WGS Statistics
Organism WGS Record. Vs Total IGHV IGLV IGKV TRAV TRBV TRGV TRDV
Miniopterus natalensis LDJU00000000.1 (LDJU01) 140 41 31 1 41 17 4 5
Vgene Table
Organism Vgene Locus contig Contig Pos. AA sequence
Miniopterus natalensis V138 trbv LDJU01000132.1 2151 SAATEVTQSPRHLIQVLGEKAVLECHPKPGHDTLYWYQQAQGQGPQFLISFFETEERARGIFPEHFSANQSGDYSSELAISALQLADSAVYLCASSL
Miniopterus natalensis V139 trbv LDJU01000132.1 5271 SAAAGVTQSPRHLIQVLGEKAVLECHPISGHKSLYWYQQALGQGPQFLISFFEKRESERGIFPEHFSANQSGDYSSELAISALQLADSAVYLCASSL
Miniopterus natalensis V140 trbv LDJU01000132.1 7126 HLDAGITQSPRYKVAGTEKKVTLRCHQTDKYDYMYWYRQDLGHGLRLLHYSFGAGATERGEIPDGYNVSRSDTEDFPLTLEAATPSQTSVYFCASSD
Miniopterus natalensis V141 trbv LDJU01000132.1 23965 HAGAVVIQNPRYQVTIVGQPVTLNCSQDLNHDAMYWYQQKLSQGPKLLFYYYGQEFNNETDTSGNFQPSRTDSFSSLGIRSPGLGDSAVYLCASSR
Miniopterus natalensis V142 trbv LDJU01000132.1 26769 SLDAKVTQTPGHLLKRKGQNAKMYCVPKSGHNYVFWYQQTLEKEFKFLVSLQYEKVLKREVPKERFLAECPQDSPCWLEIQGVESQDSAVYLCASR
Miniopterus natalensis V143 trbv LDJU01000132.1 35612 GSGLGAFVNQHPSRAICPSGASVTIQCHPVGIQATTMLWYHQPLKQGLILIATSNLGSPVIYEQGFSRATFPIDHLNSTFSNLTVTSAHPADSSLYFCAAS
Miniopterus natalensis V144 trbv LDJU01000132.1 43606 SSDAQVTQIPGHLVIGKGQRAKMDCFPPKEYPVVYWYQQTQNKEFKFLIYFQNEVLFDQIELAKERFSAQCSPDSWCSLEIPASEPGDSALYFCASGQ
Miniopterus natalensis V145 trbv LDJU01000132.1 47580 SMDTGVTQTPRNKIAGTGNSIVLGCSQNKGHDYMYWYRQDPGLGLRLIYYSYEVNKSNEGDVPDGYSVSRGEKMKFSLIIKTASPAQSAVYFCASSN
Miniopterus natalensis V146 trbv LDJU01000132.1 52625 PMDADVYQTPRHCVTGTGKMITLECSQTMGHDKMYWYNQDPGMELQLIHYPYGANSTEKGDLPFESTVSRIRKEHCPLTLASTGPSQTSRYLCAS
Miniopterus natalensis V147 trbv LDJU01000132.1 66723 LMDAEVTQTPRYLVKRKGERVLMECFQDMNHERMFWYRQDPGLGLRLLHFSYGVNNNDRGDFPDGYNVSRKEKKGFSLILLSASTDQTSVYLCASSK
Miniopterus natalensis V148 trbv LDJU01000132.1 70999 SVFGVLLSQKPSRNICQRGTSVTIQCEADSQVTLMFWYRQLPGQSLTLIATANQGSEATYESGFNKKKFPISRPSLTFSNLTVNNLSPDDSSFYFCSG
Miniopterus natalensis V187 trav LDJU01000194.1 2586299 AAGQSVQQAAEVTAMEGASVRVNCTYQTSGFNGLFWYQQHAGGAPIFLSYNVLDGLERRGHFSSFLSRSDTYSYLLVKELQMKDSATYLCAVT
Miniopterus natalensis V188 trav LDJU01000194.1 2628946 GLRAQSVTQPDNQVTVAEGSPMTVKCTYSFSGSPYLFWYVQYPNRGLQFLLKYITGDNLVKGNFGFEAEFHKSQTSFNLKKPSVLGSDSAVYFCAGR
Miniopterus natalensis V189 trav LDJU01000194.1 2652432 TLSLAKTTQPIFMDSYEGQEVNIPCNHTNIATNEYIFWYRQFPNQGPLFVIQGYKTNTSNEVASLFIPADRKSSMLSLPRASLRDTAVYYCVVS
