WGS Statistics
Organism WGS Record. Vs Total IGHV IGLV IGKV TRAV TRBV TRGV TRDV
Tursiops truncatus MRVK000000000.1 (MRVK01) 26 4 8 0 2 10 0 2
Tursiops truncatus ABRN00000000.2 (ABRN02) 34 2 10 2 7 9 1 3
Vgene Table
Organism Vgene Locus contig Contig Pos. AA sequence
Tursiops truncatus V1 iglv MRVK01000006.1 16790 SVASYELTQPPSVSVALGQTSKITCSGDLLDKKYTYWYQQKPGQAPVLVIYEDSKRPSGIPDRFSGSSSGKIATLTISRAQAEDEADYYCKSADSSDY
Tursiops truncatus V2 iglv MRVK01000006.1 19307 LCAVPVLAQTPSASSSLGGSAKLTCTLNSEHSTYYIEWYQQRVGQAPRYLMKLTSDGSVTKGDGIPDRFSGSSSGADRYLTIANIQSEDETEYICGVNY
Tursiops truncatus V3 iglv MRVK01000006.1 21768 SVASSELTQPPAVSVSLGQTARITCQGDSLGSGYAQWYQQKPGQAPMLVIYGDSNLESGIPDRFSGSKSGKIATLTISRAQAEDEADYYCGSADSSDY
Tursiops truncatus V45 trbv MRVK01000194.1 367321 ASADTEITQIPKYLIMETRNKKSLICEQRLGHNAMYWYKQRAQKPPELMFIYNYQELAGNETVPSRFRPECPDSSRIYLHVDTLKLEDSALYLCASSK
Tursiops truncatus V46 trbv MRVK01000194.1 390381 GPRDAAVTQKPRYHIIRAGSKMVLDCSQDMNHVGMFWYRQDLGQGLRLIHYSNGVGSTGEGEVTEGYSVSRKKNDHFPLTLEPASTKQTSLYLCASSE
Tursiops truncatus V47 trbv MRVK01000194.1 408941 LSITGPVEAGITQKPRHKITVTGETVTLECHQTDNHDYMYWYRQDLGHGLRLIHYSNSVGNIEKGEIPDGYNVSRSKTEDFPLTLESVIPSRTSVYFCASSD
Tursiops truncatus V48 trbv MRVK01000194.1 421764 PTDAGVIQTPRHEVTEMGHAVTLSCEPISGHTVLYWYRQTLEQGLEFLIYFVNQSPTDKSGMPKDRFSAEMPKASFSTLKIQPTEPGDSATYLCASR
Tursiops truncatus V49 trbv MRVK01000194.1 431157 GSGLSALVSQHPSRAICKSGASVTIQCHPGTLQATTVYWYHQFPKQGLVLMATSNVGSDATYEQGYTKAKYPISHSSLTFSSLMVTNMHPADSSLYFCGVR
Tursiops truncatus V50 trbv MRVK01000194.1 443622 PMDAEIYQVRFLLAEAGRDVTLECKQNLTYNSMYWYRQDPGQGLRLIYYSAVVKDVQRGDISEGYSVSREEKGLFPLTVKAAHTNQTALYLCSGS
Tursiops truncatus V51 trbv MRVK01000194.1 449223 SMDVGITQTPRNRIANTGKSTVLECSQTKGHGSMYWYRQDPGLGLRQIYYSHGVDDINKGDVSDGYRVSRKKQEKFSLFLEPATPNQTALYFCASSI
Tursiops truncatus V52 trbv MRVK01000194.1 455370 LKDAVVTQFPRHKISKTGKELTLQCSQKQNHYSMYWYRQDPGFGLRLIYYSTNTNTTEKGDVPEGYRVSRNELEYFPLTLKSASTSQTSVYLCASSE
Tursiops truncatus V53 trbv MRVK01000194.1 464077 PLEADVTQSPRHQITETRKRVTLTCSQNMQHDAMYWYRQDPGLGLRLIYFSRNIDLVEKGDVPNGYIVSREKKPDFPLTLASASTNQTSLYLCASSL
Tursiops truncatus V56 ighv MRVK01000311.1 30202 VQCEVQLVESGGGLVQPGGSLRLSCAASGFTFSSYSMSWVRQAPGKGLEWISSISSSGGNTYYADAVKGRFTISRDNSKNTLYLQMNSLRSEDTAVYYCAKG
Tursiops truncatus V109 iglv MRVK01000624.1 17118283 VVLTQPRSVSGSLEQKVTISCTRSSGNIGSYYVHWYQQRLGSAPTIVIYKDDQRPSGVPNRFSGSIDTSSSAAYLTISGLQPEDKANYYCQSGYDSNK
