WGS Statistics
Organism WGS Record. Vs Total IGHV IGLV IGKV TRAV TRBV TRGV TRDV
Takifugu rubripes CAAB00000000.2 (CAAB02) 125 73 0 13 22 13 2 2
Vgene Table
Organism Vgene Locus contig Contig Pos. AA sequence
Takifugu rubripes Vs189 ighv CAAB02005671.1 5690 VKCEQLTQPASVTVQPGQRLTITCQVSYSVSSYYTSWIRQPAGKGLEWIGWNSVGSTPRYKASLKNKFSISLDSSSNTVTLNGVNVQPEDTAVYYCAR
Takifugu rubripes Vs188 ighv CAAB02005664.1 2270 VDAQTLTQSEPVVKRPGESHTLTCSASGFTFRSYWMVWVRQAPGKGLEWIAYISSGSGSSQYYSESVKGQFIISRDNNKAQLNLQMNSMKTEDSAVYYCARY
Takifugu rubripes Vs187 ighv CAAB02005663.1 553 VKCEQLTQPASVTVQPGQSLTITCQVSYSVSSYWTGWIRQPAGKGLEWIGNGVGSSTYYKASLKNKFSISLDSSSNTVTLNGVNVQPEDTAVYYCAR
Takifugu rubripes Vs186 ighv CAAB02005662.1 573 VDAQTLTQSEPVVKRPGESHTLTCSASGFTFSSYGMHWVRQAPGKGLEWISLIYYDGSNKYYSESVKGRFLISRDNNRAQLNLQMNSLKTEDSAVYYCARW
Takifugu rubripes Vs107 ighv CAAB02018410.1 470 VKSEQLTQPASVTVQPGQCLTVTCQVSYSVSSHHTHWIRQPAGKGLEWIGAHRVGYDPLFKASLKNKFSISLYSSSNTVTLNGVNVQPEDTAVYYCAR
Takifugu rubripes Vs106 ighv CAAB02018409.1 287 VDAQTLTQSEPVVKRPGESHTLTCSASGFTFSSYGMAWVRQAPGKGLEWISAISSGSSYKYYSESVKGRFIISRDNNKAQLNLQMNSLKTEDSAVYYCARE
Takifugu rubripes Vs105 trav CAAB02017987.1 1830 CRGEDKVMQPPEDVVAAEGDIVTLDCTFQTTGSSPNLFWYKQDGTSRPQFILSRFKGDKGKTEDEFKERFSSTLNSTMKSAPLKIQELQLSDSAVYYCALR
Takifugu rubripes Vs104 trav CAAB02017987.1 267 CRGEDKVMQPPEDVVAAEGDTVTLDCTFQTTDPSPYLFWYKQDGTSRPQFILSRVKGDKGKTEDEFKERFSSTVNSTMKSAPLKIQELQLSDSAVYYCALR
Takifugu rubripes Vs103 trav CAAB02017986.1 46 CRGEDKVMQPPEDVVAAEGDTVTLDCTFQTSDTNPNLFWYKQEGTSRPQFILSKFTIGKGKTEDEFKERFSSTLNSTMKSAPLKIQELQLSDSAVYYCALR
Takifugu rubripes Vs102 ighv CAAB02017790.1 499 VDAQTLTQSEPVVKRPGESHTLTCSASGFTFSSYGMAWVRQAPGKGLEWIAYIYSSTYYSESVKGRFIISRDNNRAQLNLQMNSLKTEDSAVYYCARW
Takifugu rubripes Vs100 trav CAAB02017187.1 499 CRGEDKVMQPPEDVVAAEGDTVTLDCTFQTTDPSPYLFWYKQENNNFPKLLLRAKQKASDPQRISAFINKTSAPLKIQELQLSDSAVYYCALR
Takifugu rubripes Vs98 ighv CAAB02016775.1 220 VKGEQLTQPASVTVQPGQRLTITCQVSYSVSSYWTGWIRQPAGKGLELIGYHRVGYTPYYKASLKNKFSISLDSSSNTVTLNGVNVQPEDTAVYYCAR
Takifugu rubripes Vs109 ighv CAAB02018410.1 3491 VKCEQLTQPASVTVQPGQSLTITCQVSYSLSSYWTHWIRQPAGKGLEWIGCKYTGGSYYKASLKNKFSISLDSSSNTVTLNGVNVQPEDTAVYYCAR
Takifugu rubripes Vs108 ighv CAAB02018410.1 1520 VDAQTLTQSEPVVKRPGQSHTLTCSASGFTFSDFGMHWVRQAPGKGLEWIAYIYSSTYYSESVKGRFIISRDNNRAQLNLQMNSLKTEDSAVYYCARY
