLEIQATKLEDSAVYFCASSQ
Gorilla gorilla gorilla V475 trbv CYUI02001058.1 565773 LSNAGVMQNPRHLVRRRGQEARLRCSPMKGHSHVYWYRQLPEEGLKFMVYLQKENIIDESGMPKERFSAEFPKEGPSILRIQQAVRGDSAAYFCAS
Gorilla gorilla gorilla V476 trbv CYUI02001058.1 568899 TVDGGITQSPKYLFRKEGQNVTLNCEQNLNHDAMYWYRQDPGQGLRLIYYSQIVNDFQKGDIAEGYSVSREKKESFPLTVTSAQKNPTAFYLCASSI
Gorilla gorilla gorilla V477 trbv CYUI02001058.1 576756 GSGLGAVVSQHPSRVICKSGTSVKIECRCLDFQATTMFWYRQFPKQSLMLMATSNEGSKATYEQGVEKDKFLINHPNLTLSTLTVTSAHPEDSSFYICSAR
Gorilla gorilla gorilla V478 trbv CYUI02001058.1 586730 STDTKVTQRPRLLVKASEQKAKMDCVPIKGHSYVYWYRKKLEEELKFLVYFQNEEIIQKAEIINERFLAQCSKNSSCTLEIQSTESGDTALYFCASSK
Gorilla gorilla gorilla V479 trbv CYUI02001058.1 595787 SFHAKVTQTPGHLVKGKGQKTKMDCTPEKGHTFVYWYQQNQNKEFMLLISFQNEQVLQETEMHKKRFSSQCPSNTPCSLAILSSEPGDTALYLCASSQ
Gorilla gorilla gorilla V480 trbv CYUI02001058.1 606534 SMDADVTQTPRNRITKTGKRIMLECSQTKGHDRMYWYRQDPGLGLRLIYYSFDVKDINKGEISDGYSVSRQAQAKFSLSLESATPNQTALYFCATSD
Gorilla gorilla gorilla V481 trbv CYUI02001058.1 620569 LMEADIYQTPRYLVIGTGKKITLECSQTMGHDKMYWYQQDPGMELHLIHYSYGVNSTEKGGLSSESTVSRIRTEHFPLTLESARPSHTSQYLCASSE
Gorilla gorilla gorilla V482 trbv CYUI02001058.1 665103 PLEAQVTQNPRYLITVTGKKLTVTCSQNMNHEYMSWYRQDPGLGLRQIYYSINVEAIDKGDVPEGYNVSRKEKRNFPLILESPSPNQTSLYFCASSL
Gorilla gorilla gorilla V483 trbv CYUI02001058.1 670404 LVDVKVTQSSRYLVKRMGEKVFLECVQDMDHENMFWYRQDPGLGLRLIYFSSDVKMKEKGDIPEGYSVSREKKERFSLILESTSTNQTSMYLCASSL
Gorilla gorilla gorilla V485 iglv CYUI02001061.1 469290 SLSQLVLTQSPSASASLGASVKLTCTLSSGHSSYAITWHQQQPEKGPRYLMKLNSDGSHSKGDGIPDRFSGSSSGAERYLTISSLQSEDEADYYCQTW
Gorilla gorilla gorilla V486 iglv CYUI02001061.1 500458 VDSQTVVTQEPSFSVSPGGTVTLTCGLSSGSVSTSYYPSWYQQTPGQAPRMLIYSTNTRSSGVPDRFFGSIIGNKASLTITGAQADDESDYYCVLYMGSGI
Gorilla gorilla gorilla V487 iglv CYUI02001061.1 566593 SLSQPVLTQSSSASASLGSSVKLTCTLSSGHSSYIIAWQQQQPGKAPRYLMRLEGSGSYNKGNGIPDRFSGSSSGADRYLTISNLQSEDEADYYCQTWDS
Gorilla gorilla gorilla V488 iglv CYUI02001061.1 600155 SWANFMLTQPHSVSESPGQTVTISCTRSSGSIASNYVQWYQQRPGSAPTTVIYEDNQRPSGVPDRFSGSIDSSSNSASLTISGLKTEDEADYYCQSYDSS
Gorilla gorilla gorilla V489 iglv CYUI02001061.1 619043 SMVQAGLTQPPSVSKGLRQTATLTCTGNSNNVGNQGAAWLQQHQGHPPKLLSYRNNNRPSGISERFSASRSGNTASLTIIGLQPEDEPDYYCSAWDSSLS
Gorilla gorilla gorilla V501 ighv CYUI02001198.1 17567 VLSQVTLKESGPVLVKPTETLTLTCTVSGFSLSNARMGVSWIRQPPGKALEWLAHIFSNDEKSYSTSLKSRLTISKDTSKSQVVLTMTNMDPVDTATYYCAWI
Gorilla gorilla gorilla V502 ighv CYUI02001198.1 49636 VQCEVQLVESRGGLVQPGGSLRLSCVASGFTFSSYAMSWVRQAPGKGLEWVSTISSTGGSTWYPGSVKGRFTISRDNSKNTLYLQMNSLRAEDTAVYYCAK
Gorilla gorilla gorilla V503 ighv CYUI02001198.1 60573 AQCEVQLVESGGGLVKPGGSLRLSCAASGFTFSNYYMEWVRQAPGKGLEWVGFIRTKAKGGTTEYAASVKGRFTISRDDSKSIAYLQMNSLKTEDTAVYYCTR
Gorilla gorilla gorilla V504 ighv CYUI02001198.1 83384 VQCDVQLVESGGGLVQPGGSLRLSCAASGFTFSSYWMSWVRQAPGKGLEWVSYISSSSSYIYYADSVKGRFTISRDNAKNSLYLQMNSLRAEDTAVYYCAK
Gorilla gorilla gorilla V505 ighv CYUI02001200.1 11513 VQCEVQLVESGGGLVKPGGSLRLSCVASGFTFSSYSMNWVRQAPGKGLEWVSYISSSSSTIYYADSVKGRFTISRDNAKNSLYLQMNSLKTEDTAVYYCAR
Gorilla gorilla gorilla V506 ighv CYUI02001200.1 76457 VLSQITLKESGPTLVKPTQTLTLTCTFSGFSLSTSGTSVSWIRQPPGKALEWLAAIYSDDDKRYSPSLKSRLTITKDTSKNQVVLTMTNMDPVDTATYYCAHR
Gorilla gorilla gorilla V507 ighv CYUI02001200.1 116285 AHSQVQLVQSGSEVKKPGASVKVSCKASGYTFTSYGMNWVRQAPGQGLEWMGWINTNTGNPTYAQGFTGRFVFSLDTSVSTAYLQISSLKAEDTAVYYCAR
Gorilla gorilla gorilla V508 ighv CYUI02001200.1 129143 VLSQVQLQESGPGLVKPSETLSLICAVSGGSISSSNWWIWVRQSPGKGLEWIGYIYYSGSTYYNPSLKSRVTMSVDTSKNQFSLKLSSVTAADTAVYYCAR
Gorilla gorilla gorilla V509 ighv CYUI02001200.1 135983 AHSQVQLVQSGAEVKKPGASLKVSCKASGYTFTGYAMHWVRQAPGQRLEWMGWINTGNGNTKYSQKFQGRVTITRDTSASTAYMELSSLRSEDTAVYYCAR
Gorilla gorilla gorilla V510 ighv CYUI02001200.1 153497 AHSQVQLVQSGAEVKKPGASVKVSCKASGYTFTGYYMHWVRQAPGQGLEWMGWINPNSGGTNYAQKFQGRVTMTRDTSISTAYMELSRLRSEDTATYYCTR
Gorilla gorilla gorilla V511 ighv CYUI02001200.1 198696 VLSQVQLQQSGPGLVKPSQTLSLTCAISGDSVSSSSAAWNWIRQSPSRGLEWLGRTYYRSKWYNDYAVSVQSRITINPDTSKNQFSLQLNSVTPEDTAVYYCAR
Gorilla gorilla gorilla V516 igkv CYUI02001266.1 54314 SSGDIVMTQTPLSLPVTLGQPASISCRSSQSLVHSDGNTYLNWIQQRPGQPPRLLIYKVSNRFSGVPDRFSGSGAGTDFTLKISRVEAEDVAVYYCTQG
Gorilla gorilla gorilla V517 igkv CYUI02001266.1 70820 SRGEIVLTQSPDFQSVTPKEKVTITCRASQSIGSSLHWYQQKPDQSPKLLIKYASQSISGVPSRFSGSGSGTDFTLTINSLEAEDAATYYCQQSSSL
Gorilla gorilla gorilla V518 igkv CYUI02001266.1 89357 TTGEIVLTQSPATLSSSPGERATLSCRASQSVSSSYLAWYQQKPGQAPRLLIYDASSRATGIPDRFSGSGSGTDFTLTISRLEPEDFAVYYCQQYSNWP
Gorilla gorilla gorilla V519 igkv CYUI02001266.1 103205 SSGDIVMTQTPLSLPVNPGQLASISCRSSQSLLHSNGYTYLHWYLQKPGKSPQLLIYRVSSHFSGVPDRFSGSGSGSDFTLKISWVEAEDVGVYYCMQA
Gorilla gorilla gorilla V520 igkv CYUI02001266.1 120506 SRGDVVMTQSPAFLSVTPGEKVTITCQASEGIGNYLYWYQQKPDQAPKLLIKYASQSISGVPSRFSGSGSGTDFTFAISSLEAEDAATYYCQQGN
Gorilla gorilla gorilla V521 igkv CYUI02001266.1 132353 ARCDIQMTQSPSSLSASVGDRVTITCRASQGISKWLAWYQQKPGKAPKRLIYAASSLESGVPSRFSGSGSGTEFTLTISSLQPEDFATYYCLQYNSYP
Gorilla gorilla gorilla V522 igkv CYUI02001266.1 147009 TTGEIVMTQSPATLSVSPGERATLSCRASQSVSSYLAWYQQKPGQAPRLLIYGASNRATGIPARFSGSGSGTDFTLTISSLEPEDFAVYYCQQYNNWS
Gorilla gorilla gorilla V523 igkv CYUI02001266.1 192178 ARCDIQMTQSPSSVSASVGDRVTITCRASQGISNYLAWFQQKPGKAPKRLIYAASSLQSGVPSRFSGSGSGTDFTLTISSLQPEDFATYYCLQGYDYP
Gorilla gorilla gorilla V524 igkv CYUI02001266.1 205193 TTGEIVMTQSPATLSLSPGERATLSCRASQSVSSYLAWYQQKPGQAPRLLIYDASNRATGIPARFSGSGSGTDFTLTISSLEPEDFAVYYCQQRSNW
Gorilla gorilla gorilla V525 igkv CYUI02001266.1 242252 ARCDIQMTQSPSSLSASVGDRVTITCRASQGISSYLAWYQQKPGKAPKLLIYYASSLQSGVPSRFSGSGSGTDYTLTISSLQPEDFATYYCQQYNSDP
Gorilla gorilla gorilla V526 igkv CYUI02001266.1 259833 ARCAIRMTQSPSSLSASTGDRVTITCRASQGISSYLAWYQQKPGKAPKLLIYAASTLQSGVPSRFSGSGSGTEFTLTISCLQSEDFATYYCQQYYSYP
Gorilla gorilla gorilla V527 igkv CYUI02001266.1 273749 TTGEIVMTQSPATLSLSPGERATLSCRASQSVSSYLTWYQQKPGQAPRLLIYGASTRATGIPARFSGSGSGTDFTLTISSLQPEDFAVYYCQQHSNWP
Gorilla gorilla gorilla V528 igkv CYUI02001266.1 286185 ARCDIRMTQSPSSLSASVGDRVTITCRASQGIRNDLGWYQQKPGKAPKILIYAASSLQSGVPSRFSGSGSGTDFTLTISSLQPEDFATYYCLQDYNYP
Gorilla gorilla gorilla V539 ighv CYUI02001737.1 102688 VLSQVTLKESGPVLVKPTETLTLTCTLSGFSLSTSGMGMSWIRQPPGKALEWLAHIFSNDKKSYSTSLKNRLIISKGTSKSQVVLTMTNMDPVDTATYYCAWR
Gorilla gorilla gorilla V545 igkv CYUI02003214.1 19201 TTGEIVMTQSPATLSLSPGERATLSCRASQSVSSYLTWYQQKPGQAPRLLIYGASTRATGIPARFSGSGSGTDFTLTISSLQPEDFAVYYCQQHSNWP
Gorilla gorilla gorilla V549 ighv CYUI02003788.1 23795 AQSQVQLVQSGAEVKKPWASVKVACKASGYTFTSYCMHWVRQAHAQGLEWMGLVCPSDGSTSYAQKFQGRVTITRDTSMSTAYMELSSLRSEDTAMYYCVR
Gorilla gorilla gorilla V550 ighv CYUI02003962.1 27262 AHAEGQLVQSGAEVKKPGATVKISCKASGYTFTDYYMHWVQQAPGKGLEWMGRVDPEDGKTIYAEKFQGRVTITADTSTDTAYMELSSLRSEDTAVYYCAT
Gorilla gorilla gorilla V554 ighv CYUI02005441.1 18879 AHAEVQLVQSGAEVKKPGATVKISCKASGYTFTDYYMHWVQQAPGKGLEWMGRVDPEDGKTIYAEKFQGRVTITADTSTDTAYMELSSLRSEDTAVYYCAT
Gorilla gorilla gorilla V877 trbv CYUI02000484.1 4906976 SVFSAVISQKPSRDICQRGTSLTIQCQVDSQVTMMFWYRQQPGQSLTLIATANQGSEATYESGFIIDKFPISRPNLTFSTLTVSNMSPEDSSIYLCSVE
Gorilla gorilla gorilla V880 trdv CYUI02000487.1 4859879 VMSAIELVPEHQTVTVSMGVPATLRCSMKGEAIGNYYINWYRKTQGNTMTFIYREKDIYGPGFKDNFQGDIDIAKNLAVLKILAPSERDEGSYYCAC