Miniopterus natalensis V190 trav LDJU01000194.1 2662075 ARAQSVTQPTSHISVSEGAFLELRCKYSYTGVTYLYWYVQYPSQGLQLLLKYISGNTLVKGIKDFEAELRKNESSFNLRKHFAHWSDSAVYFCAVS
Miniopterus natalensis V191 trav LDJU01000194.1 2672336 RSNGDSVTQTKGQVTLSEGDSLTVKCSFETTWDPTLFWYVQYPGEGPQLLLKAVKANEKKNNKGFEATYSKQPNTFHLEKASVEESDSAMYYCVMS
Miniopterus natalensis V192 trav LDJU01000194.1 2680466 DSRAQSVTQPDNHISVSERAPLELKCKYSYDAVTALYWYVQYPSQGLQLLLKHFLTDTLVQGIKGFEAEFKKSESSFNLKKSSAHLSDSAVYFCALS
Miniopterus natalensis V193 trav LDJU01000194.1 2690210 DSKAQSVTQPDNHISVSERASLELRCKYVYGATPSLFWYVQYPNQGLQLLLKYISGNTLVKGIKDFEAELRKNESSFNLRKHFAHWSDSAVYFCAVS
Miniopterus natalensis V194 trav LDJU01000194.1 2699153 RNNGDSVTQTKGQVILSEGNSLTVNCSYETTRYPVLFWYVQYPGEGPQLLLKAVKASEKGSNKGFEATYSEQPNTFHLEKASVQQSDSAMYYCVLS
Miniopterus natalensis V195 trav LDJU01000194.1 2710204 DSRAQSVTQPDNHIIVSERAPLELRCKYVYSATPYLFWYVQYPNQGLQLLLKHFSADPLAQGIKGFVAEFKKSESSFNLKKSSAHLSDSAVYFCALG
Miniopterus natalensis V196 trav LDJU01000194.1 2721414 GVRGLTVEQSLSALSIQEGTSATLKCTFSNKTSYLQWFRPNPGGGLTSLFFLTTGAKQDGRLSSTISFQDLYSTLSITASQLGDSATYFCAGDA
Miniopterus natalensis V197 trav LDJU01000194.1 2747711 SSIAQKVTQSQPAMLVQEKEAVTLDCTYDTSDTTYSLFWYKQLSSGAMIFLLRQDSYNQQNAREGRYSLNFQKAKSSINLVVSASQLEDSAVYFCALRE
Miniopterus natalensis V198 trav LDJU01000194.1 2756538 RTHGDSVTQMEDPVTLSEGDSLTVKCSYETIQYPALFWYVQYPGEGLQLLLKAMKANEKGSNKGFEATYSKQPNTFHLEKASVQASDSAMYYCALS
Miniopterus natalensis V199 trav LDJU01000194.1 2783500 GTHGDSVTQMEGPVTSSEGEFLTVNCFYETTGYPILFWYVQYPGEGPQLLLKAGKDNEKGSNKGFEATYRKQPNTFHLEKASVQVSDSAMYYCVMS
Miniopterus natalensis V200 trav LDJU01000194.1 2806244 VSRGEKVEQSPSTLSVQEGNPAVITCSYSDSASDYFPWYKTEPGKGPQLIIDIFSNKDRKEDGRLTVLLNKEAKHLSLQIAATQPGDAVVYFCAAS
Miniopterus natalensis V201 trav LDJU01000194.1 2814709 SSIAQKVTQGQSAMLVQEKEAVTLDCTYDTNYGSYSLFWYKQPSSGAMIVVIRQDSYNQQNAREGRYSLNFQKAKNSVTLVISASQLEDSAVYFCALSE
Miniopterus natalensis V202 trav LDJU01000194.1 2832886 VSRGEKVEQSPSTLSVQEGNPAVITCSYSDSASNYFPWYKTEPGKGPQLIIDIRSNKDKKEDGRLTVLLNKEAKHLSLQIAATQPGDAAVYFCAAS
Miniopterus natalensis V203 trav LDJU01000194.1 2838283 SNIAQKVTQDQQEMLVQEKEAVTLDCTYDTSDPSYSLFWYKQLSSGAMIFLLRQDSYNQQNAREGRYSLNFQKAKSSINLVVSASQLEDSAVYFCALRE
Miniopterus natalensis V224 igkv LDJU01000222.1 128352 ASRSTVLSQSPAFLSVSLRESVSMVCRADQSISDYLTWYQQKPGQAPKPLIYDADNRYTGVPEKFIGIQYGTEFILKISEVEADDVATYYCQQDYTVP
Miniopterus natalensis V248 trav LDJU01000287.1 4472 VSRGEKVEQSPSTLSVQEENPAVITCSYSDSASVYFPWYKTEPGKGPKLIIDIRSNKDKKEDGRLTVLLNKEAKHLSLQIAATQPGDAAVYFCAAS