Tursiops truncatus V110 iglv MRVK01000624.1 17123463 ALAQPVLTQPPSLSSNLGASARLTCTLSSGFNVGNFWIRWYQQKPGNPPRYLLTFHSDSDKHQGSGVPSRFTGSNDASTNAEILLISGLQPEDEADYYCAT
Tursiops truncatus V111 iglv MRVK01000624.1 17143845 CLSQPVLTQPPSLSASPGASASLTCTLSSGYIVGGYHIFWYQQKPGSSPRYLLRFKSDSDKYQGSGVPSRFSGSKDASANAGLLLISALQPEDEADYYCAT
Tursiops truncatus V112 iglv MRVK01000624.1 17146004 SWAQAVLTQPRSVSGALGQRVTISCTGSSSNIGSNYVSWYQQVPGTAPRLLIYENSKRPSGVLDRFSGSKSGNSGSLTITGLQAEDEADYYCQSYDDSLD
Tursiops truncatus V113 iglv MRVK01000624.1 17241624 SWAQSGLTQPPSVSGNLGQTVTISCAGTSSDIGKYNYVSWYQQLPGTAPKTLIYEVNKRPSGIPDRFSGSKSGNTASLTISGLQAEDEADYYCSSARSG
Tursiops truncatus V119 ighv MRVK01000730.1 15014 WPRTGEALTDPVPHLCRLRGLCNQQLLLELDLPTPWGRVGVDGVLDREYKLQPAFQGRISVTADTSKNQFSLQLSSVTTEDTAVYYCARDSERKSV
Tursiops truncatus V160 trbv MRVK01000194.1 519293 VRAQTIHQWPLIRVQPAGSPLSLECTVKGTPNPRLYWYRQEAGGALQLLYYSISSDQIDAEEPQNFEASRPREDLFILSSKKLLPSNSGFYLCAWN
Tursiops truncatus V168 ighv MRVK01000311.1 53474 VQCEVQLVESGGGLVQPGASLRLSCAASGFTFSSYGMSWVRQAPGKGLEWISCTSSSGGNTYYADSVKGRFTISRDNSKNTLYLQMNSLRSEDTAVYYCAKD
Tursiops truncatus V169 ighv MRVK01000311.1 40113 VQCEVQLVESGGGLVKPGASLRLSCAASGFTFDDYAMSWVRQAPGKGLEWISVINYSGGYTNYADSVKGRFTISRDNSKNTLYLQMNSLRSEDTAVYYCAKG
Tursiops truncatus V208 trav MRVK01000515.1 852181 SSVAQMVTQPQPEVSVQEADTVTLDCTYSTSDSNYYLLWYKRPPSGEMIFIIGQEAYKQQNATNSHYSVNFQKEAKSFHLSISDSQLEDAAMYFCTYSG
Tursiops truncatus V209 trav MRVK01000515.1 820592 VSGKNDVEQSPRYLSALEGDFVTINCSYSEEMTTLQWFQQNPGRGVVSLFILSLEMKKKGRVSATINRKERHSSLHISASQPRDTATYFCAVE
Tursiops truncatus V210 trdv MRVK01000515.1 773354 VYLDVILEPETKTLTVLLGEPATFRCSITGGDLKNYQMSWYEKNENNSLTLVYRLSNNSNEKERSNFKGKIDALKSRYILNIQKTTVKDVGTYYCGSN
Tursiops truncatus V211 trdv MRVK01000515.1 752607 VMSAVTLVPQNQARSVSVGESVTLRCSMKGDSISNYYTFWYRKTPGNTMTLIYREGGTYGPGFEDNFQGEIDLSNNQAVLNILEASERDEGSYYCAS
Tursiops truncatus V23 trgv ABRN02028896.1 1911 HLEQPQLSTTKKLSKTARLECVVSGVTISKMSVYWYQERPGEAMQHLLHILPNNTVRRDSDVTLGKFEADKKPETSTSTLTIHNVQEQDAATYYCALWE
Tursiops truncatus V25 iglv ABRN02031736.1 425 SWAQAVLTQPRSVSGALGQRVTISCTGSSSNIGSNYVSWYQQVPGTAPRLLIYENSKRPSGVLDRFSGSKSGNSGSLTITGLQAEDEADYYCQSYDDSLM
Tursiops truncatus V33 trdv ABRN02041410.1 7693 SSVAQMVTQPQPEVSVQEADTVTLDCTYSTSDSNYYLLWYKQPPSGEMIFIIGQEAYKQQNATNSRYSVNFQKEAKSFRLRISDSQLEDAAKYFCAYSG