Gorilla gorilla gorilla V888 trav CYUI02000515.1 1456388 TSDEEFQVNQPQTLVSVNPGDVLTLACNMSALSPEGPVLWFKSTGPGQQLIYSFNGSHFPRVTPVENTMVDQTDYSIRISDVLPEDAGTYYCVKLRV
Gorilla gorilla gorilla V904 trgv CYUI02000570.1 2445135 SQKSSNLEGRTKSVIRQTGSSAEITCDLDGGSTGYIHWYLHQEGKAPQRLQYYDSYNSKVVLESGVSPGKYYTYTSTRKNLRLILRNLIENDSGVYYCATWD
Gorilla gorilla gorilla V905 trgv CYUI02000570.1 2440794 SQKSSNLEGRTKSVTRQTGSSAEITCDLTVTNTFYIHWYLHQEGKAPQRLLYYDVSTARDVLESGLSSGKYYTHTPRRWSWILRLQNLIENDSGVYYCATWD
Gorilla gorilla gorilla V906 trgv CYUI02000570.1 2436019 SQKSSNLEGRTKSVIRQTGSSAEITCDLAEGSTGYIHWYLHQEGKAPQRLLYYDSYTSRVVSESGISPGKYDTYGSTRKNLRLILRNLIENDSGVYYCATWD
Gorilla gorilla gorilla V907 trgv CYUI02000570.1 2426923 IFQLGRENEVSHQADWVIAEITCDLTVTNAFYIHWYLPQEGKAPQRLLYYDVSTARDVLESGLSSGKYYTHTPRRWSWILRLQNLIENDSGVYYCATWD
Gorilla gorilla gorilla V908 trgv CYUI02000570.1 2412243 SQKSSNLEGRTKSVTRPPGSSAVITCDLPVENAAYIHWYLHQEGKAPQRLLYYDSYNSRVVLESGISREKYHTYASTGKSLKFILENLIEHDSGVYYCATWD
Gorilla gorilla gorilla V909 trgv CYUI02000570.1 2398081 HLEQPQISSTKTLSKTARLECVVSGVTISATSVYWYRERPGEVIQFLVSISHDGTVRKESGIPSGKFEVDRIPEMSTSTLTIHNVEKQDIATYYCALWE
Gorilla gorilla gorilla V910 trgv CYUI02000570.1 2364235 TSGENLITQLVTSVTKKKGNTAFFECQIKSSTFKKNVCIHWYHQKPDRSLKRILYISSNENVVHEQGVSEERYEARKWQSDLSSSLRIHRVAEEDAGIYYCACW
Gorilla gorilla gorilla V911 trgv CYUI02000570.1 2362236 GDTKMRVSQDQLSSTRRQDRTVHKRCKLSGVPLENTVVHWYQQQEGEPLRRILYGSAKNYKQDRPNPRLEADDKHDGIFYLIINNVAKSDEATYYCACWDLIM
Gorilla gorilla gorilla V990 ighv CYUI02000896.1 1276842 AQCEVQLVESGGGLVQPGGSLRLSCAASGFTFSNHYTSWVLQAPGKGLEWVSYISGDSDYTNYADSVKGRFTISRDNAKNSLYLQMNSLRAEDTAVYYCV
Gorilla gorilla gorilla V992 trav CYUI02000899.1 752675 TAGQSLEQPSEVTAVEGATVQINCTYQTSGFYGLSWYQQHDGGAPTFLSYNALDGLEETGHFSSFLSRSDSYGYLLLQELQMKDSASYFCAVR
Gorilla gorilla gorilla V993 trav CYUI02000899.1 731626 MYLVLGTTGQNTDQPTEMTATEGAIVQINCTYQTFGFNGLFWYQQHAGKAPTFLSYNVLDGLEEKGRFSSFLSRSKVYSYLLLKELQMKDAASYLCAVR
Gorilla gorilla gorilla V994 trav CYUI02000899.1 642312 GLRAQSVAQPEDQVTVAEGNPLTVKCTYSVSGNPYLFWYVQYPNQGLKFLLKYITGDNLVKGSYGFEAEFNKSQTSFHLKKPSALVSDSALYFCAVR
Gorilla gorilla gorilla V995 trav CYUI02000899.1 629710 TLSLAKTTQPISMDSYEGQEVNITCSHNNIATNDYITWYQQFPSQGPRFIIQGYKTNVTNEVASLFIPADRKSSTLSLPRVSLSDTAVYYCLVG
Gorilla gorilla gorilla V996 trav CYUI02000899.1 617002 MSRGEDVEQSLFLSVQEGDSSIIKCTYTDSSSTYLYWYKQEPGAGLQLLMYIFSNMDMKQDQRLTVLLNKKDKHLSLRIADTQTGDSAIYFCAES
Gorilla gorilla gorilla V997 trav CYUI02000899.1 597420 VKSQKIEQNSEALNIQEGKTATLTCNYTNYSPAYLQWCRQDPGRGPVFLLLIRENEKEKRKERLKVTFDTTLKQSLFHITASQPADSATYLCAL
Gorilla gorilla gorilla V998 trav CYUI02000899.1 583058 ANGENQVEHSPHFLGPRQGDIASMSCTYSVSRFNNLPWYRQNTGMGPKHLLSMYSAGYEKQKGRLNATLLKNGSSLYITAVQPEDLATYFCAVD
Gorilla gorilla gorilla V999 trav CYUI02000899.1 568848 DARAQSVSQHNHHVILSEAASLELRCNYSYGGTVNLFWYVQYPGQHLQLLLKYFSGDPLVKGIKGFEAEFIKSKFSFNLRKPSVQWSDTAEYFCAMN
Gorilla gorilla gorilla V1000 trav CYUI02000899.1 554722 GINGDSVVQTEGQVLLSEGDSLIVNCSYETTQYPSLFWYVQYPGEGPQLLLKAMKANDKGRNKGFEATYHKETTSFHLEKDSVQESDSAVYFCALS
Gorilla gorilla gorilla V1001 trav CYUI02000899.1 541220 GSGKNQVEQSPQSLIILEGKNCTLRCNYTVSPFNNLRWYKQDTGRGPVSLTIMTFSENTKSNGRYTATLDADTKQSSLHITASQLSDSASYICVVS
Gorilla gorilla gorilla V1002 trav CYUI02000899.1 525478 VWSQRKEEVEQDPGPFNVPEGATVAFNCTYSNSASQSFFWYRQDCRKEPKLLMSVYSSGNEDGRFTAQLNRASQYISLLIRDSQLSDSATYLCAV
Gorilla gorilla gorilla V1003 trav CYUI02000899.1 520034 GTRAQSVTQLDSHVSVSEGTPVLLRCNYSSSYSPSLFWYVQHPNKGLQLLLKYTSRATLVKGINGFEAEFKKSETSFHLTKPSAHMSDAAEYFCAVS
Gorilla gorilla gorilla V1004 trav CYUI02000899.1 514282 TARAQSVTQPDIHITVSEGASLELRCNYSYGATPYLFWYVQSPGQGLQLLLKYFSGDTLVQGIKGFEAEFKRSQSSFNLRKLSVHWSDAAEYFCAVG
Gorilla gorilla gorilla V1005 trav CYUI02000899.1 497605 VNGENVEQHPSTLSVQEGDSAVIKCTYSDSASNYFPWYKQELGKGPQLLIDIRSNVGEKKDQGITVTLNKTAKHFSLHITETQPEDSAVYFCAAS
Gorilla gorilla gorilla V1006 trav CYUI02000899.1 478279 VWSQQKEVEQNSGPLSVPEGAIASLNCTYSDRRSQSFFWYRQYSGKSPELIMSIYSNGDKEDGRFTAQLNKASQYVSLLIRDSQPSDSATYLCAV
Gorilla gorilla gorilla V1007 trav CYUI02000899.1 465156 LKFLSFVLCPFISQASQNLGKIEKNLCDYRGRFPDTATPSLFWHVQSPGQGLQLLLKYFSGDTLVQGIEGFEAEFKRSQSSFNLRRPSVHWSDAAEYFCAVG
Gorilla gorilla gorilla V1008 trav CYUI02000899.1 450988 VSRGESEGLHLPTLSVQEGDNSIINCAYSNSASDYFIWYKQESGKGPQFIIDIRSNMDKRQGQRVTVLLNKTVKHLSLQIAATQPGDSAVYFCAEN
Gorilla gorilla gorilla V1009 trav CYUI02000899.1 445061 PGIAQKITQTQPGMFVQEKEAVTLDCTYDTSDQSYGLFWYKQPSSGEMIFLIYQGSYDQQNATEGRYSLNFQKARKSANLVISASQLGDSATYFCAMRE
Gorilla gorilla gorilla V1010 trav CYUI02000899.1 428243 RTRGDSVTQMEGPVTLSEEAFLTINCTYTATGYPSLFWYVQYPGEGLQLLLKATKADDKGSNKGFEATYRKETTSFHLEKDSVQASDSAVYFCALS
Gorilla gorilla gorilla V1011 trav CYUI02000899.1 403883 VWSQQKEVEQDPGPLSVPEGAIASLNCTYSNSAFQYFMWYRQYSRKGPELLMYTYSSGNKEDGRFTVQVDKSSKYISLFIRDSQPSDSATYLCAMS
Gorilla gorilla gorilla V1012 trav CYUI02000899.1 390905 GTRAQSVTQLDSQVPVFEEAPVELRCNYSSSVSVYLFWYVQYPNQGLQLLLKYLSGSTLVKGINGFEAEFKNSETSFHLRKPSVHISDVAEYFCAVS
Gorilla gorilla gorilla V1013 trav CYUI02000899.1 373057 GTRAQRVTQPEKLLSVFKGAPVELKCNYSYSGSPELFWYVQYPRQRLQLLLRHISRESIKGFTADLNKGETSFHLKKPFAQEEDSAMYYCALS
Gorilla gorilla gorilla V1014 trav CYUI02000899.1 365817 VNSQQGEEDPQALSIQEGENATMNCSYKTSINNLQWYRQNSCRGLVHLILIRSNEREKHSGRLRVTLDTSKKSSSLLITASRAADTASYFCATD
Gorilla gorilla gorilla V1015 trdv CYUI02000899.1 355759 SSMAQKVTQTQNEISVVEKEDVTLDCVYETRDTTYYLFWYKQPPSGELVFLVRQNSFDEQNEISGRYSWNFQKSTSSFNFTITASQVVDSAVYFCALSE
Gorilla gorilla gorilla V1016 trav CYUI02000899.1 322997 LSGEDQVTQSPEALRLQEGESSSLNCSYTVSGLRGLFWYRQDPGKGPEFLFTLYSAGEEKEKERLKATLTKKESFLHITAPKPEDSATYLCAVQ
Gorilla gorilla gorilla V1017 trav CYUI02000899.1 292777 VRGIQVEQSPPDLILQEGANSTLRCNFSDSVNNLQWFHQNPWGQLINLFYIPSGTKQNGRLSATTVATERYSLLYISSSQTTDSGVYFCAVEPQCSP
Gorilla gorilla gorilla V1018 trdv CYUI02000899.1 268423 SSVAQKVTQAQSSVSTSVRKAVTLNCLYETSQWSYYIFWYKQLPSKEMIFLIRQGSAEQNAKSGRYSVNFKKAAKSVALTISALQLEDSAKYFCALWE
Gorilla gorilla gorilla V1019 trav CYUI02000899.1 259124 VNSILNVGQSPQSLHVQEGDSTNFTCSFPSSNFYALHWYRWETAKSPEALFVMTLNGDEKKKGRISATLNTKEGYSYLYIKGSQPEDSATYLCAF
Gorilla gorilla gorilla V1020 trav CYUI02000899.1 251715 VNGQQVMQIPQYQHVQEGEDFTTYCNSSTTLSNIQWYKQRPGGHPVFLIQLVKNGEVKKQKRLTFQFGEAKKNSSLHITATQTTDVGTYFCA
Gorilla gorilla gorilla V1021 trav CYUI02000899.1 241360 TIIDAKTTQPTSMDCAEGRAANLPCNHSTISGNEYVYWYRQIHSQGPQYIIHGLKNNETNEMASLIITEDRKSSTLILPHATLRDTAVYYCIVRV
Gorilla gorilla gorilla V1022 trav CYUI02000899.1 232701 GTRAQSVTQLDGHITVSEEAPLELKCNYSYSGVPSLFWYVQYSSQSLQLLLKDLTEATQVKGIKGFEAEFKKSETSFYLRKPSTHVSDAAEYFCAVG
Gorilla gorilla gorilla V1023 trav CYUI02000899.1 217063 VSTQLLEQSPRFLSIQEGENLTVYCNSSSVFSSLQWYRQEPGEGPVLLVTVVTGGEVKKLKRLTFQFGDARKDSSLHITAAQPGDTGLYLCAG
Gorilla gorilla gorilla V1024 trav CYUI02000899.1 162751 IMGDAKTTQPNSMESYEEEPVHLPCNHSTISGTDYIHWYRQLPSQGPEYVIHGLTSNVNRMASLTIAEDRKSSTLILHRATLRDAAVYYCILR
Gorilla gorilla gorilla V1025 trav CYUI02000899.1 157991 VSSQELEQSPQSLIVQEGKNLTINCTSSKTLYGLYWYKQKYGEGLIFLMMLQKGGEEKSHEKITAKLDEKKQQSSLHITASQPSHAGIYLCGA
Gorilla gorilla gorilla V1026 trav CYUI02000899.1 135582 VSSEDKVVQSPLSLVVHEGDTVTLNCSYEVTNFRSLLWYKQEKKAPTFLFTLTSSGIEKKSGRLSSILDKKELFSILNITATQTRDSAIYLCAVE