Miniopterus natalensis V249 trav LDJU01000287.1 10043 CNIAQKVTQDQQERLVQEKEAVTLDCTYDISYPTYSLFWYKQLNSGAMIFLLRQDSYNQQNAREGRYSLNFQKAKSSINLVVSASQLEDSAVYFCALSE
Miniopterus natalensis V250 trav LDJU01000287.1 25272 LTHGDSVTQVESQVTLSEDAYLILNCTFSATGYPTLFWYVQYPGESLQLLLKATRANEKGSNKGFEATYRKEQNSFHLEKASVHESDSAMYYCVLG
Miniopterus natalensis V251 trav LDJU01000287.1 41334 GTGAQSATQPDSHVTVFEREALELKCKYSTSSSPYLFWYVQYPNQGLQLVLRYFSGDTLVKGIKDFEAVFRKSDTTFHLKKHSVYWNDSAVYFCAVS
Miniopterus natalensis V252 trav LDJU01000287.1 49964 GIRAQTVTQPEDHISVLEGASVEVKCNYVYSGSPELFWYVQYPKRSLQLLLKHISRESIKGFTAVLNKSETSFHLKKSSAQEEDSAVYYCALR
Miniopterus natalensis V253 trav LDJU01000287.1 60754 ETSGDSVNQAEGPVTLQEKEFLTLTCTYQTSYSAFLFWYVQYQNKEPVLLLRSSSDNEEVRSRGFQATLVKQDSSFHLRKASVQASDSATYLCALS
Miniopterus natalensis V254 trav LDJU01000287.1 71480 GTNGDSVTQTDGPVTLPENAPVILNCRYQTTYSSPFLFWYVQYPNKAPELLLKSSTENQKAERQGFQAKLVKSDSSFHLEKSSLQTADSAVYYCAL
Miniopterus natalensis V255 trav LDJU01000287.1 83851 LSGEDQVEQSPPILRIQEGNSVSLNCSYTVSAFRGLLWYRQDPGKGLKFLFLLFSVENEQKNERLRATLSQKISSLHIETPKAEDSATYLCAVE
Miniopterus natalensis V256 trav LDJU01000287.1 117701 VRGVEVEQSPPAWSLQEGANSTLWCKFSTSVNNVQWFRQNPGGQLISLFYIPSGTKQNGNLIAMTDPKERHSSLYISSAQTTDSAIYFCAVQA
Miniopterus natalensis V257 trav LDJU01000287.1 122031 VRGVEVEQSPPAWSLQEGANSTLWCKFSTSVNNVQWFRQNPGGQLISLFYIPSGTKQNGNLIAMTDPKERHSSLYISSAQTTDSAIYFCAVQA
Miniopterus natalensis V258 trdv LDJU01000287.1 146412 SSVAQKIIQDQSPIVKQEGTAATTLNCRYETSQITYHIFWYKQLTSGKLIFLIRQSSYGQNTKTSRYSTNFQETAKSINFTISTLQLKDSGKYFCVLWE
Miniopterus natalensis V259 trav LDJU01000287.1 153345 VDSEPNVEQSPPSLHVQEGESTDFTCHFPSSSLYALYWYRWEPTKSLKSLFVMSLSGDVKEEGRVRATLNTKEDSSSLYIKGSQPEDSATYLCAF
Miniopterus natalensis V260 trav LDJU01000287.1 163888 VNGQQIKQIPQFLLLEEGENFTIHCSFSNALSSLQWYKQSPGESPVFLTLLAKNGEVKKQKRLTAQLGETRKDSSLHVSATQAADVGTYFCAA
Miniopterus natalensis V261 trav LDJU01000287.1 175070 TVIDAKITQPNSMDYAEGKDVNLPCNHPTISGDDYIYWYRQNPNQRLQYIIHGLRNNVTNNMASLIITTDRKSSTLILPSATLRDSAVYYCALR
Miniopterus natalensis V262 trav LDJU01000287.1 190802 GTKAQSVTQPDGHITVSEGDSLELKCSYSYGGAIYLFWYVQYPSQGLQLLLKYVTGATLVTGIKGFKAEFRKNETSFHLRKLSTHWSDSAVYFCALS
Miniopterus natalensis V263 trav LDJU01000287.1 202700 ESTQQLEQSPRFLQIQEGENRTVYCSSSSVFPTFQWYRQKPGEGPVLLMTLSKGGEKKVQERITAQFGDERKDSSLLITEAQAEHAGTYLCAG