Takifugu rubripes Vs140 ighv CAAB02025807.1 715 VDAQTLTQSEPVVKRPGESHTLTCSASGFTFSSYYMVWVRQAPGKGLEWISLIYTDGSSQYYSESVKGRFIISRDNNKAQLNLQMNSLKTEDSAVYYCARD
Takifugu rubripes Vs190 ighv CAAB02005671.1 4311 VDAQTLTQSEPVVKRPGESHTLTCSASGFTFSSYEMNWVRQAPGKGLEWIAYISSSSSYKYYSESVKGRFIISRDDNRAQLNLQMNSLKTEDSAVYYCARE
Takifugu rubripes Vs191 ighv CAAB02005672.1 2273 VKGEQLTQPASVTVQPGQSLTITCQVSYSLSSYWTHWIRQPAGKGLEWIGQKYTGGSYYKDSLKNKFSISLDSSSNTVTLNGVNVQPEDTAVYYCA
Takifugu rubripes Vs192 ighv CAAB02005672.1 926 VDAQTLTQSEPVVKRPGESHTLTCSASGFTFSSYEMHWVRQAPGKGLEWIAYIYRSGSSQYYSESVKGRFIISRDNNRAQLNLQMNSLKTEDSAVYYCARE
Takifugu rubripes Vs110 ighv CAAB02018410.1 4994 ADAQTLTQSEPVVKRPGESHTLTCSASGFTFSSYWMHWVRQAPGKGLEWISAIGTDSSTYYSESVKGRFIISRDNNRAQLNLQMNSLKTEDSAVYYCARE
Takifugu rubripes Vs111 ighv CAAB02018412.1 690 VDAQTLTQSEPVVKRPGESHTLTCSASGFTFSSYRMNWVRQAPGKGLEWIAFISNYGGSIQYYSESVKGRFIISRDDNKAQLNLQMNSLKTEDSAVYYCARN
Takifugu rubripes Vs112 igkv CAAB02018623.1 600 YNVIVEGSGLTIDQPASQSIQAEGSVTLNCTVHTGWTCDGDHTVYWFRNSGPSQLGLMYSHTGGNKQCERKTNTCFYSFSMKNLNTSQTGTYYCAVAAC
Takifugu rubripes Vs113 ighv CAAB02018641.1 704 VKCEQLTQPASVTVQPGQRLTITCQVSYSLSSYWTHWIRQPAGKGLEWIGQKYTGGSYYKASLKNKFSISLDSSSSTVTLNGVNVQPEDTAVYYCARE
Takifugu rubripes Vs114 ighv CAAB02018642.1 1497 VKCEQLTQPASVTVQPGQSLTITCQVSYSVSSYYTNWIRQPAGKGLEWIGQKYTGGSYYKDSLKNKFSISLDSSSNTVTLNGVNVQPEDTAVYYCA
Takifugu rubripes Vs115 ighv CAAB02018642.1 2775 VDAQTLTQSEPVVKRPGESHTLTCSASGFTFSSYYMAWVRQAPGKGLEWISFIYHDGSNKYYSESVKGRFIISRDNNRAQLNLQMNSLKTEDSAVYYCARD
Takifugu rubripes Vs116 ighv CAAB02019229.1 1276 VDAQTLTQSEPVVKRPGESHTLTCSASGFTFSSYWMNWVRQAPGKGLEWISAISTDSSQYYSESVKGRFIISRDNNRAQLNLQMNSLKTEDSAVYYCARE
Takifugu rubripes Vs117 ighv CAAB02019975.1 508 VKCEQLTQPASVTVQPGQSLTITCQVSYSLSSYYTNWIRQPAGKGLEWIGWHCFGYNPIYKASLKNKFIISSDPSSNTVTLNGVNVQPEDTAVYYCAR
Takifugu rubripes Vs118 ighv CAAB02019975.1 2806 VDAQTLTQSEPVVKRPGESHTLTCSASGFTFSSYRMNWVRQAPGKGLEWIAFISNYGGSIQYYSESVKGRFIISRDDNKAQLNLQMNSLKTEDSAVYYCARN
Takifugu rubripes Vs119 ighv CAAB02019975.1 4325 VKGEQLTQPASVTVQPGQSLTITCQVSYSVGSYYTSWIRQPAGKGLEWIGWNSVGSTPRCKASLKNKFSISLDSSSNTVTLNGVNVQPEDTAVYYCAR
Takifugu rubripes Vs291 ighv CAAB02023409.1 1532 VDAQTLTQSEPVVKRPGESHTLTCSASGFTFSDYWMAWVRQAPGKGLEWISFIYHDGSNKYYSESVKGRFIISRDNNRAQLNLQMNSLKTEDSAVYYCARW
Takifugu rubripes Vs290 ighv CAAB02023409.1 2773 VKGEQLTQPASVTVQPGQRLTITCQVSYSLSSYYTNWIRQPAGKGLEWIGYHRVGYTPFYKASLKNKFSISSDSSSNTVTLNGVNVQPEDTAVYYCAR