Tursiops truncatus V34 trav ABRN02041410.1 11436 SSVAQMVTQPQPEVSVQEADTVTLDCTYSTSDSNYYLLWYKRPPSGEMIFIIGQEAYKQQNATNSHYSVNFQKEAKSFHLSISDSQLEDAAMYFCTYSG
Tursiops truncatus V35 trav ABRN02041414.1 4579 VSGKNDVEQSPRYLSALEGDFVTINCSYSEEMTTLQWFQQNPGGGVVSLFILSLEMKKKGRVSATINRKERHSSLHISASQPRDTATYFCAVE
Tursiops truncatus V86 trav ABRN02177399.1 20821 VSLGEKMEQSPSTLTVQEGNSSVITCTYTNSALDYFLWYKKEPGKGPQLLIDIRSNKNKKEHQRWSVLLNDKAKRLSLHISDTQPGDSAVYFCAAS
Tursiops truncatus V192 trbv ABRN02293407.1 743 ASADTEITQIPKYLIMETRNKKSLICEQRLGHNAMYWYKQRAQKPPELMFIYNYQELAGNETVPSRFRPECPDSSRIYLHVDTLKLEDSALYLCASSK
Tursiops truncatus V193 trbv ABRN02293407.1 25667 GPRDAAVTQKPRYHIIRAGSKMVLDCSQDMNHVGMFWYRQDLGQGLRLIHYSNGVGSTGEGEVTEGYSVSRKKNDHFPLTLEPASTKQTSLYLCASSE
Tursiops truncatus V194 trbv ABRN02293409.1 914 LSITGPVEAGITQKPRHKITVTGETVTLECHQTDKHDYMYWYRQDLGHGLRLIHYSLGVGNIEKGEIPDGYNVSRSKTEDFPLTLESVIPSRTSVYFCASSD
Tursiops truncatus V207 ighv ABRN02307601.1 2254 WPRTGEALTDPVPHLCRLRGLCNQQLLLELDLPTPWGRVGVDGVLDREYKLQPAFQGRISVTADTSKNQFSLQLSSVTTEDTAVYYCARDSERKSV
Tursiops truncatus V232 trbv ABRN02327898.1 4637 VRAQTIHQWPLIRVQPAGSPLSLECTVKGTPNPRLYWYRQEAGGALQLLYYSISSDQIDAEEPQNFEASRPREDLFILSSKKLLPSNSGFYLCAWN
Tursiops truncatus V287 trav ABRN02388168.1 583 GTRAQTVTQPEDHISVFEGSPVQVKCNYSYSGSPELFWYVHYPKQHLQLLLRHTSRESIRGFTADLNKGEASFHLKKLSAQEEDSAVYYCALR
Tursiops truncatus V288 trav ABRN02388169.1 750 VNSQQGEENLQALSIHEGENATMNCSYKTAIDTLHWYRQDSRRGFAHLILIRSNEREKLSGRLRVTLDNSIKGSSLSITASQAADTATYLCATD
Tursiops truncatus V289 trav ABRN02388169.1 3222 VNSQQGDENLQALSIQEGENATMNCSYKTAIDTLHWYRQDSRRGFAHLILIRSNEREKLSGRLRGTLDNSIKGSSLSITASQAADTATYLCATD
Tursiops truncatus V413 trdv ABRN02535064.1 18785 VYLDVILEPETKTLTVLLGEPATFRCSITGGDLKNYQMSWYEKNENNSLTLVYRLSNNSNEKERSNFKGKIDALKSRYILNIQKTTVKDVGTYYCGSN
Tursiops truncatus V414 trdv ABRN02535067.1 2535 VMSAVTLVPQNQARSVSVGESVTLRCSMKGDSISNYYTFWYRKTPGNTMTLIYREGGTYGPGFEDNFQGEIDLSNNQAVLNILEASERDEGSYYCAS
Tursiops truncatus V562 igkv ABRN02240542.1 1395 ARCDVQMTQSPSSVSASLRERVTISCRASQSISKYLAWYQQKPGEAPKLLIYSASSLETGVPSRFSGSGSGTDFTLTINSLEAQDAATYYCQQYDE
Tursiops truncatus V593 ighv ABRN02263196.1 797 VLSQVHLQESGPGLVKPQQTLSLTCAVSGFSITTSGYCWSWVRQPPRKDLEWMGIICYNGATAYNPSLKSHTSISSDPSKNQYSLQLSSVITEDTATYYCAR
Tursiops truncatus V679 iglv ABRN02360881.1 2100 SVASSALTQPPAVSVSLGQTARITCQGDSLGNYYAQWYQQKPGQAPMLVIYGDSNLESGIPDRFSGSKSGKIATLTISRAQAEDEADYYCGSADSSDY