Gorilla gorilla gorilla V1027 trav CYUI02000899.1 90282 SGTAQTVTQSQPEMSVQEAETVTLSCTYDTSESNYYLFWYKQPPSRQMILVIRQEAYKQQNATENRFSVNFQKAAKSFSLKISDSQLGDTAMYFCAFM
Gorilla gorilla gorilla V1028 trav CYUI02000899.1 81090 FSMAQTVTQSQPEMSVQEAETVTLSCTYDTSESDYYLFWYKQPPSRQMILVIRQEAYKQQNATENRFSVNFQKAAKSFSLKISDSQLGDAAMYFCAYR
Gorilla gorilla gorilla V1029 trav CYUI02000899.1 58266 LSGELKVGQNPLFLSTQEGKNYTIYCNYSTTSDRLYWYKQDPGKSLESLFVLLSNGAVKQEGRLMASLDTKARLSSLHITAAVHDLSATYFCAV
Gorilla gorilla gorilla V1033 igkv CYUI02000944.1 133640 ARCDIQVTQSPSSLSASVGDRVTITCRASQGISNELSWYQQKPGQAPTLLIYAASSLQSGVPSRFSGSGSGTDFTLTISSLQPEDIATYYCLQDYTTP
Gorilla gorilla gorilla V1034 igkv CYUI02000944.1 116543 SSGNIVMTQTPLSLPVTLGEPASISCRSSQSLKDSDHGFIYLYWYLQKPGQSPQLLIYFVSYRASGVPDRFSGSGSGTDFTLEISRVEAEDVGVYYCMQSRELP
Gorilla gorilla gorilla V1035 igkv CYUI02000944.1 104310 SSGDIVMTQTPLSLPVTPGQPASISCRSSQSLLHSNGYTYLDWYLQKPGQSPQLLIYTLSYRASGVPDRFSGSGSGTDFTLKISRVEAEDVGVYYCMQALQTP
Gorilla gorilla gorilla V1036 igkv CYUI02000944.1 76991 SSGDIVMTQTPLSLPVTPGQPASISCRSSQSLLDSDDGNTYLYWYLQKPGQSPQLLIYEVSNRASGVPDRFSGSGSGTDFTLKISRVEAEDVGVYYCMQSRELP
Gorilla gorilla gorilla V1037 igkv CYUI02000944.1 66521 ARCDIQMTQSPSSLSASVGDRVTITCRASQSVSNYLSWYQQKPGKAPKLLIYAASSLQSGVPSRFSGSGSGTDFTLTISSLQPEDFATYYCQHGYGTP
Gorilla gorilla gorilla V1038 igkv CYUI02000944.1 16266 ARCDIQMTQSPSSLSASVGDRVTITCRASQSISSYLNWYQQKPGKAPKLLIYAASSLQSGVPSRFSGSGSGTDFTFTISSLQPEDIATYYCQQYDNLP
Gorilla gorilla gorilla V1041 iglv CYUI02000979.1 971635 SWAQSVLTQPPSVSAAPGQKVTISCSGSSSNIGNNYVSWYQQLPGTAPKILIYDNNKRPSGISDRFSGSKSGTSATLGITGLQTGDEADYYCGTWDSSLSA
Gorilla gorilla gorilla V1042 iglv CYUI02000979.1 917943 SNSQAVVTQEPSLTVSPGGTVTLTCGSSTGAVTSGHYPYWFQQKPGQAPRTLIYDTSNKHSWTPARFSGSLLGGKAALTLSGAQPEDEAEYYCW
Gorilla gorilla gorilla V1043 iglv CYUI02000979.1 906715 SWAQSVLTQPPSASGTPGQRITISCSGSSSNIGSNTVNWYQQLPGTAPKLLIYSNNQRPSGIPDRFSGSKSGTSASLAISGLQSEDEADYYCAAWDDSLNG
Gorilla gorilla gorilla V1044 iglv CYUI02000979.1 744432 SWAQSALTQPPFVSRAPGQSVTISCTGTSSDVGDYDHVFWYQKRLSTTSRLLIYNVNTQPSGISDLFSGSKSGNMASLTISGLKSEVEANYHCSLYSSS
Gorilla gorilla gorilla V1045 iglv CYUI02000979.1 663646 SVASYELTQPSSVSVSPGQTARITCSGDVLAKKYARWFQQKPGQAPVLVIYKDSERPSGIPERFSGSSSGTTVTLTISGAQVEDEADYYCYSAADNN
Gorilla gorilla gorilla V1046 iglv CYUI02000979.1 645364 SEASYELTQPPSVSVSPGQTARITCSGDALPKQYAYWYQQKPGQSPVLVIYKDSERPSGIPERFSGSSSGTTVTLTISGVQAEDEADYYCLSADSSGTY
Gorilla gorilla gorilla V1047 iglv CYUI02000979.1 640387 SWAQSALTQPSSVSGSPGQSVTISCTGTSTDIGSYNTVSWYQQHPGKAPKLMIYDVRWRPSGVPDRFSGSKSGNTASLTISGLQAEDEADYYCCSYAGS
Gorilla gorilla gorilla V1048 iglv CYUI02000979.1 634001 SVASYELTQPSSVSVSPGQTARITCSGDVLAKNYAGWYQQKPGQAPVLVIYKDSERPSGIPERFSGSSSGTTVMLTISGVQAEDEADYYCLSADSSGNH
Gorilla gorilla gorilla V1049 iglv CYUI02000979.1 622906 SWAQSALTQPSSVSGSPGQSVTISCTGTSSDVGGYNYVSWYQQHPGKAPKLMIYEVSKRPSGVSNRFSGSKSGNTASLTISGLQAEDEADYYCSSYRSGET
Gorilla gorilla gorilla V1050 iglv CYUI02000979.1 616490 SVASCELTQLPSVSVSPGQTARITCSGDVLGENYADWYQQKPGQAPELVTYEDSERPPGIPERFSGSTSGNMTTLTISRVLTEDEADYYCLSRDEDN
Gorilla gorilla gorilla V1051 iglv CYUI02000979.1 600210 SVVSSELTQDPAVSVALGQTVRITCQGDSLRSYYASWYQQKPGQVPVLIIYGKNNRPSGIPDRFSGSSSGNTASLTITGAQEEDEADYYCNSWDSSGNH
Gorilla gorilla gorilla V1052 iglv CYUI02000979.1 584216 SWAQSALTQPPSVSGSPGQSVTISCTGTSSDIGGYNRASWYQQHPGKAPKLMIYEVSKRPSGVSNRFSGSKSGNTASLTISGLQAEDEADYYCSSYTSS
Gorilla gorilla gorilla V1053 iglv CYUI02000979.1 571413 SEASYELTQPPSVSVSLGQTARITCSGEELPKKYAYWYQQKPGQSPVLVIYKDSERPSGIPERFSGSSSGTTVTLTISGVQAEDEADYYCLSADSSDTY
Gorilla gorilla gorilla V1054 iglv CYUI02000979.1 560206 SWAQSALTQPASVSGSPGQSITISCTGTSSDVGGYNYVSWYQQHPGKAPKLMIYYVSNRPSGVSNRFSGSKSGNTASLTISGLQAEDEADYYCSSYTSS
Gorilla gorilla gorilla V1055 iglv CYUI02000979.1 557010 SVASYELTQPPAVSVSPGQTARISCSGDVLRDNYADWYLQQPGQAPVLVIYKDGERPSGIPESFSGSTSGNTTTLTISRVLTKGRADYYCFSGD
Gorilla gorilla gorilla V1056 iglv CYUI02000979.1 547005 SATSYELTQPHSVSVATAQTARITCGGNNIGSKAVHWYQQKPGQDPVLVIYSDSNRPSGIPERFSGSNSGNTATLTISRIEAGDEADYYCQVWDSSSDH
Gorilla gorilla gorilla V1057 iglv CYUI02000979.1 526674 SWAQSALTQPRSVSGSPGQSVTISCTGTSSDVGGYNYVSWYQQHPGTAPKLMIYEVSNRPSGVPDRFSGSKSGNTASLTISGLQAEDEADYYCCSYAGSYS
Gorilla gorilla gorilla V1058 iglv CYUI02000979.1 507305 SEASYELTQSPSVSVSPGQTARITCSGDALPKKYAYWYQQKPGQAPVLVIYEDSKRPSGIPERFSGSSSGTMATLPISGAQVEDEADYYCYSTDSSGNH
Gorilla gorilla gorilla V1059 iglv CYUI02000979.1 499828 SVASYELTQPLSVSVALGQTARITCGGNNTGSKNVHWYQQKPGQAPVLVIYRDSNRPSGIPERFSGSNSGNTATLTISRAQAGDKADYYCQVWDS
Gorilla gorilla gorilla V1060 iglv CYUI02000979.1 496314 SWAQSALIQPPSASGSPGQSVTISCTGTSSDIGGYNYVSWYQRHPGKAPKLMIYEVSNRPSGVPNLFSGSKSGNTASLTISGLQAEDEADYYCCSYAGSNN
Gorilla gorilla gorilla V1061 iglv CYUI02000979.1 438661 SVASYELTQPPSVSVSPGQTASITCSGDKLGDEYACWYQQKPGQSPVLVIYQDSKRPSGIPERFSGSNSGNTATLTISGTQAMDEADYYCQAWDS
Gorilla gorilla gorilla V1062 igkv CYUI02000983.1 40579 TRAETTLTQSPAFVSATPGDKVTISCKASQDIDDDMNWYQQKPGEAAIFIIQEATTLVSGIPPRFSGSGYGTDFTLTINNIESEDAAYYFCLQDDNFP
Gorilla gorilla gorilla V1086 ighv CYUI02001316.1 230944 VQCEVQLVESGGGLVQPGGSLRLSCAASGFTFSSYHMSWVRQAPGKGLEWVSVIYSDGSSTYYAASVKGRFTISRDNSKNTLYLQMNSLRAEDTAVYYCAR
Gorilla gorilla gorilla V1087 ighv CYUI02001316.1 213721 VQCEVQLVESGGGLVQPGGSLRLSCAASGFTFSSYAMHWVRQAPGKGLEWVSAIYSGGSTYYADSVKGRFTISRDNSKNTLYLQMGSLRAEDTAVYYCAR
Gorilla gorilla gorilla V1088 ighv CYUI02001316.1 160263 VLSQVQLQESGPGLVKPSQTLSLTCTVSGGSISSGSYYWSWIRQPPGKGLEWIGYIYYSGSTNYNPSLKSRVTISVDTSKNQFSLKLSSVTAADTAVYYCAR
Gorilla gorilla gorilla V1089 ighv CYUI02001316.1 155484 AHSQVQLVQSGPEVKKPGASVKVSCKASGYTFTSSAMQWVRQAPGQGLEWIGWIIVGSGNTNYAQKFQGRVTITRDTSTSTAYMELSSLRSEDMAVYYCAA
Gorilla gorilla gorilla V1090 ighv CYUI02001316.1 139464 ILSQVQLQESGPGLVKPSETLSLTCAVSGDSISSGNWWIWVRQPPGKGLEWIGEINHSGSTYYNPSLKSRITMSVDTSKNQFSLKLSSVTAADTAVYYCAR
Gorilla gorilla gorilla V1091 ighv CYUI02001316.1 124708 VQCEVQLVESGGGVVQPGRSLRLSCAASGFTFSSYWMHWVRQAPGKGLEWVSAIYSDGSSTYYAASVKGRFTISRDNSENTLYLQMNSLRAEDTAVYYCAR
Gorilla gorilla gorilla V1092 ighv CYUI02001316.1 110797 VCAEVQLVQSAAEVKRPGESLRISCKGSGYSFTSYWIGWVRQMPGKGLEWMGIIYPGDSDTRYSPSFQGQVTISADKSISTAYLQWSSLKASDTAMYYCA
Gorilla gorilla gorilla V1093 ighv CYUI02001316.1 89166 VQCEVQLVESGGGLVKPGGSLRLSCTASGFTFGDYTMSWVRQAPGKGLEWVGFIRSKAYGGTTEYAASVKSRFTISRDDSKSIAYLQMNSLKTEDTAVYYCTT
Gorilla gorilla gorilla V1094 ighv CYUI02001316.1 70130 VQCEVQLVESGGGLVKPGGSLRLSCAASGFTFSSYGMSWVRQAPGKGLEWVSVISSSGRTTYYADSVKGRFTISRDNAKNSLYLQMNSLRAEDTAVYYCGE
Gorilla gorilla gorilla V1095 ighv CYUI02001316.1 49226 AQCEVQLVESGGGLVQPGGSLRPSCAASGFAFSSYVLHWVRRAPGKGLEWVSAIGTGGDTYYADSVMGRFTISRDNAKKSLYLQMNSLIAEDMAVYYCAR
Gorilla gorilla gorilla V1096 ighv CYUI02001316.1 41695 AHSQVQLVQSGAEVKKPGASVKVSCKASGYTFTSYYMHWVRQAPGQGLEWMGIINPSGGSTSYAQKFQGRVTMTRDTSTSTVYMELSSLRSEDTAVYYCAR
Gorilla gorilla gorilla V1097 ighv CYUI02001316.1 37584 AHSQMQLVQSGAEVKKTGASVKVSCKASGYTFTYRSLHWVRQAPGQALEWMGWITPYNGNTNYAQKFQDRVTITRDRSMSTAYMELSSLRSEDTAVYYCAR
Gorilla gorilla gorilla V1099 ighv CYUI02001348.1 139650 VLSQVQLQESGPGLVKPSETLSLTCVVSGGSISSSNWWSWVRQPPGKGLEWIGEIYHSGSPNYNPSLKSRVTISVDKSKNQFSLKLSSVTATDTAVYYCAR