Takifugu rubripes Vs297 trbv CAAB02025848.1 1560 FTVLVLQSGDQLSPPGGAVTLGCRLGSGVGMSSFTMFWYRQNSHAAALEFVAKEYGQSSGSFQTLIDSAKNNFSLLITQLSAKDSSTYYCAA
Takifugu rubripes Vs296 trav CAAB02025727.1 356 CRTQKDTVLQPKAEEMAAEDQTVTLDCHYTSTVTDVYIFWYKQDGTSRPQFILSRFTIGKGKTEDEFKERFSSTLNSTIKSAPLKIQELQLSDSAVYYCALR
Takifugu rubripes Vs294 igkv CAAB02025452.1 2984 ITSTPGSTVALTCKTNPAVYSSCYNGQSNSDCLGWYQQKPGQPPQLLVKHIINHSGTAARFSGSGSSTDFTLTISGVQTQDEAVYYCLGGYSDGT
Takifugu rubripes Vs279 ighv CAAB02021774.1 570 VKGEQLTQPASVTVQPGQRLTITCQVSYSLSSYDTNWIRQPAGKGLEWIGYHGVGYTPYYKASLKNKFSISLDSSSNTVTLNGVNVQPEDTAVYYCAR
Takifugu rubripes Vs271 trgv CAAB02020427.1 1727 TQLTQDQISVTRRAGESASISCGGIDDCNSNYVLWYQKKESGTFEVLLNIVKSNGKITRYSHAEKDDFSARIQQNNCELIIFSVKPSHAASYYCSCWKSG
Takifugu rubripes Vs270 igkv CAAB02020160.1 474 ITSTPGSTVALTCKTNPAVHSRCYNGQSYEDCMFWFQQKPGQPPQLLVRNVRINHSGTAARFSGSGSSTDFTLTISGVQTQDEAVYYCLGYHNGPVL
Takifugu rubripes Vs272 trav CAAB02020585.1 3408 HNVIVEGSGLTIDQSASQSIQAEDSVTLNCTVHTGWTCDGDHTVYWFRNSGPFQLGLMYSHTGGNKQCERETNTCFYSFSMKNLNTSQTGTYYCAVAAC
Takifugu rubripes Vs275 trbv CAAB02021371.1 2678 AADDKSVRQTPPSITKREGDALVSGIKCSHSISSYNQIYWYKQDESRALKLLGYLYTNNQNMEEDMKGKISFDGDGRSGSSLSIAAVGLKDSGVYFCAAS
Takifugu rubripes Vs274 trav CAAB02021108.1 2089 WIFISGSGPETVEVRQGEDVTLACSNTSTEQSQSIWFRLVNRTKPNAIASMFIPTQKALICPGFDKTKFEMTSNISTLFVHIMRADLSDSGLYFCGI
Takifugu rubripes Vs276 trbv CAAB02021371.1 1991 SSLSDQVHQSPADIYHQPRGTAKINCSHSIETYNQIFWYKKSNLELQLLGNMYANNPNVEKGSGVTIEGDANKNKTCTLIIDSLSVNSSGVYFCAAS
Takifugu rubripes Vs99 ighv CAAB02016778.1 609 VDAQTLTQSEPVVKRPGESHTLTCSATGFTFSSYGMAWVRQAPGKGLEWIAYIYSSGSSYYSESVKGRFIISRDNNKAQLNLQMNSLKTEDSAVYYCARD
Takifugu rubripes Vs301 ighv CAAB02028933.1 1049 VKCEQLTQPASVTVQPGQRLTITCQVSYSVSSYYTNWIRQPAGKGLEWIGAHRVGYNPVYKASLKNKFSISSDSSSKTVTLNGVNVQPEDTAVYYCAR
Takifugu rubripes Vs300 ighv CAAB02028491.1 453 VDAQTLTQSEPVVKRPGESHTLTCSASGFTFSSYWMSWVRQAPGKGLEWISDIKYDGSTKYYSESVKGRFIISRDNNRAQLNLQMNSLKTEDSAVYYCARE
Takifugu rubripes Vs284 ighv CAAB02022887.1 1155 VDAQTLTQSEPVVKRPGESHTLTCSASGFTFSDHYMNWVRQAPGKGLEWISRISSSGGSKHYSESVKGRFIISRDNNRAQLNLQMNSLKTEDSAVYYCARD
Takifugu rubripes Vs285 ighv CAAB02023088.1 1765 VKSEQLTQPASVTVQPGQCLTVTCQVSYSVSSHHTHWIRQPAGKGLEWIGAHRVGYDPLFKASLKNKFSISLYSSSNTVTLNGVNVQPEDTAVYYCAR
Takifugu rubripes Vs286 ighv CAAB02023088.1 715 VDAQTLTQSEPVVKRPGQSHTLTCSASGFTFSDFGMHWVRQAPGKGLEWISLISYPSGSSQYYSESVKGRFIISRDNNKAQLNLQMNSLKTEDSAVYYCARE