Tursiops truncatus V680 iglv ABRN02360882.1 3493 SVASYELTQPPSVSVALGQMSKITCSGDLLDKKYTYWYQQKPGQAPVLVIYEDSKRPSGIPDRFSGSSSGKIATLTISRAQAEDEADYYCKSADSSDY
Tursiops truncatus V681 iglv ABRN02360882.1 1017 LCAVPVLTQAPSASSSLGGSAKLTCTLSSEHSTYYIEWYQQRVGQAPRYLMKLTSDGSVTKGDGIPDRFSGSSSGADRYLTIANIQSEDETEYICGVSY
Tursiops truncatus V689 igkv ABRN02371079.1 1572 CWGQITLTQTPETLAASQGSFVSITCKSSVEVGTSMAWYQQKPKEPPRLLIFGASARASGTPSRFQGSGSGFDFSLAIHGVEAEDVGVYYCQ
Tursiops truncatus V693 iglv ABRN02378522.1 834 CLSQPVLTQPPSLSASPGASASLTCTLSSGYIVGGYHIFWYQQKPGSSPRYLLRFKSDSDKYQGSGVPSRFSGSKDASANAGLLLISALQPEDEADYYCAT
Tursiops truncatus V739 iglv ABRN02425951.1 31061 SWAQSGLTQPPSVSGNLGQTVTISCAGTSSDIGKYNDVGWYQQLPGTAPKTLIYDVNKRPSGIPDRFSGSKSGNTASLTISGLQAEDEADYYCSSYRSG
Tursiops truncatus V740 iglv ABRN02425951.1 27080 SWAQSGLTQPPSVSGNLGQTVTISCAGTSNDIGKYNAVGWYQQLPGTAPKTLIYQVNKRPSGIPDRFSGSKSGNTASLTISGLQAEDEADYYCSSARSG
Tursiops truncatus V742 iglv ABRN02425951.1 15015 SWAQSGLTQPPSVSGNLGQTVTISCAGTSSDIGKYNQVGWYQQLPGMAPKTLIYEVNKRPSGIPGRFSGSKSGNTASLTISGLQAEDEAVYYCSSYAGSYA
Tursiops truncatus V752 trav ABRN02440234.1 2644 QTHEDSVTQMDGQMTLPEGAALTINCTYSATGYPITFWYVQYPGEGPQVLLKAMKDNEKGTNKEFEATYHKESKSFHLEKASVQDSDSAVYYCALS
Tursiops truncatus V796 iglv ABRN02492386.1 5282 ALAQPVLTQPPSLSSNLGASARLTCTLSSGFNVGNFWIRWYQQKPGNPPRYLLTFHSDSDKHQGSGVPSRFTGSNDASTNAEILLISGLQPEDEADYYCAT
Tursiops truncatus V797 iglv ABRN02492387.1 1875 VVLTQPRSVSGSLEQKVTISCTRSSGNIGSYYVHWYQQRLGSAPTIVIYKDDQRPSGVPNRFSGSIDTSSSAAYLTISGLQPEDKANYYCQSGYDSNK
Tursiops truncatus V807 trbv ABRN02499068.1 38196 GSGLSAVISQHPSRAICKSGASVTIQCHPGTLQATTVYWYHQFPKQGLVLMATSNVGSDATYEQGYTKAKYPISHSSLTFSSLMVTNMHPADSSLYFCGVR
Tursiops truncatus V808 trbv ABRN02499068.1 26143 PMDAEIYQVRFLLAEAGRDVTLECKQNLTYNSMYWYRQDPGQGLRLIYYSAVVKDVQRGDISEGYSVSREEKGLFPLTVKAAHTNQTALYLCSGS
Tursiops truncatus V809 trbv ABRN02499068.1 20505 SMDVGITQTPRNRIANTGKSTVLECSQTKGHESMYWYRQDPGLGLRQIYYSHGVDDINKGDVSDGYRVSRKEKAKFSLFLEPATPNQTALYFCASSI
Tursiops truncatus V810 trbv ABRN02499068.1 14358 LKDAVVTQFPRHKISKTGKELTLQCSQKQNHYSMYWYRQDPGFGLRLIYYSTGTNTTEKGDVPEGYRVSRNELEYFPLTLKSASTSQTSVYLCASSE
Tursiops truncatus V811 trbv ABRN02499070.1 2142 PTDAGVIQTPRHEVTEMGHAVTLSCEPISGHTVLYWYRQTLEQGLEFLIYFVNQSPTDKSGMPKDRFSAEMPKASFSTLKIQPTEPGDSATYLCASR