Gorilla gorilla gorilla V1100 ighv CYUI02001348.1 115320 AHSQVQLVQSGAEVKKPGASVKVSCKASGYTFTDYYMHWVRQAPGQGLEWMGRINPNSGGTNYTQKFQGRVTMTRDTSISTAYMELSRLRSEDTATYYCAR
Gorilla gorilla gorilla V1101 ighv CYUI02001387.1 116975 TYSQVQLVQSGHEVKQPGASVKVSCKASGYSFTSYGMNWVRQAPGQGLEWMGWFNTYTGNPTYAQGFTGRFVFSMDTSVSTAYLQISSLKAEDTAMYYCAR
Gorilla gorilla gorilla V1102 ighv CYUI02001387.1 115152 VLSQVQLQEWGPGLVKPSEALSLTCAVSGDSISSGNWWSWVRQSPGKGLEWIGYIYYSGRSYYNPSLKSRVTMSVDTSKNQFSLKLSSVTAADTAVYYCAR
Gorilla gorilla gorilla V1103 ighv CYUI02001387.1 53290 VQCEVQLLESGGGLVQPGGSLRLSCAASGFTFSSYWMHWVRQAPGKGLEWVSRINSDGSSTSYADSVKGRFTISRDNAKNTLYLQMNSLRAEDTAVYYCAR
Gorilla gorilla gorilla V1104 ighv CYUI02001387.1 45575 VQCEVQLVESGGGLVQPGGSLRLSCAASGFTFSGSAMHWVRQASGKGLEWVGRIRSKANSYATAYAASVKGRFTISRDDSKNTAYLQMNSLKTEGTAVYYCTA
Gorilla gorilla gorilla V1106 trbv CYUI02001408.1 142042 SMDTKVTQRPRLLVKANEQKAKMDCVPIKRHSYVYWYHKTLEEELKFLIYFQNEEIIQKAEIINERFSAQCPQNSPCTLEIQSTESGDTARYFCANSK
Gorilla gorilla gorilla V1107 trbv CYUI02001408.1 133115 CFHAKVTQTPGYLVKGKGRKTKMYCTPENGHTFVCWYQQNQNKEFMFLISFQNEQVLQETEMHKKRFSPQCPKNPPCSLAILSSEPGDTALYLCASSP
Gorilla gorilla gorilla V1108 trbv CYUI02001408.1 108969 LMEAEIYQTPRYHVIGTGKKITLECSQTMGHDKMYWSRSRNGITPHPPFPWVNSTEKGDLSSESTVSRIRIEHFPLTLESASPSHTSQYLCASSE
Gorilla gorilla gorilla V1111 ighv CYUI02001721.1 59604 VLSQVQLQQWGAGVVKPSETLSLTCAVYGGSFSGYYWNWIRQPPGKGLEWIGHISYDGSTNYNPSLKSRVTISVDTSKNQFSLKLSSVTAADTAVYYCAR
Gorilla gorilla gorilla V1112 ighv CYUI02001721.1 47112 VQCEVQLVESGGGVVQPGRSLTLSCAASGFTFSSYGMHWVRQAPGKGLEWVAVIWNDGSNKYYADSVKGRFTISRDNSKNTLYLQMNSLRAEDTAVYYCAK
Gorilla gorilla gorilla V1113 ighv CYUI02001721.1 22927 SGAAGGIWGGVVQPGRSLTLSCAASGFTFSSYGMHWVRQAPGKGLEWVAVIWNDASNKYYADSVKGRFTISRDNSKNTLYLQMNSLRAEDTAVYYCAK
Gorilla gorilla gorilla V1115 igkv CYUI02003154.1 20760 ARCDIQLTQSPSSLSASVGDRVTITCRASQGISNRLNWYQQKPGKAPRLLIYDASSLESGVPSRFSGSGSGTDFTLTISSLQPEDFATYYCQQFNSYP
Gorilla gorilla gorilla V1117 ighv CYUI02003213.1 4540 VLSQVTLKESGPVLVKPTETLTLTCTLSGFSLSTSGMGMSWIRQPPGKALEWLAHIFSNDKKSYSTSLKNRLIISKGTSKSQVVLTMTNMDPVDTATYYCAWR
Gorilla gorilla gorilla V1118 ighv CYUI02003453.1 25903 AAGGVWGGLVQPGGSLRLSCAASGFTFSNHYTSWVLQAPGKGLEWVSYISGDSDYTNYADSVKGRFTISRDNAKNSLYLRMNSLRAEDTAVYYCV
Gorilla gorilla gorilla V1120 igkv CYUI02003946.1 12346 AKCDIQMTQSPSTLSASVGDRVTITCRASQGISKWLAWYQQKPGKAPKLLIYAASSLESGVPSRFSGSGSGTEFTLTISSLQPDDFATYYCQQHSSTP
Gorilla gorilla gorilla V1127 ighv CYUI02007039.1 9948 VLSQVQLQQWGTGLVKPSETLSLTCAVYGGSISSDGYYWSWIRQPPGKGLEWIGYIYYSGSTYYNPSLKSRVTISVDTSKNQFSLKLSSVTAADTAVYYCAR
Gorilla gorilla gorilla V1128 ighv CYUI02007576.1 10302 VLSQLQLQESGPGLVKPSQTLSLTCTVSGGSISSGSYYWSWIRQPPGKGLEWIGSIYYSGGTYYNPSLKSRVTISVDTSKNQFSLKLSSVTAADTAVYYCAR
Gorilla gorilla gorilla V1130 ighv CYUI02008751.1 9665 VQCEVHLVQSGGGLVQPGGSLRLSCAGSGFTFSSHAMHWVRQAPGKGLEWVSAIGTGGGTYYADSVKGRFTISRDNAKNSLYLQMNSLRAEDMAVYYCAR
Gorilla gorilla gorilla V40 igkv CABD030011168.1 2363 AKCAIQMTQSPSSLPASTGDRVTITCQASQGIGSYLNWYQQKPGKSPKLLIYYASYLQSGIPSRFSGSGSGTDFTLTIDCLQPEDFATYYCEQSYGTP
Gorilla gorilla gorilla V41 igkv CABD030011169.1 2816 DRCDIQMTQSPSSLSASVGGRVTITCRASQGISNNLNWYQQKPGKTPKLLIYAASSLQSGIPSRFSDSGSGTDYTLTISSLQPEDFAAYYCQQSDSTP
Gorilla gorilla gorilla V43 igkv CABD030011440.1 6406 SSGDIVMTQTPLSLPVTLGQPASISCRSSQSLVHSDGNTYLNWIQQRPGQPPRLLIYKVSNRFSGVPDRFSGSGAGTDFTLKISRVEAEDVAVYYCTQG
Gorilla gorilla gorilla V44 igkv CABD030011443.1 3019 SRGEIVLTQSPDFQSVTPKEKVTITCRASQSIGSSLHWYQQKPDQSPKLLIKYASQSISGVPSRFSGSGSGTDFTLTINSLEAEDAATYYCQQSSSL
Gorilla gorilla gorilla V45 igkv CABD030011476.1 13377 ARCDIQMTQSPSSLSASVGDRVTITCRASQGISKWLAWYQQKPGKAPKRLIYAASSLESGVPSRFSGSGSGTEFTLTISSLQPEDFATYYCLQYNSYP
Gorilla gorilla gorilla V46 igkv CABD030011480.1 2523 TTGEIVMTQSPATLSLSPGERATLSCRASQSVSSYLTWYQQKPGQAPRLLIYGASTRATGIPARFSGSGSGTDFTLTISSLQPEDFAVYYCQQHSNWP
Gorilla gorilla gorilla V47 igkv CABD030011480.1 14997 ARCDIRMTQSPSSLSASVGDRVTITCRASQGIRNDLGWYQQKPGKAPKILIYAASSLQSGVPSRFSGSGSGTDFTLTISSLQPEDFATYYCLQDYNYP
Gorilla gorilla gorilla V48 igkv CABD030011482.1 3818 AKCDIQMTQSPSTLSASVGDRVTITCRASQGISKLLAWYQQKPGKAPKLLIYAASSLESGVPSRFSGSGSGTEFTLTISSLQPDDFATYYCQQHSSTP
Gorilla gorilla gorilla V49 igkv CABD030011484.1 4691 CNGDIVLTQSPASLAMSPGQRATITCRASECVSFLGINLIHWYQQKPGQPPKLLIYQASNKDIGVPARFSGSGSGTDFTLTINPVEANNTAKYYCLQSKNFP
Gorilla gorilla gorilla V65 igkv CABD030014738.1 4223 ARCDIQVTQSPSSLSASVGDRVTITCRASQGISNELSWYQQKPGQAPTLLIYAASSLQSGVPSRFSGSGSGTDFTLTISSLQPEDIATYYCLQDYTTP
Gorilla gorilla gorilla V103 trav CABD030023454.1 12026 MMTGTIETMGNISAEKGGSIILQCHLSSTTAQVTQVNWQQQDQLLAVCNADLGWHISPSFKDRVAPGPGLGLTLQSLTTNDTGEYFCIYHTYPDGT
Gorilla gorilla gorilla V195 trbv CABD030055580.1 32541 LTEPEVTQTPSHQVTQMGQEVILRCVPISNHLYFYWYRQILGQKVEFLVSFYNNKISEKAEIFDDQFSVERPDGSNFTLKIRSTKLEDSAMYFCASSE
Gorilla gorilla gorilla V196 trbv CABD030055580.1 40155 PLDTAVSQTPKYLVTQMGNDKSLKCEQNLGHDTMYWYKQDSKKFLKIMFSYNNKELIINETVPNRFSPKSPDKAHLDLHIKSLELGDSAVYFCASS
Gorilla gorilla gorilla V197 trbv CABD030055580.1 44775 PIDTEVTQTPKHLVMGMTNKKSLKCEQHMGHRAMYWYKQKAKKPPELMFVYSYEKLSVNESVPSRFSPECPNNSLLNLHLHALQPEDSALYLCASSQ
Gorilla gorilla gorilla V198 trbv CABD030055580.1 52626 PVEAGVTQTPRYLIKTRGQQVTLSCSPISGHRSVSWYQQTLGQGLQFLFEYFGETQRNKGNFPGRFSGRQFSNSRSEMNVSTLELGDSALYLCASSL
Gorilla gorilla gorilla V199 trbv CABD030055580.1 59871 PVNAGVAQTPKFQVLKTGQSMTLQCAQDMNHNSMYWYRQDPGMGLRLIYYSAAEGTTAKGEVPDGYNVSRLNKREFSLRLESAAPSQTSVYFCASSE
Gorilla gorilla gorilla V200 trbv CABD030055582.1 3199 PVNAGVTQTPKFHVLKTGQSMTLLCAQDMNHEYMYWYRQDPGMGLRLIHYSVGEGTTAKGEVPDGYNVSRLKKQNFLLGLESAAPSQTSVYFCASSY
Gorilla gorilla gorilla V201 trbv CABD030055584.1 7275 PLDTAVSQTPKYLVTQMGKKESLKCEQNLGHNAMYWYKQDSKKFLKTMFIYSNKEPILNETVPNRFSPDSPDKAHLNLHINSLELGDSAVYFCASSQ
Gorilla gorilla gorilla V202 trbv CABD030055584.1 10722 PMETGVTQTPRHLVMGMTNKKSLKCEQHLGHNAMYWYKQSAKKPLELMFVYSFKEQTENNSVPSRFSPECPNSSHLFLHLHALQPEDSALYLCASSQ
Gorilla gorilla gorilla V203 trbv CABD030055585.1 4881 PVDAGVTQTPKFQVLKTGQSMTLQCAQDMNHNYMYWYRQDPGKGLRLIHYSAGEGTTAKGEVPDGYNVSRLNTQNFLLRLELAARSQTSVYFCATSE
Gorilla gorilla gorilla V204 trbv CABD030055586.1 449 HTRAGVSQSPSNKVTEKGKDVVFRCDPISGHSVLYWYQQSLGQGLEFLIYFQGNSAPDKSGLPSDRFSAERTGGSVSTLTIQRTQQEDSAMYLCASSL
Gorilla gorilla gorilla V205 trbv CABD030055588.1 19768 PMIAGITQAPTSQILAAGRSMTLRCTQDMRHNAMYWYRQDLGLGLRLIHYSNTAGTTGKGEVPDGYSVSRANTDDFPLMLASAVPSQTSVYFCASSD
Gorilla gorilla gorilla V206 trbv CABD030055589.1 1173 HTGAGVSQTPSNKVTEKGKDVELRCDPISGHTALYWYRQSLGQGPEFLIYFQGTGATDDSGLPNDRFFAVRPEGSVSTLKIQRTEQGDSAVYLCASSL
Gorilla gorilla gorilla V207 trbv CABD030055589.1 6076 PVEAGATQSPTHLLKTRGQQVTLRCSPISGHSSVSWYQKAPGQGPQFIFEYANELRRLEGNFPNRFSGRQFHDYRSEMNVSALELGDSALYLCARSL
Gorilla gorilla gorilla V208 trbv CABD030055589.1 8808 PVDSGVTQTPKHLITATGQRVTLRCSPRSGDLSVYWYQQSLDQGLQFLIQYYNGEERAKGNILERFSAQQFPDSHSELNLSSLELGDSALYLCASSV
Gorilla gorilla gorilla V209 trbv CABD030055589.1 16821 HRDAEITQSPRHKITETGRQVTLACYQTWNHNNMFWYRQDLGHGLRLSHYSYGVQDTNKGEVSDGCSVSRSNTEDFPLTLESAASSQTSVYFCASSE
Gorilla gorilla gorilla V210 trbv CABD030055589.1 24569 FSEAEVAQSPRYKITEKSQAVAFWCDPISGHATLYWYWQILGQGPELLVRFQDESVVDDSQLPKDRFSAERLKGVDSTLKIQLAKLEDSAVYLCASSL