Takifugu rubripes Vs281 ighv CAAB02022626.1 1711 VDAQTLTQSEPVVKRPGESHTLTCSASGFTFSDYGMHWVRQAPGKGLEWISAINTDGSIQYYSESVKGRFIISRDNNRAQLNLQMNSLKTEDSAVYYCARE
Takifugu rubripes Vs84 trbv CAAB02014153.1 184 SSLSDQVHQSPADIYHQPRGTAKINCSHSIETYNRIFWYKKSNLEFQLLGYMFLNEPNVEKGGGVTIGGDANKNKTCTLIIDSLSVNSSGVYFCAAS
Takifugu rubripes Vs260 ighv CAAB02017583.1 622 VDAQTLTQSEPVVKRPGESHTLTCSASGFTFSDYYMAWVRQAPGKGLEWISAISDGGISQYYSESVKGRFIISRDNNRAQLNLQMNSLKTEDSAVYYCARE
Takifugu rubripes Vs302 igkv CAAB02028963.1 2798 ITSTPGSTVALTCKTNPAVASGCYNGQSNSDCMGWYQQKPGQPPQLLVKHIINHSGTAARFSGSGSSTDFTLTISGVQTQDEAVYYCQSYHSGDV
Takifugu rubripes Vs289 ighv CAAB02023262.1 341 VKCEQLTQPASVTVQPGQSLTITCQVSYSVSSYWTSWIRQPAGKGLEWIGHHRIGYNPVYKTSLKNKFSISLDSSSNTVTLNGVNVQPEDTAVYYCA
Takifugu rubripes Vs254 trbv CAAB02017412.1 814 AADDKSVRQTPPSITKREGDALVSGIKCSHSISSYDRIYWYKQDESRALKLLGYLNTNFKNVEEDVKGKISFDGDGRSGSSLSIAAVGLKDSGVYFCAAS
Takifugu rubripes Vs299 ighv CAAB02028431.1 465 VDAQTLTQSEPVVKRPGESHTLTCSASGFTFSGYWMAWVRQAPGKGLEWISGIYTDGSSQHYSESVKGRFIISRDNNRAQLNLQMNSLKTEDSAVYYCARD
Takifugu rubripes Vs90 trav CAAB02016039.1 4758 YNVIVEGSGLTIDQSASQSIQAEGSVTLNCTVHTGWTCDGDHTVYWFRNSGPSQLGLMYSHTGSNKQCERKTNTCFYSFSMKNLNTSQTGTYYCAVAAC
Takifugu rubripes Vs143 ighv CAAB02025865.1 800 VDAQTLTQSEPVLKRPGESHTLTCSASGFTFSSYWMNWVRQAPGKGLEWISAISTGSSQYYTESVKGRFLISRDNNRAQLNLQMNSLKTEDSAVYYCARE
Takifugu rubripes Vs142 ighv CAAB02025864.1 688 VKGEQLTQPASVTVQPGQRLTITCQVSYSVSSYYTSWIRQPAGKGLEWIGWKYTGGSYYKDSLKNKFSISLDSSSNTVTLNGVNVQPEDTAVYYCAR
Takifugu rubripes Vs141 ighv CAAB02025807.1 1864 VDAQTLTQSEPVVKRPGESHTLTCSASGFTFSSFEMNWVRQAPGKGLEWISAISSSGSSTYYSASVKGRFIISRDNNRAQLNLQMNSLKTEDSAVYYCARE
Takifugu rubripes Vs148 trdv CAAB02026631.1 1211 TTWGQKISPVPGMKNGISSREGEDVTLRCNYETSNSNVLLYWYKHQSDYEAPQFILWKGARSNTGQYIPDKRYRCNTGQQESELTITDVTLADSAVYYCALR
Takifugu rubripes Vs147 trav CAAB02026631.1 469 CRGEDKVMQPPEDVVAAEGDTVTLDCTFQTTYTNPNLFWYKQDGTSRPQFILSRFKGDTGKTEDEFMERFSSTLNSTMKSAPLKIQELQLSDSAVYYCALR
Takifugu rubripes Vs146 ighv CAAB02026133.1 685 VDAQTLTQSEPVVKRPGESHTLTCSASGFTFSDYGMHWVRQAPGKGLEWIAYISSASSQYYSESVKGRFIISRDNNRAQLNLQMNSLKTEDSAVYYCARE
Takifugu rubripes Vs145 ighv CAAB02026132.1 500 VKGEQLTQPASVTVQPGQRLTITCQVSYSVSSYYTSWIRQPAGKGLEWIGYHRVGYTPYYKASLKNKFSISLDSSSNTVTLNGVNVQPEDTAVYYCA
Takifugu rubripes Vs144 ighv CAAB02026075.1 2402 VKGEQLTQPASVTVQPGQSLTITCQVSYSVSSYYTNWIRQPAGKGLEWIGGHRAGYTPYYKDSLKNKFSISLDSSSNTVTLNGVNVQPENTAVYYCAR