Gorilla gorilla gorilla V211 trbv CABD030055589.1 41577 PVNAGVTQTPKFQVLKTGQSMTLQCAQDMNHDYMYWYRQDPGMGLRLIHYSVGAGITDKGEVPNGYNVSRSNTEDFPLRLQSAAPSQTSVYFCASSY
Gorilla gorilla gorilla V212 trbv CABD030055589.1 45769 HTGAGVSQSPRYKVAKRGRDVALRCDSISGHVTLYWYRQTLGQGSEVLTYFRSDAQRDKSGRPSGRFSAERPERSVSTLKIQRTEQGDSAVYLCASSL
Gorilla gorilla gorilla V213 trbv CABD030055589.1 53702 SVETGVTQSPTHLIKTRGQQVTLRCSPQSGHNTVSWYQQALGQGPQLIFQYYREEENGRGNFSPRFSGRQFPNYSSELNVNALELDDSALYLCASSL
Gorilla gorilla gorilla V214 trbv CABD030055589.1 60161 AVNAGVTQTPKFRILKIGQSMTLQCAQDMNHNYMYWYQQDPGMGLKLIYYSVTAGITDKGEVPNGYNVSRSTTEDFPLRLESAAPSQTSVYFCASSY
Gorilla gorilla gorilla V215 trbv CABD030055590.1 1079 PVDAGVTQSPTHLIKTRGQQVTLRCSPQSGHNTVSWYQQALGQGPQFIFEYYEKEERGRGNFPDRFSARQFPNYSSELNVNALLLGDSALYLCASSL
Gorilla gorilla gorilla V216 trbv CABD030055590.1 10718 HTGAGVSQAPRFKVTKRGQDVALRCDPISGHVALYWYRQALGQGPEFLTYFNDEAQPDKSGMPNDRFSAERPEGSISTLTIQRTEQRDSAMYLCASSLARA
Gorilla gorilla gorilla V217 trbv CABD030055590.1 18585 LVDAGVTQSPTHLIKTRGQQVTLRCSPKSGHDTVSWYQQALGQGPQFIFQYYEEEERQRGNFPDRFSGHQFPNYSSELNVNALLLGDSALYLCASSL
Gorilla gorilla gorilla V218 trbv CABD030055590.1 33860 PANAGVTQTPKFHILKTGQSMTLQCAQDMNHGYMSWYRQDPGMGLRLIYYSAAAGTIDKGEVPNGYNVSRLNTEDFLLRPVSAAPSQTSVYFCASSY
Gorilla gorilla gorilla V219 trbv CABD030055590.1 38159 SISTDHTGAGVSQSPRYKVTKRGQDVTLRCDPISSHATLYWYQQALGQGPEFLTYFNYEAQPDKSGLPNDRFSAERPEGSNSTLTIQRTEQRDSAMYLCASSL
Gorilla gorilla gorilla V220 trbv CABD030055591.1 2758 PVDAGVTQSPTHLIKMRGQQVTLRCSPKSGHDTVSWYQQALGQGPQFIFEYYEKEERGRGNFPDRFSARQFPNYSSELNVNPLLMGDSALYLCASSL
Gorilla gorilla gorilla V221 trbv CABD030055591.1 12026 HADTGVSQDPRHKITKRGQNVTFRCDPISEHNQLYWYRQTLGQGPEFLTYFQNEAQLEKSRLLSDRFSAERPKGSFSTLEIQRTEQGDSAMYLCASSL
Gorilla gorilla gorilla V222 trbv CABD030055591.1 18581 SVAAGVIQSPRHLIKEKRETATLKCYPIPRHDTVYWYQQGPGQDPQFLISFYEKMQSDKGSIPDRFSAQQFSDYHSELNMSSLELGDSALYFCASSL
Gorilla gorilla gorilla V224 trbv CABD030055592.1 1499 HMDAGITQSPRHKVTEIGTPVTLRCHQTENHRYMYWYRQDPGHGLRLIHYSYGVKDTDKGEVSDGYSVSRSKTEDFLLTLESATSSQTSVYFCAISE
Gorilla gorilla gorilla V225 trbv CABD030055592.1 12182 LIEAGVVQSPRYKIIEKKQPVAFWCNPISGHNTLYWYRQNLGQGPELLIRYENEEAVDDSQLPKDRFSAERLKGVDSTLKIQPAELGDSAVYLCASSL
Gorilla gorilla gorilla V226 trbv CABD030055592.1 17784 HTDAGVIQSPRHEVTEMGQEVTLRCKPISGHNSLFWYRQTMMRGLELLIYFNNNVPIDDSGMPKDRFSAKMPNASFSTLKIQPSEPRDSAVYFCASSL
Gorilla gorilla gorilla V227 trbv CABD030055592.1 21096 HTDAGVIQSPRHEVTEMGQEVTLRCKPISGHNSLFWYRQTMMRGLELLIYFNNNVPIDDSAMPKDRFSAKMPNASFSTLKIQPSEPRDSAVYFCASSL
Gorilla gorilla gorilla V228 trbv CABD030055595.1 5897 LTDAGVTQTPRHKVTEMGQEVTMRCQPILGHNTVFWYRQTMMQGLELLAYFRNRDPLDDSGMPKDRFSAEIPDATLATLKIQPSGPRDSAVYFCASGL
Gorilla gorilla gorilla V229 trbv CABD030055595.1 12812 HIEAGVTQFPSHSVIEKGQTVTLRCDPISGHDNLYWYRRVMGKEIKFLLHFVKESKQDESGMPNNRFLAERTGGTYSTLKVQPAELEDSGVYFCASSQ
Gorilla gorilla gorilla V230 trbv CABD030055595.1 17938 HGDAMVIQNPRYQVTQFGKPVTLSCSQNLNHNIMYWYQQKSSQAPKLLFHYYDKDFNNEADTPDNFQSRRPNTSFCFLDISSPGLGDAAMYLCATSR
Gorilla gorilla gorilla V231 trbv CABD030055595.1 40786 LSNAGVMQNPRHLVRRRGQEARLRCSPMKGHSHVYWYRQLPEEGLKFMVYLQKENIIDESGMPKERFSAEFPKEGPSILRIQQAVRGDSAAYFCAS
Gorilla gorilla gorilla V232 trbv CABD030055595.1 43917 TVDGGITQSPKYLFRKEGQNVTLNCEQNLNHDAMYWYRQDPGQGLRLIYYSQIVNDFQKGDIAEGYSVSREKKESFPLTVTSAQKNPTAFYLCASSI
Gorilla gorilla gorilla V233 trbv CABD030055595.1 51776 GSGLGAVVSQHPSRVICKSGTSVKIECRCLDFQATTMFWYRQFPKQSLMLMATSNEGSKATYEQGVEKDKFLINHPNLTLSTLTVTSAHPEDSSFYICSAR
Gorilla gorilla gorilla V234 trbv CABD030055595.1 61764 STDTKVTQRPRLLVKASEQKAKMDCVPIKGHSYVYWYRKKLEEELKFLVYFQNEEIIQKAEIINERFLAQCSKNSSCTLEIQSTESGDTALYFCASSK
Gorilla gorilla gorilla V235 trbv CABD030055595.1 70824 SFHAKVTQTPGHLVKGKGQKTKMDCTPEKGHTFVYWYQQNQNKEFMLLISFQNEQVLQETEMHKKRFSSQCPSNTPCSLAILSSEPGDTALYLCASSQ
Gorilla gorilla gorilla V236 trbv CABD030055595.1 81577 SMDADVTQTPRNRITKTGKRIMLECSQTKGHDRMYWYRQDPGLGLRLIYYSFDVKDINKGEISDGYSVSRQAQAKFSLSLESATPNQTALYFCATSD
Gorilla gorilla gorilla V237 trbv CABD030055595.1 95614 LMEADIYQTPRYLVIGTGKKITLECSQTMGHDKMYWYQQDPGMELHLIHYSYGVNSTEKGGLSSESTVSRIRTEHFPLTLESARPSHTSQYLCASSE
Gorilla gorilla gorilla V238 trbv CABD030055596.1 2519 SMDADVTQTPRNRITKTGKRIMLECSQTKGHDRMYWYRQDPGLGLRLIYYSFDVKDINKGEISDGYSVSRQAQAKFSLSLESATPNQTALYFCATSD
Gorilla gorilla gorilla V239 trbv CABD030055596.1 16659 LMEADIYQTPRYLVIGTGKKITLECSQTMGHDKMYWYQQDPGMELHLIHYSYGVNSTEKGGLSSESTVSRIRTEHFPLTLESARPSHTSQYLCASSE
Gorilla gorilla gorilla V240 trbv CABD030055596.1 61224 PLEAQVTQNPRYLITVTGKKLTVTCSQNMNHEYMSWYRQDPGLGLRQIYYSINVEAIDKGDVPEGYNVSRKEKRNFPLILESPSPNQTSLYFCASSL
Gorilla gorilla gorilla V241 trbv CABD030055596.1 66529 LVDVKVTQSSRYLVKRMGEKVFLECVQDMDHENMFWYRQDPGLGLRLIYFSSDVKMKEKGDIPEGYSVSREKKERFSLILESTSTNQTSMYLCASSL
Gorilla gorilla gorilla V242 trbv CABD030055599.1 5932 SVFSAVISQKPSRDICQRGTSLTIQCQVDSQVTMMFWYRQQPGQSLTLIATANQGSEATYESGFIIDKFPISRPNLTFSTLTVSNMSPEDSSIYLCSVE
Gorilla gorilla gorilla V270 igkv CABD030061791.1 7597 ARCDIQMTQSPSSLSASVGGRVTITCRASQDISNNLNWYQQKPGKTPKLLIYAASSLQSGIPSRFSDSGSGTDYTLTISSLQPEDFAAYYCQQSDSTP
Gorilla gorilla gorilla V361 trdv CABD030091906.1 84241 RGMLCDKVTQSSPDQTVASGSEVVLLCTYDTVYSNPDLFWYRIRPDYSFQFVFYGDNSGSQAADFTQGRFSVKHILTQKAFHLVISPVRTEDSATYYCAF
Gorilla gorilla gorilla V392 ighv CABD030100548.1 38803 VQCEVQLVESEGGLVQPGGSLRLSCAASGFTFSSYNMHWVRQAPGKGLEWVSAIGTGGDTYYPGSVKGRFTISRENAKNSLYLQMNSLRAEDTAVYYCAR
Gorilla gorilla gorilla V472 iglv CABD030120237.1 69324 VDSQTVVTQEPSFSVSPGGTVTLTCGLSSGSVSTSYYPSWYQQTPGQAPRMLIYSTNTRSSGVPDRFFGSIIGNKAALTITGAQADDESDYYCVLYMGSGI
Gorilla gorilla gorilla V473 iglv CABD030120242.1 1019 SLSQPVLTQSSSASASLGSSVKLTCTLSSGHSSYIIAWQQQQPGKAPRYLMRLEGSGSYNKGNGIPDRFSGSSSGADRYLTISNLQSEDEADYYCQTWDS
Gorilla gorilla gorilla V474 iglv CABD030120244.1 3558 SWANFMLTQPHSVSESPGQTVTISCTRSSGSIASNYVQWYQQRPGSAPTTVIYEDNQRPSGVPDRFSGSIDSSSNSASLTISGLKTEDEADYYCQSYDSS
Gorilla gorilla gorilla V475 iglv CABD030120244.1 22463 SMVQAGLTQPPSVSKGLRQTATLTCTGNSNNVGNQGAAWLQQHQGHPPKLLSYRNNNRPSGISERFSASRSGNTASLTIIGLQPEDEPDYYCSAWDSSLS
Gorilla gorilla gorilla V476 iglv CABD030120268.1 12935 SWAQSVLTQPPSVSAAPGQKVTISCSGSSSNIGNNYVSWYQQLPGTAPKILIYDNNKRPSGISDRFSGSKSGTSATLGITGLQTGDEADYYCGTWDSSLSA
Gorilla gorilla gorilla V477 iglv CABD030120268.1 44036 SLSQPVLTQPTSLSASPGASARLTCTLRSGINLGTYRIYWYQQKPGSPPRYLLNYYSDSDKHQGSGVPSRFSGSKDASTNAGILVISGLQSEDEADYYCMI
Gorilla gorilla gorilla V478 iglv CABD030120272.1 1585 SWAQSVLTQPPSASGTPGQRVTISCSGSSSNIGSNTVNWYQQLPGTAPKLLIYDNNKRPSGVPDRFSGSKSGTSASLAISGLRSEDEADYYCAAWDDSLNG
Gorilla gorilla gorilla V479 iglv CABD030120273.1 7490 SNSQAVVTQEPSLTVSPGGTVTLTCGSSTGAVTSGHYPYWFQQKPGQAPRTLIYDTSNKHSWTPARFSGSLLGGKAALTLSGAQPEDEAEYYCW
Gorilla gorilla gorilla V480 iglv CABD030120273.1 18737 SWAQSVLTQPPSASGTPGQRITISCSGSSSNIGSNTVNWYQQLPGTAPKLLIYDNNKRPSGVPDRFSGSKSGTSASLAISGLQSEDEADYYCAAWDDSLNG
Gorilla gorilla gorilla V481 iglv CABD030120283.1 9450 SWAQSALTQPPFVSRAPGQSVTISCTGTSSDVGDYDHVFWYQKRLSTTSRLLIYNINTRPSGISDLFSGSKSGNVASLTISGLKSEVEANYHCSLYSSS
Gorilla gorilla gorilla V482 iglv CABD030120300.1 1310 SVASYELTQPSSVSVSPGQTARITCSGDVLAKNYAGWYQQKPGQAPVLVIYKDSERPSGIPERFSGSSSGTTVTLTISGAQVEDEADYYCYSAADNN