Takifugu rubripes Vs262 trbv CAAB02019261.1 674 SSLSDQVHQSPADIYHQPRGTAKINCSHSIETYNRIFWYKKSNLELQLLGNMIFNNPNVEKGSGVTIGGDANKNKICTLIIEGLSVNSSGVYFCAAS
Takifugu rubripes Vs266 ighv CAAB02019453.1 426 VKCEQLTQPASVTVQPGQRLTITCQVSYSVSSHHTHWIRQPAGKGLEWIGGHRVGYNPIYKASLQNKFSISLDSSSNTVTLNGVNVQPEDTAVYYCARE
Takifugu rubripes Vs149 ighv CAAB02027400.1 381 VDAQTLTQSEPVVKRPGESHTLTCSASGFTFSSYWMVWVRQAPGKGLEWISFIYTDGSYKYYSESVKGRFIISRDDNRAQLNLQMNSLKTEDSAVYYCARE
Takifugu rubripes Vs91 igkv CAAB02016040.1 1295 RYVIVEGSGLTIDQPASHSIQAEGSVTLNCTVHTGWTCDGDHTVYWFRNSGPSQLGLIYSHTGRNKQCERKTNTCFYSFSIKNLNTSQTGTYYCAVAAC
Takifugu rubripes Vs96 ighv CAAB02016772.1 1703 VKCEQLTQPASVTVQPGQRLTITCQVSYSVSSYDTNWIRQPAGKGLEWIGWHRVGYTPSYKASLKNKFSISSDSSSNTVTLNGVNVQPEDTAVYYCA
Takifugu rubripes Vs97 ighv CAAB02016774.1 99 VDAQTLTQSEPVVKRPGESHTLTCSASGFTFSSYDMAWVRQAPGKGLEWIAYIYSSGSSQYYSESVKGRFIISRDNNRAQLNLQMNSLKTEDSAVYYCARW
Takifugu rubripes Vs264 igkv CAAB02019410.1 2583 YNVIVEGSGLTIDQPASHSIQAEGSVTLNCTVHTGWTCDGDHTVYWFRNSGPSQLGLMYSHTGRNKQCERKTNTCFYSFSLKNLTTSQTGTYYCAVAAC
Takifugu rubripes Vs95 trav CAAB02016744.1 564 HNVIVEGSGLTIDQSASQSIQAEVSVTLNCTVHTGWTCDGDHTVYWFRNSGPSQLGLMYSHTGRNKQCERKTNTCFYSFSMKNLNTSQTGTYYCAVAAC
Takifugu rubripes Vs298 ighv CAAB02028233.1 1493 VKCEQLTQPASVTVQPGQGLTITCQVSYSLSSYWTHWIRQPAGKGLEWIGQKYTGGSYYKDSLKNKFSISLDSSSSTVTLNGVNVQPEDTAVYYCARE
Takifugu rubripes Vs292 ighv CAAB02023721.1 665 VDAQTLTQSEPVVKRPGESHTLTCSASGFTFSDYWMYWVRQAPGKGLEWISLIYTDGSNKYYSESVKGRFIISRDNNRAQLNLQMNSLKTEDSAVYYCARE
Takifugu rubripes Vs265 ighv CAAB02019452.1 1006 VDAQTLTQSEPVVKRPGESHTLTCSASGFTFSSYWMVWVRQAPGKGLEWISRISSGSSQYYSESVKGRFIISRDNNKAQLNLQMNSLKTEDSAVYYCARE
Takifugu rubripes Vs267 ighv CAAB02019617.1 3977 VKCEQLTQPASVTVQPGQRLTVTCQVSYSVSSHHTHWIRQPAGKGLEWIGAHRVGYDPLFKASLKNKFSISLYSSSNTVTLNGVNVQPEDTAVYYCAR
Takifugu rubripes Vs156 trav CAAB02029058.1 677 CRGEDKVMQPPEDVVAAEGDTVTLDCTFQTSYTSPNLFWYKQENNKFPKLLLRAKQKPSDPQRISALINKTSAPLKIQELQLSDSAVYYCALR
Takifugu rubripes Vs157 ighv CAAB02029173.1 202 VDAQTLTQSEPVVKRPGESHTLTCSASGFTFSSYGMAWVRQAPGKGLEWIAYIYSSGSSYYSESVKGRFIISRDNNKAQLNLQMNSLKTEDSAVYYCARW
Takifugu rubripes Vs150 ighv CAAB02027601.1 2055 VKCEQLTQPASVTVQPGQSLTITCQVSYSLSSYWTHWIRQPAGKGLEWIGCKYTGASYDKDSLKNKFSISLDSSSNTVTLNGVNVQPEDTAVYYCA
Takifugu rubripes Vs151 ighv CAAB02027602.1 323 VDDQTLTQSEPVVKRPGESHTLTCSASGFTFSSYYMVWVRQAPGKGLEWISRISSSGGSQYYSESVKGWFIISRDNNRAQLNLQMNNLKTEDSAVYYCARE