Gorilla gorilla gorilla V483 iglv CABD030120302.1 13888 SWAQSALTQPSSVSGSPGQSVTISCTGTSSDVGGYNYVSWYQQHPGKAPKLMIYEVSKRPSGVSNRFSGSKSGNTASLTISGLQAEDEADYYCSSYRSGET
Gorilla gorilla gorilla V484 iglv CABD030120302.1 20308 SVASCELTQLPSVSVSPGQTARITCSGDVLGENYADWYQQKPGQAPELVTYEDSERPPGIPERFSGSTSGNMTTLTISRVLTEDEADYYCLSRDEDN
Gorilla gorilla gorilla V485 iglv CABD030120302.1 28679 SVTSYELTQPPSVSVAPGQAARITCGGNNIGSKSVHWYQQKPGQAPVLVIYDDSDRPSGIPERFSGSNSGNTATLTISRVEAGDEADYYCQVWDSSSKH
Gorilla gorilla gorilla V486 iglv CABD030120302.1 36610 SVVSSELTQDPAVSVALGQTVRITCQGDSLRSYYASWYQQKPGQVPVLIIYGKNNRPSGIPDRFSGSSSGNTASLTITGAQEEDEADYYCNSWDSSGNH
Gorilla gorilla gorilla V487 iglv CABD030120303.1 2005 SWAQSALTQPPSVSGSPGQSVTISCTGTSSDIGGYNRASWYQQHPGKAPKLMIYEVSKRPSGVSNRFSGSKSGNTASLTISGLQAEDEADYYCSSYTSS
Gorilla gorilla gorilla V488 iglv CABD030120303.1 15404 SEASYELTQPPSVSVSLGQTARITCSGEELPKKYAYWYQQKPGQSPVLVIYKDSERPSGIPERFSGSSSGTTVTLTISGVQAEDEADYYCLSADSSGTY
Gorilla gorilla gorilla V489 iglv CABD030120303.1 26618 SWAQSALTQPASVSGSPGQSITISCTGTSSDVGGYNYVSWYQQHPGKAPKLMIYYVSNRPSGVSNRFSGSKSGNTASLTISGLQAEDEADYYCSSYTSS
Gorilla gorilla gorilla V490 iglv CABD030120303.1 29819 SVASYELTQPPAVSVSPGQTARISCSGDVLSDNYADWYLQQPGQAPVLVIYKDGERHSGIPESFSGSTSGNTTTLTISRVLTKGRADYYCFSGD
Gorilla gorilla gorilla V491 iglv CABD030120303.1 39825 SATSYELTQPHSVSVATAQTARITCGGNNIGSKAVHWYQQKPGQDPVLVIYSDSNRPSGIPERFSGSNSGNTATLTISRIEAGDEADYYCQVWDSSSDH
Gorilla gorilla gorilla V492 iglv CABD030120304.1 12358 SWAQSALTQPRSVSGSPGQSVTISCTGTSSDVGGYNYVSWYQQHPGTAPKLMIYEVSNRPSGVPDRFSGSKSGNTASLTISGLQAEDEADYYCCSYAGSYS
Gorilla gorilla gorilla V493 iglv CABD030120305.1 3615 SEASYELTQSPSVSVSPGQTARITCSGDALPKKYAYWYQQKPGQAPVLVIYEDSKQPSGIPERFSGSSSGTMATLTISGAQVEDEADYYCYSTDSSGNH
Gorilla gorilla gorilla V494 iglv CABD030120305.1 11113 SVASYELTQPLSVSVALGQTARITCGGNNTGSKNVHWYQQKPGQAPVLVIYRDSNRPSGIPERFSGSNSGNTATLTISRAQAGDKADYYCQV
Gorilla gorilla gorilla V495 iglv CABD030120305.1 14620 SWAQSALIQPPSASGSPGQSVTISCTGTSSDIGGYNYVSWYQRHPGKAPKLMIYEVSNRPSGVPNRFSGSKSGNTASLTISGLQAEDEADYYCCSYAGSNN
Gorilla gorilla gorilla V496 iglv CABD030120307.1 3585 SVASYELTQPPSVSVSPGQTASITCSGDKLGDEYAYWYQQKPGQSPVLVIYQDSKRPSGIPERFSGSNSGNTATLTISGTQAMDEADYYCQAWDS
Gorilla gorilla gorilla V521 igkv CABD030129457.1 2240 SSGDVVMTQSPLSLPVTLGQPASISCRSSQSLVYSDGNTYLNWFQQKPGQSPRRLIYKVSNRDSGVPDRFSGSGSGTDFTLKISRVEAEDVGVYYCMQG
Gorilla gorilla gorilla V522 igkv CABD030129458.1 8612 SSGDIVMTQTPLSLPVTPGQPASISCRSSQSLLDSDDGNTYLYWYLQKPGQSPQLLIYEVSNRASGVPDRFSGSGSGTDFTLKISRVEAEDVGVYYCMQSRELP
Gorilla gorilla gorilla V523 igkv CABD030129458.1 19095 ARCDIQMTQSPSSLSASVGDRVTITCRASQSVSNYLSWYQQKPGKAPKLLIYAASSLQSGVPSRFSGSGSGTDFTLTISSLQPEDFATYYCQHGYGTP
Gorilla gorilla gorilla V524 igkv CABD030129458.1 37706 ARCDIQLTQSPTSLSASVGDRVTITCQASQGISNNLAWYQQKPGKVPKLLIYSASSLQSGVPSRFSGSGSGTDFTLTISSLQPEDVATYYCQRTYNAP
Gorilla gorilla gorilla V585 igkv CABD030011447.1 29530 SSGDIVMTQTPLSLPVNPGQLASISCRSSQSLLHSNGYTYLHWYLQKPGKSPQLLIYRVSSHFSGVPDRFSGSGSGSDFTLKISWVEAEDVGVYYCMQA
Gorilla gorilla gorilla V586 igkv CABD030011447.1 12233 SRGDVVMTQSPAFLSVTPGEKVTITCQASEGIGNYLYWYQQKPDQAPKLLIKYASQSISGVPSRFSGSGSGTDFTFAISSLEAEDAATYYCQQGN
Gorilla gorilla gorilla V587 igkv CABD030011447.1 385 ARCDIQMTQSPSSLSASVGDRVTITCRASQGISKWLAWYQQKPGKAPKRLIYAASSLESGVPSRFSGSGSGTEFTLTISSLQPEDFATYYCLQYNSYP
Gorilla gorilla gorilla V588 igkv CABD030011451.1 2984 ARCAIRMTQSPSSLSASTGDRVTITCRASQGISSYLAWYQQKPGKAPKLLIYAASTLQSGVPSRFSGSGSGTEFTLTISCLQSEDFATYYCQQYYSYP
Gorilla gorilla gorilla V589 igkv CABD030011452.1 17789 VRFDIQMTQSPSFLSASVGDRVSITCRASDGISSDLAWYLQKPGKSPKLFLYDAKDLRPGVSSRFSGRGSGTDFTLTIISLKPEDFATYYCKQDFSYP
Gorilla gorilla gorilla V590 igkv CABD030011455.1 1915 TTGEIVMTQSPATLSVSPGERATLSCRASQSVSSYLAWYQQKPGQAPRLLIYDASNRATGIPARFSGSGSGTDFTLTISSLEPEDFAVYYCQQYNNW
Gorilla gorilla gorilla V591 igkv CABD030011456.1 6457 ARCAIQMTQSPSSLSASVGDRVTITCRASQGISSYLAWYQQKPGKAPKLLIYYASSLQSGVPSRFSGSGSGTDYTLTISSLQPEDFATYYCQQHSSTP
Gorilla gorilla gorilla V592 igkv CABD030011457.1 755 ARCDIQMTQSPSSVSASVGDRVTITCRASQGISNSLNWYQQKPGKAPRLLIYDASSLESGVPSRFSGSGSGTDFTLTISSLQPEDFATYYCQQFNSYP
Gorilla gorilla gorilla V593 igkv CABD030011484.1 34357 AYGDIVMTQSPESLAVSLGERVTINCKSSQSVLYSSNNKNYLAWYQQKPGQAPKLLIYWASTRQSGVPDRFSGSGSGTDFTLTISSLQAEDVAVYYCQQYYSTP
Gorilla gorilla gorilla V594 igkv CABD030011484.1 22636 TRAETTLTQSPAFVSATPGDKVTISCKASQDIDDDMNWYQQKPGEAAIFIIQEATTLVSGIPPRFSGSGYGTDFTLTINNIESEDAAYYFCLQDDNFP
Gorilla gorilla gorilla V700 igkv CABD030046099.1 1026 TTGEIVLTQSPATLSSSPGERATLSCRASQSVSSSYLAWYQQKPGQAPRLLIYDASSRATGIPDRFSGSGSGTDFTLTISRLEPEDFAVYYCQQYSNWP
Gorilla gorilla gorilla V721 trgv CABD030050821.1 34856 HLEQPQISSTKMLSKTARLECVVSGVTISATSVYWYRERPGEVIQFLVSISYDGTVRKESGIPSGKFEVDRIPETSTSTLTIHNVEKQDIATYYCALWE
Gorilla gorilla gorilla V722 trgv CABD030050821.1 942 TSGENLITQLVTSVTKKKGNTAFFECQIKSSTFKKNVCIHWYHQKPDRSLKRILYISSNENVVHEQGVSEERYEARKWQSDLSSSLRIHRVAEEDAGIYYCACW
Gorilla gorilla gorilla V723 trgv CABD030050823.1 5681 SQKSSNLEGRTKSVTRQTGSSAEITCDLTVTNTFYIHWYLHQEGKAPQRLLYYDVSTARDVLESGLSSGKYYTHTPRRWSWILRLQNLIENDSGVYYCATWD
Gorilla gorilla gorilla V724 trgv CABD030050823.1 1320 SQKSSNLEGRTKSVTRPPGSSAVITCDLPVENAAYIHWYLHQEGKAPQRLLYYDSYNSRVVLESGISREKYHAYASTGKSLKFIVENLIEHDSGVYYCATWE
Gorilla gorilla gorilla V725 trgv CABD030050826.1 2695 SQKSSNLEGRTKSVIRQTGSSAEITCDLDGGSTGYIHWYLHQEGKAPQRLQYYDSYNSKVVLESGVSPGKYYTYTSTRKNLRLILRNLIENDSGVYYCATWD
Gorilla gorilla gorilla V735 trbv CABD030055612.1 36593 VRSQTIHQWPATLVQPVGSPLSLECTVEGTSNPNLYWYRQAAGRGLQLLFYSAGIGQISSEVPQNLSASRPQDRQFILSSKKLLLSDSGFYLCAWS
Gorilla gorilla gorilla V758 trbv CABD030063008.1 17308 SVFSAVISQKPSRDICQRGTSMTIQCQVNSQVTMMFWYCQQPGQSVTLIATANQGSEATYESGFVIDKFPISCPNLTFSTLTVSNRSPEDSSIYLCSVE
Gorilla gorilla gorilla V759 trbv CABD030063023.1 38612 SMDTKVTQRPRLLVKANEQKAKMDCVPIKRHSYVYWYHKTLEEELKFLIYFQNEEIIQKAEIINERFSAQCPQNSPCTLEIQSTESGDTARYFCANSK
Gorilla gorilla gorilla V760 trbv CABD030063023.1 29670 CFHAKVTQTPGYLVKGKGRKTKMYCTPENGHTFVCWYQQNQNKEFMFLISFQNEQVLQETEMHKKRFSPQCPKNPPCSLAILSSEPGDTALYLCASSP
Gorilla gorilla gorilla V761 trbv CABD030063023.1 5526 LMEAEIYQTPRYHVIGTGKKITLECSQTMGHDKMYWSRSRNGITPHPPFLWVNSTEKGDLSSESTVSRIRIEHFPLTLESASPSHTSQYLCASSE
Gorilla gorilla gorilla V790 igkv CABD030071279.1 1753 ARCDIQMTQSPSSLSASVGDRVTITCQASQGISNNLNWYQQKPEKTPKLLIYAASSLQSGIPSRFSDSGSGTDYTLTISSLQPEDFATYYCQQSDSTP
Gorilla gorilla gorilla V858 trdv CABD030091906.1 131175 VMSAIELVPEHQTVTVSMGVPATLRCSMKGEAISNYYINWYRKTQDNTMTFIYREKDIYGPGFKDNFQGDIDIAKNLAVLKILAPSERDEGSYYCAC
Gorilla gorilla gorilla V859 trav CABD030091912.1 79191 SGTAQTVTQSQPEMSVQEAETVTLSCTYDTSESNYYLFWYKQPPSRQMILVIRQEAYKQQNATENRFSVNFQKAAKSFSLKISDSQLGDTAMYFCAFM
Gorilla gorilla gorilla V860 trav CABD030091912.1 69980 FSMAQTVTQSQPEMSVQEAETVTLSCTYDTSESDYYLFWYKQPPSRQMILVIRQEAYKQQNATENRFSVNFQKAAKSFSLKISDSQLGDAAMYFCAYR
Gorilla gorilla gorilla V861 trav CABD030091912.1 47154 LSGELKVGQNPLFLSTQEGKNYTLYCNYSTTSDRLYWYKQDPGKSLESLFVLLSNGAVKQEGRLMASLDTKARLSSLHITAAVHDLSATYFCAV
Gorilla gorilla gorilla V862 trav CABD030091912.1 30477 VSAAKNEVEQSPQDLTAQEGEFITINCSYSVGISVLHWLQQYPGGGIVSLFMLSSGKKKHGRLIATINIQEKHSSLHITASHPRDSAIYICAV
Gorilla gorilla gorilla V863 trav CABD030091913.1 34333 VSGQQLNQSPQSMFIQEGEGVSMNCTSSSIFNTWLWYKQDPGEGPVLLIALYKAGELTSNGRLTAQFGITRKDSFLNISASIPSDVGIYFCAG
Gorilla gorilla gorilla V864 trav CABD030091913.1 29556 VSSEDKVVQSPLSLVVHEGDTVTLNCSYEVTNFRSLLWYKQEKKAPTFLFMLTSSGIEKKSGRLSSILDKKELFSILNITATQTRDSAIYLCAVE
Gorilla gorilla gorilla V865 trdv CABD030091914.1 199961 SSMAQKVTQTQNEISVVEKEDVTLDCVYETRDTTYYLFWYKQPPSGELVFLVRQNSFDEQNEISGRYSWNFQKSTSSFNFTITASQVVDSAVYFCALSE
Gorilla gorilla gorilla V866 trav CABD030091914.1 167176 LSGEDQVTQSPEALRLQEGESSSLNCSYTVSGLRGLFWYRQDPGKGPEFLFTLYSAGEEKEKERLKATLTKKESFLHITAPKPEDSATYLCAVQ
Gorilla gorilla gorilla V867 trav CABD030091914.1 155218 VSSKQEVTQIPAALSVPEGENLVLNCSFTDSAIYSLQWFRQDPGKGLTSLLLIQSSQREQTSGRLNASLDKSSGHSTLYIAASQPGDSATYLCAV
Gorilla gorilla gorilla V868 trav CABD030091914.1 137068 VRGIQVEQSPPDLILQEGANSTLRCNFSDSVNNLQWFHQNPWGQLINLFYIPSGTKQNGRLSATTVATERYSLLYISSSQTTDSGVYFCAVEPQCSP
Gorilla gorilla gorilla V869 trdv CABD030091914.1 112682 SSVAQKVTQAQSSVSTSVRKAVTLNCLYETSQWSYYIFWYKQLPSKEMIFLIRQGSAEQNAKSGRYSVNFKKAAKSVALTISALQLEDSAKYFCALWE
Gorilla gorilla gorilla V870 trav CABD030091914.1 103383 VNSILNVGQSPQSLHVQEGDSTNFTCSFPSSNFYALHWYRWETAKSPEALFVMTLNGDEKKKGRISATLNTKEGYSYLYIKGSQPEDSATYLCAF
Gorilla gorilla gorilla V871 trav CABD030091914.1 95963 VNGQQVMQIPQYQHVQEGEDFTTYCNSSTTLSNIQWYKQRPGGHPVFLIQLVKNGEVKKQKRLTFQFGEAKKNSSLHITATQTTDVGTYFCA
Gorilla gorilla gorilla V872 trav CABD030091914.1 85597 TIIDAKTTQPTSMDCAEGRAANLPCNHSTISGNEYVYWYRQIHSQGPQYIIHGLKNNETNEMASLIITEDRKSSTLILPHATLRDTAVYYCIVRV
Gorilla gorilla gorilla V873 trav CABD030091914.1 76912 GTRAQSVTQLDGHITVSEEAPLELKCNYSYSGVPSLFWYVQYSSQSLQLLLKDLTEATQVKGIKGFEAEFKKSETSFYLRKPSTHVSDAAEYFCAVG
Gorilla gorilla gorilla V874 trav CABD030091914.1 61278 VSTQLLEQSPRFLSIQEGENLTVYCNSSSVFSSLQWYRQEPGEGPVLLVTVVTGGEVKKLKRLTFQFGDARKDSSLHITAAQPGDAGLYLCAG
Gorilla gorilla gorilla V875 trav CABD030091914.1 41229 VRSQQPVQSPQAVILREGEDAVINCSSSKALYSVHWYRQKHGEAPVFLMILLKGGEQKGHDKISASFNEKKQQSSLYLMASQLSYSGTYFCGAE
Gorilla gorilla gorilla V876 trav CABD030091914.1 6920 IMGDAKTTQPNSMESYEEEPVHLPCNHSTISGTDYIHWYRQLPSQGPEYVIHGLTSNVNRMASLTIAEDRKSSTLILHRATLRDAAVYYCILR
Gorilla gorilla gorilla V877 trav CABD030091914.1 2155 VSSQELEQSPQSLIVQEGKNLTINCTSSKTLYGLYWYKQKYGEGLIFLMMLQKGGEEKSHEKITAKLDEKKQQSSLHITASQPSHAGIYLCGA
Gorilla gorilla gorilla V878 trav CABD030091915.1 15434 GTRAQRVTQPEKLLSVFKGAPVELKCNYSYSGSPELFWYVQYPRQCLQLLLRHISRESIKGFTADLNKGETSFHLKKPFAQEEDSAMYYCALS
Gorilla gorilla gorilla V879 trav CABD030091915.1 8188 VNSQQGEEDPQALSIQEGENATMNCSYKTSINNLQWYRQNSGRGLVHLILIRSNEREKHSGRLRVTLDTSKKSSSLLITASRAADTASYFCATD
Gorilla gorilla gorilla V880 trav CABD030091917.1 139577 VWSQRKEEVEQDPGPFNVPEGATVAFNCTYSNSASQSFFWYRQDCRKEPKLLMSVYSSGNEDGRFTAQLNRASQYISLLIRDSQLSDSATYLCAV
Gorilla gorilla gorilla V881 trav CABD030091917.1 134131 GTRAQSVTQLDSHVSVSEGTPVLLRCNYSSSYSPSLFWYVQHPNKGLQLLLKYTSRATLVKGINGFEAEFKKSETSFHLTKPSAHMSDAAEYFCAVS
Gorilla gorilla gorilla V882 trav CABD030091917.1 128364 TARAQSVTQPDIHITVSEGASLELRCNYSYGATPYLFWYVQSPGQGLQLLLKYFSGDTLVQGIKGFEAEFKRSQSSFNLRKLSVHWSDAAEYFCAVG
Gorilla gorilla gorilla V883 trav CABD030091917.1 110612 VNGENVEQHPSTLSVQEGDSAVIKCTYSDSASNYFPWYKQELGKGPQLLIDIRSNVGEKKDQGITVTLNKTAKHFSLHITETQPEDSAVYFCAAS
Gorilla gorilla gorilla V884 trav CABD030091917.1 91273 VWSQQKEVEQNSGPLSVPEGAIASLNCTYSDRRSQSFFWYRQYSGKSPELIMSIYSNGDKEDGRFTAQLNKASQYVSLLIRDSQPSDSATYLCAV
Gorilla gorilla gorilla V885 trav CABD030091917.1 84770 GTRAQSVTQLASHVSVSEGALVLLRCNYSSSVPPYLFWYVQYPNQGLQLLLKYTSGATLVKGINGFEAEFKKSETSFHLTKPSAHVSDAAEYFCAVS
Gorilla gorilla gorilla V886 trav CABD030091917.1 78140 LKFLSFVLCPFISQASQNLGKIEKNLCDYRGRFPDTATPSLFWHVQSPGQGLQLLLKYFSGDTLVQGIEGFEAEFKRSQSSFNLRRPSVHWSDAAEYFCAVG
Gorilla gorilla gorilla V887 trav CABD030091917.1 63963 VSRGESVGLHLPTLSVQEGDNSIINCAYSNSASDYFIWYKQESGKGPQFIIDIRSNMDKRQGQRVTVLLNKTVKHLSLQIAATQPGDSAVYFCAEN
Gorilla gorilla gorilla V888 trav CABD030091917.1 58036 PGIAQKITQTQPGMFMQEKEAVTLDCTYDTSDQSYGLFWYKQPSSGEMIFLIYQGSYDQQNATEGRYSLNFQKARKSANLVISASQLGDSATYFCAMRE
Gorilla gorilla gorilla V889 trav CABD030091917.1 41219 RTRGDSVTQMEGPVTLSEEAFLTINCTYTATGYPSLFWYVQYPGEGLQLLLKATKADDKGSNKGFEATYHKETTSFHLEKDSVQASDSAVYFCALS
Gorilla gorilla gorilla V890 trav CABD030091917.1 16847 VWSQQKEVEQDPGPLSVPEGAIASLNCTYSNSAFQYFMWYRQYSRKGPELLMYTYSSGNKEDGRFTVQVDKSSKYISLFIRDSQPSDSATYLCAMS
Gorilla gorilla gorilla V891 trav CABD030091917.1 3864 GTRAQSVTQLDSQVPVFEEAPVELRCNYSSSVSVYLFWYVQYPNQGLQLLLKYLSGSTLVKGINGFEAEFKNSETSFHLRKPSVHISDVAEYFCAVS
Gorilla gorilla gorilla V892 trav CABD030091918.1 1018 GSGKNQVEQSPQSLIILEGKNCTLRCNYTVSPFNNLRWYKQDTGRGPVSLTIMTFSENTKSNGRYTATLDADTKQSSLHITASQLSDSASYICVVS
Gorilla gorilla gorilla V893 trav CABD030091919.1 15607 DARAQSVSQHNHHVILSEVASLELRCNYSYGGTVNLFWYVQYPGQHLQLLLKYFSGDPLVKGIKGFEAEFIKSKFSFNLRKPSVQWSDTAEYFCAMN
Gorilla gorilla gorilla V894 trav CABD030091919.1 1473 GINGDSVVQTEGQVLLSEGDSLIVNCSYETTQYPSLFWYVQYPGEGPQLLLKAMKANDKGRNKGFEATYHKETTSFHLEKDSVQESDSAVYFCALS
Gorilla gorilla gorilla V895 trav CABD030091920.1 16646 VKSQKIEQNSEALNIQEGKTATLTCNYTNYSPAYLQWYRQDPGRGPVFLLLIRENEKEKRKERLKVTFDTTLKQSLFHITASQPADSATYLCAL
Gorilla gorilla gorilla V896 trav CABD030091920.1 2277 ANGENQVEHSPHFLGPRQGDIASMSCTYSVSRFNNLPWYRQNTGMGPKHLLSMYSAGYEKQKGRLNATLLKNGSSLYITAVQPEDLATYFCAVD
Gorilla gorilla gorilla V897 trav CABD030091922.1 16012 TLSLAKTTQPISMDSYEGQEVNITCSHNNIATNDYITWYQQFPSQGPRFIIQGYKTNVTNEVASLFIPADRKSSTLSLPRVSLSDTAVYYCLVG
Gorilla gorilla gorilla V898 trav CABD030091922.1 3314 MSRGEDVEQSLFLSVQEGDSSIIKCTYTDSSSTYLYWYKQEPGAGLQLLMYIFSNMDMKQDQRLTVLLNKKDKHLSLRIADTQTGDSAIYFCAES
Gorilla gorilla gorilla V899 trav CABD030091923.1 2004 GLRAQSVAQPEDQVTVAEGNPLTVKCTYSVSGNPYLFWYVQYPNQGLKFLLKYITGDNLVKGSYGFEAEFNKSQTSFHLKKPSALVSDSALYFCAVR
Gorilla gorilla gorilla V900 trav CABD030091925.1 57599 MYLVLGTTGQNTDQPTEMTATEGAIVQINCTYQTFGFNGLFWYQQHAGKAPTFLSYNVLDGLEEKGRFSSFLSRSKVYSYLLLKELQMKDAASYLCAVR
Gorilla gorilla gorilla V901 trav CABD030091926.1 10047 TAGQSLEQPSEVTAVEGATVQINCTYQTSGFYGLSWYQQHDGGAPTFLSYNALDGLEETGHFSSFLSRSDSYGYLLLQELQMRDSASYFCAVR
Gorilla gorilla gorilla V913 ighv CABD030094444.1 14785 VLSQVQLQQSGPGLVKPSQTLSLTCAISGDSVSSSSAAWNWIRQSPSRGLEWLGRTYYRSKWYNDYAVSVQSRITINPDTSKNQFSLQLNSVTPEDTAVYYCAR
Gorilla gorilla gorilla V914 ighv CABD030094452.1 2621 AHSQVQLVQSGAEVKKPGASVKVSCKASGYIFTGYAMHWVRQAPGQRLEWMGWINTGNGNTKYSQKFQGRVTITRDTSASTAYMELSSLRSEDTAVYYCAR
Gorilla gorilla gorilla V915 ighv CABD030094454.1 9007 VLSQITLKESGPTLVKPTQTLTLTCTFSGFSLSTSGTSVSWIRQPPGKALEWLAAIYSDDDKRYSPSLKSRLTITKDTSKNQVVLTMTNMDPVDTATYYCAHR
Gorilla gorilla gorilla V916 ighv CABD030094458.1 19730 VQCEVQLVESGGGLVQPGRSLRLSCVASGFTFDDYAMHWVRQAPGKGLEWVSGISWNSGSTGYADSVKGRFTISRDNAKNSLYLQMNSLRAEDTALYYCAKD
Gorilla gorilla gorilla V917 ighv CABD030094458.1 6554 VHSQVQLVQSGAEVRKPGSSVKVSCKASGYTFTSYDINWVRQAPGQGLEWMGWMNPNSGNTGYAQKFQGRVTMTRNTSTSTAYMELSSLRSEDTAVYYCAR
Gorilla gorilla gorilla V918 ighv CABD030094460.1 9746 VQCEVQLVESEGGLVQPGGSLRLSCAASGFTFSSYNMHWVRQAPGKGLEWVSAIGTGGDTYYPGSVKGRFTISRENAKNSLYLQMNSLRAEDTAVYYCAR
Gorilla gorilla gorilla V919 ighv CABD030094474.1 10536 VQCEVQLVESGGGLVQPGGSLRLSCAASGFTFDDYGMSWVRQAPGKGLEWVSGINWNGGSTGYADSVKGRFTISRDNAKNSLYLQMNSLRAEDTALYYCAR