Takifugu rubripes Vs152 trbv CAAB02027611.1 377 SSLSDQVHQSPADIYHQPRGTAKINCSHSIETYNRIFWYKKSNLELQLLGNMYNNNPNVEKESGVTIEGDANKNKTCTLIIDSLSVNSSGVYFCAAS
Takifugu rubripes Vs153 trav CAAB02028266.1 567 CRGEDKVMQPPEDVVAAEGDTVTLDCTFQTSYTSPNLFWYKQENNKFPKLLLRAKQKPSDPQRISALINKTSAPLKIQELQLSDSAVYYCALR
Takifugu rubripes Vs236 ighv CAAB02016105.1 2151 VDAQTLTQSEPVVKRPGESHTLTCSASGFTFSSYWMSWVRQAPGKGLEWISDIKYDGSTKYYSESVKGRFIISRDNNRAQLNLQMNSLKTEDSAVYYCARE
Takifugu rubripes Vs129 trav CAAB02022236.1 13 CRGEDKVMQPPEDVVAAEGDTVTLDCTFQTSDTNPYLFWYKQDGTSRPQFILSKFTIGKGKTEDEFKERFSSTLNSTMKSAPLKIQELQLSDSAVYYCALR
Takifugu rubripes Vs128 trav CAAB02021934.1 13 CRGEDKVMQPPEDVVAAEGDTVTLDCTFQTSDTSPNLFWYKQDGTSRPQFILSRVKADKGKTEDEFKERFSSTLNSTMKSAPLKIQELQLSDSAVYYCALR
Takifugu rubripes Vs121 ighv CAAB02020165.1 470 VDAQTLTQSEPVVKRPGESHTLTCSASGFTFSSYAMHWVRQAPGKGLEWIAYIYSSPEYYSESVKGRFIISRDNNRAQLNLQMNSLKTEDSAVYYCARE
Takifugu rubripes Vs120 ighv CAAB02019975.1 5645 VDAQTLTQSEPVVKRPGESHTLTCSASGFTFSDYYMAWVRQAPGKGLEWISAISSPSGSDKYYSESVKGRFIISRDNNRAQLNLQMNSLKTEDSAVYYCARW
Takifugu rubripes Vs123 trav CAAB02020470.1 228 CRTQKDTVLQPKAEEMAAEDQTVTLDCHYTSTATSDYIFWYKQDGTSRPQFILSRFKGDEGKTEDEFKERFSSTLNSTMKSVPLKIQELQLSDSAVYYCALR
Takifugu rubripes Vs122 ighv CAAB02020165.1 1960 VKCEQLTQPASVTVQPGQRLTITCQVSYSVSSYATNWIRQPAGKGLEWIGENCIGCTPYYKDSLKNKFSISSDSSSNTVTLNGVNVQPEDTAVYYCA
Takifugu rubripes Vs125 trbv CAAB02021506.1 894 ATDTKSVSQKPSFTILRTGESVVSEINCSHSISSYDQIYWYKQDESRALKLLGYLYTNIQNVEEDVKGKISFDGDGRSGSSLSIAAVGLKDSGVYFCAAS
Takifugu rubripes Vs127 trbv CAAB02021507.1 254 AADDKSVRQTPPSITKREGDALVSGINCSHQVSSFQVILWYKQDESRALKLLGYLNTNFKNVEEDVKGKISFDGDGRSGSSLSIAAVGLKDSGVYFCAAS
Takifugu rubripes Vs238 ighv CAAB02016106.1 2533 VKCEQLTQPAFVTVQPGQSLTITCQVSYSLRSYWTSWIRQPAGKGLEWIGYNGVGWTPYYKASLKNKFSISLDSSSNTVTLNGVNVQPEDTAVYYCAR
Takifugu rubripes Vs74 trav CAAB02010181.1 834 LTDETSSFVYPVNSLVFANVGENMTLQCSYKDNSANMFHWYKQTQGEKPILLSNFFKHDKKVESRGKLNNHFSVNFTRRNYHLIIAKLRISDSGIYYCTSSYV
Takifugu rubripes Vs257 ighv CAAB02017582.1 2347 VDAQTLTQSEPVVKRPGESHTLTCSASGFTFSDYGMHWVRQAPGKGLEWISAINTDGSIQYYSESVKGRFIISRDNNRAQLNLQMNSLKTEDSAVYYCARE
Takifugu rubripes Vs256 igkv CAAB02017480.1 749 RYVIVEGSGLTIDQPASHSIQAEGSVTLNCTVHTGWTCDGDHTVYWFRNSGPSQLGLIYSHTGRNKQCERKTNTCFYSFSIKNLNTSQTGTYYCAVAAC