Gorilla gorilla gorilla V920 ighv CABD030094476.1 5323 VQCEVQLVESGGGLVKPGGSLRLSCAASGFTFSSYWMSWVRQAPGKGLEWVSVISSSGRTTYYADSVKGRFTISRDNAKNSLYLQMNSLRAEDTAVYYCAR
Gorilla gorilla gorilla V921 ighv CABD030094477.1 1569 VQCDVQLVESGGGLVQPGGSLRLSCAASGFTFSSYWMSWVRQAPGKGLEWVSYISSSSSYIYYADSVKGRFTISRDNAKNSLYLQMNSLKTEDTAVYYCAR
Gorilla gorilla gorilla V922 ighv CABD030094478.1 19062 AQCEVQLVESGGGLVKPGGSLRLSCAASGFTFSNYYMEWVRQAPGKGLEWVGFIRTKAKGGTTEYAASVKGRFTISRDDSKSIAYLQMNSLKTEDTAVYYCTR
Gorilla gorilla gorilla V923 ighv CABD030094480.1 8119 ARAEVQLVQSGAEVKKPGASVKVSCKVSGYTLTELSMHWVRQASRKGLEWMGGFDPEDGETIYAQKFQGRVTMTEDTSTDTAYMELSSLRPEDMAVYYCAT
Gorilla gorilla gorilla V924 ighv CABD030094483.1 8264 VLSQVTLKESGPVLVKPTETLTLTCTVSGFSLSNARMGVSWIRQPPGKALEWLAHIFSNDEKSYSTSLKSRLTISKDTSKSQVVLTMTNMDPVDTATYYCAWI
Gorilla gorilla gorilla V925 ighv CABD030094488.1 8741 VLSQVQLQQWGPGLVKPSETLSLTCAVYGGSISSSDYYWSWIRQPPGKGLEWIGLINYVRSTNYNPSLKSRVTISVDTSKNQFSLKLSSVTAADTAVYYCAR
Gorilla gorilla gorilla V926 ighv CABD030094489.1 781 VLSQVQLQQWGTGLVKPSETLSLTCAVYGGSISSDGYYWSWIRQPPGKGLEWIGYIYYSGSTYYNPSLKSRVTISVDTSKNQFSLKLSSVTAADTAVYYCAR
Gorilla gorilla gorilla V927 ighv CABD030094491.1 5198 VQCQVQLVESAGGVVQPGRSLTLSCTASGFTFSSYGMHWVRQAPGKGLEWVAVISYDASNKYYAASVKGRFTISRDNSKNTLYLQMNSLRAEDTAVYYCAK
Gorilla gorilla gorilla V928 ighv CABD030094493.1 15089 VLSQVQLQQWGAGVVKPSETLSLTCAVYGGSFSGYYWNWIRQPPGKGLEWIGRISYDGSTNYNPSLKSRVTISVDTSKNQFSLKLSSVTAADTAVYYCAR
Gorilla gorilla gorilla V929 ighv CABD030094493.1 1714 VQCQVQLVESGGGVVQPGRSLTLSCTASGFTFSSYGMHWVRQAPGKGLEWVAVISYDASNKYYADSVKGRFTISRDNSKNTLYLQMNSLRAEDTAVYYCAK
Gorilla gorilla gorilla V930 ighv CABD030094498.1 7633 VLSQVQLQESGPGLVKPSETLSLTCVVSGGSISSSNWWSWVRQPPGKGLEWIGEIYHSGSPNYNPSLKSRVTISVDKSKNQFSLKLSSVTATDTAVYYCAR
Gorilla gorilla gorilla V931 ighv CABD030094500.1 7593 VQCEVQLVESGGGLVQPEGSLKLSCAASGFTFSSYAMDWVRQAPGKGLEWVAHIWNDGSQKYYADSVKGRFTISRDNSKSMLYLQMDSLKAEDTAMYYCT
Gorilla gorilla gorilla V932 ighv CABD030094502.1 11106 VQCEVQLVESGGGVVQPGRSLRLSCAASGFTFDDYAMHWVRQAPGKGLEWVSRISWGGGSTYYADSVKGLFTISRDNSKISLYLQMNSLRAEDTALYYCAKD
Gorilla gorilla gorilla V933 ighv CABD030094504.1 37478 AQCEVQLVESGGGLVQPGGSLRPSCAASGFAFSSYVLHWVRRAPGKGLEWVSAIGTGGDTYYADSVMGRFTISRDNAKKSLYLQMNSLIAEDMAVYYCAR
Gorilla gorilla gorilla V934 ighv CABD030094504.1 29944 AHSQVQLVQSGAEVKKPGASVKVSCKASGYTFTSYYMHWVRQAPGQGLEWMGIINPSGGSTSYAQKFQGRVTMTRDTSTSTVYMELSSLRSEDTAVYYCAR
Gorilla gorilla gorilla V935 ighv CABD030094504.1 25832 AHSQMQLVQSGAEVKKTGASVKVSCKASGYTFTYRSLHWVRQAPGQALEWMGWITPYNGNTNYAQKFQDRVTITRDRSMSTAYMELSSLRSEDTAVYYCAR
Gorilla gorilla gorilla V936 ighv CABD030094505.1 13562 VQCDVQLVQSGGGLVQPGGSLRLSCAASGFTFSSYWMHWVRQAPGKGLEWVANIKKDGSGKYYVDSVKGRFTISRDNAKNSLYLQMNSLRAEDTAVYYCAR
Gorilla gorilla gorilla V937 ighv CABD030094506.1 40145 VCAEVQLVQSAAEVKRPGESLRISCKGSGYSFTSYWIGWVRQMPGKGLEWMGIIYPGDSDTRYSPSFQGQVTISADKSISTAYLQWSSLKASDTAMYYCA
Gorilla gorilla gorilla V938 ighv CABD030094506.1 18458 VQCEVQLVESGGGLVKPGGSLRLSCTASGFTFGDYTMSWVRQAPGKGLEWVGFIRSKAYGGTTEYAASVKSRFTISRDDSKSIAYLQMNSLKTEDTAVYYCTT
Gorilla gorilla gorilla V939 ighv CABD030094508.1 5537 VQCEVQLVESGGGLVQPGGSLRLSCVASGFTFSSYAMSWVRQAPGKGLEWVSTISSTGGSTWYPGSVKGRFTISRDNSKNTLYLQMNSLRAEDTAVYYCAK
Gorilla gorilla gorilla V940 ighv CABD030094510.1 26653 VLSQVQLQESGPGLVKPSQTLSLTCTVSGGSISSGSYYWSWIRQPPGKGLEWIGYIYYSGSTNYNPSLKSRVTISVDTSKNQFSLKLSSVTAADTAVYYCAR
Gorilla gorilla gorilla V941 ighv CABD030094510.1 21866 AHSQVQLVQSGPEVKKPGASVKVSCKASGYTFTSSAMQWVRQAPGQGLEWIGWIIVGSGNTNYAQKFQGRVTITRDTSTSTAYMELSSLRSEDMAVYYCAA
Gorilla gorilla gorilla V942 ighv CABD030094510.1 5840 ILSQVQLQESGPGLVKPSETLSLTCAVSGDSISSGNWWIWVRQPPGKGLEWIGEINHSGSTYYNPSLKSRITMSVDTSKNQFSLKLSSVTAADTAVYYCAR
Gorilla gorilla gorilla V943 ighv CABD030094512.1 20887 VQCEVQLVESGGGLVQPGGSLRLSCAASGFTFSSYHMSWVRQAPGKGLEWVSVIYSDGSSTYYAASVKGRFTISRDNSKNTLYLQMNSLRAEDTAVYYCAR
Gorilla gorilla gorilla V944 ighv CABD030094512.1 3812 VQCEVQLVESGGGLVQPGGSLRLSCAASGFTFSSYAMSWVRQAPGKGLEWVSVIYSGGSTYYADSVKGRFTISRDNSKNTLYLQMSSLRAEDTAVYYCAR
Gorilla gorilla gorilla V945 ighv CABD030094517.1 1018 VHSQVQLVQSGAEVKKPGSSVKVSCKLSGGTFSSYAISWVRQAPGQGLEWMGGFIPILGTANYAQKFQGRVTITADESTSTAYMELSSLRSEDTAVYYCAR
Gorilla gorilla gorilla V946 ighv CABD030094518.1 23338 VQCEVQLLESGGGLVQPGGSLRLSCAASGFTFSDHYMDWVRQAPGKGPEWVGRIRNKANSYTTEYAASVKGRFTISRDDSKNSLYLQMNSLKTEDTAVYYCTT
Gorilla gorilla gorilla V947 ighv CABD030094518.1 7808 VQCEVQLVESGGGLVQPGGSLRLSCAASGFTFSNYYKSWVCQAPGKGLEWVRFIRNKANGGTTEYTTSVKGRFTISRDDSKSITYLQMNSLKTEDTAVYYCSR
Gorilla gorilla gorilla V948 ighv CABD030094518.1 3231 VLSQVTLKESGPALVKPTQTLTLTCTFSGFSLSTSGMSVGWIRQPLGKALEWLARIDWDDDKYYSPSLKSRLTISKDTSKNQVVLTMTNMDPVDTATYYCARI
Gorilla gorilla gorilla V949 ighv CABD030094519.1 13264 VQCEVQLLESGGGLVQPGGSLRLSCAASGFTFSSYWMHWVRQAPGKGLEWVSRINSDGSSTSYADSVKGRFTISRDNAKNTLYLQMNSLRAEDTAVYYCAR
Gorilla gorilla gorilla V950 ighv CABD030094519.1 5543 VQCEVQLVESGGGLVQPGGSLRLSCAASGFTFSGSAMHWVRQASGKGLEWVGRIRSKANSYATAYAASVKGRFTISRDDSKNTAYLQMNSLKTEGTAVYYCTA
Gorilla gorilla gorilla V951 ighv CABD030094533.1 13410 AHSQVQLVQSGAEVKKPGASVKVSCKASGYTFTSYGISWVRQAPGQGLEWMGWIDAYYGNTNYAQKLQGRVTMTTDTSTRTAYMELRRLRSDDTAVYYCAR
Gorilla gorilla gorilla V952 ighv CABD030094534.1 11784 VQCEVQLVESGGGLVQPGGSLRLSCAASGFTFSDHYRSWVRQAQGKGLELVGLIRNKANSYTTEYAASVKGRFTISRGDSKNTLYLQMSSLKTEDLAVYYCAR
Gorilla gorilla gorilla V953 ighv CABD030094717.1 926 AHSQVQLVQSGAEVKKPGASVKVSCKASGYTFTDYYMHWVRQAPGQGLEWMGRINPNSGGTNYTQKFQGRVTMTRDTSISTAYMELSRLRSEDTATYYCAR
Gorilla gorilla gorilla V954 ighv CABD030094718.1 903 AHSQVQLVQSGAEVKKPGASVKVSCKASGYTFTGYYMHWVRQAPGQGLEWMGWINPNSGGTNYAQKFQGRVTMTRDTSISTAYMELSRLRSEDTATYYCTR
Gorilla gorilla gorilla V982 ighv CABD030100548.1 24559 VQCEVHLVQSGGGLVQPGGSLRLSCAGSGFTFSSHAMHWVRQAPGKGLEWVSAIGTGGGTYYADSVKGRFTISRDNAKNSLYLQMNSLRAEDMAVYYCAR
Gorilla gorilla gorilla V983 ighv CABD030100548.1 10432 AQCEVQLVESGGGLVQPGGSLRLSCAASGFTFSNHYTSWVLQAPGKGLEWVSYISGDSDYTNYADSVKGRFTISRDNAKNSLYLRMNSLRAEDTAVYYCV
Gorilla gorilla gorilla V984 ighv CABD030100747.1 10809 VLSQVTLKESGPVLVKPTEILTLTCTLSGFSLSTSGMGMSWIRQPPGKALEWLAHIFSNDKKSYSTSLKNRLIISKGTSKSQVVLTMTNMDPVDTATYYCAWR
Gorilla gorilla gorilla V1046 trav CABD030115254.1 160979 TSDEEFQVNQPQTLVSVNPGDVLTLACNMSALSPEGPVLWFKSTGPGQQLIYSFNGSHFPRVTPVENTMVDQTDYSIRISDVLPEDAGTYYCVKLRV
Gorilla gorilla gorilla V1090 igkv CABD030129462.1 780 SSADIVMTQTPLSLPVTPGQPASISCKSSQSLLHSDGKTYLYWYLQKPGQSPQLLIYEVSNRASGVPDRFSGSGSGTDFTLKISRVEAEDVRVYYCMQGIQLP
Gorilla gorilla gorilla V1091 igkv CABD030129466.1 2953 ARCDIQMTQSPSSLSASVGDRVTITCRASQSISSYLNWYQQKPGKAPKLLIYAASSLQSGVPSRFSGSGSGTDFTFTISSLQPEDIATYYCQQYDNLP
Gorilla gorilla gorilla V1092 igkv CABD030129493.1 14201 ARCDIQMTQSPSSLSASVGGRVTITCRASQGISNNLNWYQQKPGKTPKLLIYAASSLQSGIPSRFSDSGSGTDYTLTISSLQPEDFAAYYCQQSDSTP
Gorilla gorilla gorilla V1094 ighv CABD030130603.1 11196 AHSQVQLVQSGSEVKKPGASVKVSCKASGYTFTSYGMNWVRQAPGQGLEWMGWINTNTGNPTYAQGFTGRFVFSLDTSVSTAYLQISSLKAEDTAVYYCAR
Gorilla gorilla gorilla V1106 trgv CABD030156525.1 578 GDTKMRVSQDQLSTRRQDRTVHKRCKLSGVPLENTVVHWYQQQEGEPLRRILYGSAKNYKQDRPNPRLEADDKHDGIFYLIINNVAKSDEATYYCACWDLIM