Takifugu rubripes Vs86 trbv CAAB02014154.1 824 AADDKSVRQTPPSITKREGDALVSGINCSHQVSSFQVILWYKQDESRALKLLGYLNINFKNVEEDMKGKISFDGDGRSGSSLSIAAVGLKDSGVYFCAAS
Takifugu rubripes Vs81 trav CAAB02012880.1 3329 CRGEDKVMQPPEDVVAAEGDTVTLDCTFQTSYTSPNLFWYKQENNKFPKLLLRAKQKPSDPQRISALINKTSAPLKIQELQLSDSAVYYCALR
Takifugu rubripes Vs252 trbv CAAB02017408.1 2457 ATDTKSVSQKPSFTILRTGEFVVSGINCSHSINSYDRIYWYKQDESRALKLLGYLNTNIQNVEEDVKGKISFDGDGRSGSSLSIAAVGLKDSGVYFCAAS
Takifugu rubripes Vs251 trav CAAB02017358.1 362 CRGEDKVMQPPEDVVAAEGDTVTLDCTFQTSDPSPYLFWYKQDGTSRPQFILSRVKGDKGKTEDEFKERFSSTLNSTMKSAPLKIQELQLSDSAVYYCALR
Takifugu rubripes Vs250 igkv CAAB02017246.1 3965 ITSTPGSTVALTCKTNPAVGSGCYNGQSNSDCMFWYQQKPGQPPQLLVRNVRINHSGTAARFSGSGSSTDFTLTISGVQTQDEAVYYCLGYHSGPV
Takifugu rubripes Vs88 igkv CAAB02015738.1 1108 ITSTPGSTVALTCKTNPAVHSRCYNGQSTSHCMSWYQQKPGQPPQLLVRHVRINHSGTAARFSGSGSSTDFTLTISGVQTQDEAVYYCLGYNSDGT
Takifugu rubripes Vs259 ighv CAAB02017583.1 1729 VKCEQLTQPASVTVQPGQSLTITCQVSYSLSSYWTHWIRQPAGKGLEWIGCKYTGGSYYKDSLKNKLSISLDSSSNTVTLNGANVQPEDTAVYYCAR
Takifugu rubripes Vs258 ighv CAAB02017582.1 730 VKGEQLTQPASVTVQPGQRLTITCQVSYSLNSYGTNWIRQPAGKGLEWIGSNCAGCTPGYKVSLKNKFSISLDSSSNTVTLNGVNVQPEDTAVYYCAR
Takifugu rubripes Vs138 ighv CAAB02025293.1 481 VDAQTLTQSEPVVKRPGESHTLTCSASGFTFSSYWMVWVRQAPGKGLEWISAISTGSSTYYSESVKGRFIISRDDNRAQLNLQMNSLKTEDSAVYYCARE
Takifugu rubripes Vs139 ighv CAAB02025695.1 131 VDAQTLTQSEPVVKRPGESHTLTCSASGFTFSDYYMAWVRQAPGKGLEWISAISDGGISQYYSESVKGRFIISRDNNRAQLNLQMNSLKTEDSAVYYCARE
Takifugu rubripes Vs239 ighv CAAB02016106.1 1552 VDAQTLTQSEPVVKRPGESHTLTCSASGFTFSSYWMHWFRQAPGKGLEWISAISTDGSSQYYSESVKGRFIISRDNNRAQLNLQMNSLKTEDSAVYYCARD
Takifugu rubripes Vs131 trav CAAB02023513.1 1691 YKVIVEGSGLTIDQSASQSIQAGGSVTLNCTVHTGWTCDGDHTVYWFRNSGQSQLGLMYSHTGRNKQCERKTNTCFYSFSMKNLNTSQTGTYYCAVAAC
Takifugu rubripes Vs136 trav CAAB02024833.1 1193 CRGEDKVMQPPEDVVAAEGDTVTLDCTFQTTDTNLYLFWYKQEGTSRPQFILSRFTFGKGKTEDEFKERFSSTVNSTMKSAPLKIQELQLSDSAVYYCALR
Takifugu rubripes Vs137 ighv CAAB02025291.1 2215 VDAQTLTQSEPVVKRPGESHTLTCSASGFTFSSYGMHWVRQAPGKGLEWISLIYYDGSNKYYSESVKGRFIISRDNNRAQLNLQMNSLKTEDSAVYYCARN
Takifugu rubripes Vs135 trav CAAB02024833.1 403 CRTQKDTVLQPKAEEMAAEDQTVTLDCHYTSTATNDYIFWYKQDGTSRPQFILSRVKGDKGKTEDEFKERFSSTLNSTMKSAPLKIQELQLSDSAVYYCALR
Takifugu rubripes Vs69 ighv CAAB02009398.1 5685 VDAQTLTQSEPVVKRPGESHTLTCSASGFTFSDYGMHWVRQVPGKGLEWIAYIYSSGSSQYYSESVKGRFIISRDNNRAQLNLQMNSLKTEDSAVYYCARW
Takifugu rubripes Vs68 ighv CAAB02009398.1 4323 VKCEQLTQPASVTVQPGQSLTITCQVSYSLSSYWTHWIRQPAGKGLEWIGYKYTGGSNYKDSLKNKFSISLDSSSNTVTLNGVNVQPEDTAVYYCARE
Takifugu rubripes Vs240 ighv CAAB02016108.1 1551 VKGEQLTQPASVTVQPGQSLTITCQVSYSLSSYATSWIRQPAGKGLEWIGYHCAGCTPYYKASLKNKFSISLDSSSNTVTLNGVNVQPEDTAVYYCAR
Takifugu rubripes Vs241 igkv CAAB02016188.1 2955 SYVIVEGSGLTIDQPASQSIQAEGSMTLNCTVHTGWTCDGDHSVYWFRNSGPFQLGLMYSHTGRNKQCERKTNTCLYSFSLKNLNTSQTGTYYCAVAAC
Takifugu rubripes Vs242 igkv CAAB02016348.1 1071 QTASMEFSPSLNRKTNFILVKPGQNLTLPCHDKDDVSTRIYWFKQTLGEKPRLICTHRISSKDWKFVNDFKTNPHFQLHPGNKAANLTISDLELSDSATYYCV
Takifugu rubripes Vs243 igkv CAAB02016348.1 726 YNVIVEGSGLTIDQPASHSIQAEGSVMLNCTVHTGWTCDGDYTVYWFRNSGQSQLGLMYSHTGGNKQCERKTNTCLYSFSMKNLNTSQTGTYYCAVAAC
Takifugu rubripes Vs244 trbv CAAB02016548.1 1229 SSLSDQVHQSPADIYHQPRGTAKINCSHSIETYNRIFWYKKSNLELQLLGNMYNNNPNVEKESGVTIEGDANKNKTCTLIIDSLSVNSSGVYFCAAS
Takifugu rubripes Vs246 trbv CAAB02016552.1 813 AADDKSVRQTPPSITKREGDALVSGINCSHQVSSFQVILWYKQDESRALKLLGYLYTNNQNVEEDVKGKISFDGDGRSGSSLSIAAVGLKDSGVYFCAAS
Takifugu rubripes Vs268 ighv CAAB02019617.1 2596 VDAQPLTQSEPVVKRPGESHTLTCSASGFTFSDYGMNWVRQAPGKGLEWIAYISSSSSYKYYSESVKGRFLISRDNNRAQLNLQMNSLKTEDSAVYYCARW
Takifugu rubripes Vs269 ighv CAAB02019618.1 573 VDAQTLTQSEPVVKRPGESHTLTCSASGFTFSDYWMVWVRQAPGKGLEWISATNYGGGSTYYSESVKGRFIISRDNNRAQLNLQMNSLKTEDSAVYYCARY
Takifugu rubripes Vs237 ighv CAAB02016106.1 4157 VDAQTLTQSEPVVKRPGQSHTLTCSASGFTFSDYWMSWVRQAPGKGLEWISAISTDSSTYYSESVKGRFIISRDNNRAQLNLQMNSLKTEDSAVYYCARN
Takifugu rubripes Vs283 ighv CAAB02022887.1 2544 VKCEQLTQPASVPVQPGQRLTITCQVSYSVSSHHTHWIRQPAGKGLEWIGAHRVGYNPIYKASLQNKFSISLDSSSNTVTLNGVNVQPEDTAVYYCAR
Takifugu rubripes Vs101 trdv CAAB02017188.1 116 TTWGQKISPVPGMKNGISSREGEDVTLRCNYETSNSYVLLFWYKHQSDYEAPQFILWKGARSNTGQYIPDKRYRCNTGQQESELTITDVTLADSAVYYCALM
Takifugu rubripes Vs287 trav CAAB02023219.1 724 CRGEDKVMQPPEDVVAAEGDTVTLDCTFQTTGSSPNLFWYKQDGTSRPQFILSRFKGDTGKTEDEFKERFSSTLNSTMKSAPLKIQELQLSDSAVYYCALR
Takifugu rubripes Vs280 trgv CAAB02022143.1 4649 LVVIETQLTQDQISVTSRAGESASISCGGINNCDYYVFWYQKKESGTFERLLNIDKSSSEIERYSHADQDDFSAKIQQNNCELIISSVKPSHAASYYCSCWKSG
Takifugu rubripes Vs261 ighv CAAB02018056.1 803 VDAQTLTQSEPVVKRPGESHTLTCSASGFTFSSYWMVWVRQAPGKGLEWISAISNGGSSQYYSESVKGRFIISRDDNRAQLNLQMNSLKTEDSAVYYCARD
Takifugu rubripes Vs249 igkv CAAB02017245.1 2176 ITSTPGSTVALTCKTNPAVYSSCYDGQSSSECMFWYQQKPGQPPQLLVRNVRINHSGTAARFSGSGSSTDFTLTISGVQTQDEAVYYCQSYHNIPVF