Miniopterus natalensis V264 trav LDJU01000287.1 218180 VRSQEVQQSPQSLIIQEEEEFNITCKFSKTLYALHWYWQKHGEGPTFLMMLSRGGEEMSRDKITATLDEKKQHSSLYITASQRRHSGTYFCAGE
Miniopterus natalensis V265 trdv LDJU01000287.1 228512 FITTEEVTQVQTAISVQEGEAVTMDCTYNTNQKSYALYWYKQLPSGEMVFLIFQFHSSRNANKDRYFVNFQKEKKIISLIIFSLQLADSAKYFCALR
Miniopterus natalensis V266 trav LDJU01000287.1 235355 IMGDAKSTQPDVMEGTAGEAVYLPCSHSTISGSEYIYWYRQIPRQGPEYVIYGLKGNVTERMASLTIAADRKSSTLVLPQVTLRDSAVYYCIVRD
Miniopterus natalensis V267 trav LDJU01000287.1 246647 VSSQELEQSPWSLNIQIIQEGKYFTINCNSSKTVYAFYWYKQKYSEGPISLMIALWKRGEEKSHEKMMAKLDEKKRRSVLHVTASQTSHSGIYFCGVH
Miniopterus natalensis V268 trav LDJU01000287.1 251968 GVSGQQLNQSPQSMSIQEGEDISMSCTSSSTLNTLLWYKQDAGKGLILLITLYRRDELTRNGRLTAQFGGTRKFSFLNISDSELAHAGTYFCAG
Miniopterus natalensis V269 trav LDJU01000287.1 264728 VYSDDKVLQSPPSLAVHEGNSATLKCSYEVANFQGLYWYKQKEDAPTLLFRLITSDFDSEKIKGTLDKKDRLSTLHITATQPGDSATYLCAVE
Miniopterus natalensis V270 trav LDJU01000287.1 272183 PGGADWIKSQGTEVSETEGKNVNLFCSYSTSSRGIADLYWFRQYPDQAPEYILYRAQGYTGKGDAAFATGKFYSKSTANVTNLHIKKVVLSDTALYLCALRK
Miniopterus natalensis V271 trav LDJU01000287.1 288195 SSMAQTVTQPQPEISVQETETVTLGCTYDTSDSDYYLFWYKQPPSGEMLFIIRQEAYKQQNATDNRFSVNFQKATKSFSLRISDSQLEDAAMYFCALS
Miniopterus natalensis V272 trav LDJU01000287.1 298996 SSMAQTVTQPQPEISVQETETVTLGCTYDTSESNYYLFWYKQPPSGEMLFIIRQEAYKQQNATDNRFSVNFQKATKSFSLRISDCQLEDAAMYFCAFSG
Miniopterus natalensis V273 trav LDJU01000287.1 334373 VNGKNGVEQSPQYLSAQEEEFITINCSYSIGMTTLHWMQQNPGGGIVSLFILSLQMKKKGRISATINTKESYSSLHISAAQPRDSAIYLCAVE
Miniopterus natalensis V274 trdv LDJU01000287.1 398630 VSLDIILEPEAKTLTVLVGEPATFRCSITGADLKNYQMSWYKKHEDKSLALVYKLSNSSGDHLRSNIKGKIDALKSQYILDIQKATTKDVGTYYCGSD
Miniopterus natalensis V276 trdv LDJU01000287.1 420996 AMSTIVLVSLDQVVTVSVGESATLGCSMEGETISNYYISWYKQTQDNKMTFIYREGGIYGPGFLGKFQAIVDDSNNKAVLEILEASKREEGIYYCASD
Miniopterus natalensis V362 iglv LDJU01000771.1 9950 ATSQASVTQEASLSTTPGGTVTLTCGSSAGAVTTTNYAGWVQQKPNQVLQGLIGDTSNRLPGVPGRFSGSLLGNKAVLTITGAQPEDEAEYYCALWFSNH
Miniopterus natalensis V363 iglv LDJU01000771.1 17770 SWAQSGLTQEASVSGSLGQKVTLSCVGNSNNVGSYGASWYQQIPGAAPKTVMLGSSRPSGIPERFSGSRSGNTAYLTITGLQPEDEADYYCSAWDRSISN
Miniopterus natalensis V364 iglv LDJU01000771.1 26932 VDSQTVVTQEPSLSVSLGGKVTLTCGLSSGSVTTGYYPSWYQQTPGKAPRTLIYETNKRPSGVPDRFSGSISGNKAALTITGAQPEDEADYYCFLP
Miniopterus natalensis V365 iglv LDJU01000771.1 33250 VDSQTVVTQEPSLSVSPGGTVTLTCGLSSGSVTSSNYPSWYQQTPGKAPRMLIYNTNSRPSGVPDRFSGSISGNKAALTITGAQPEDEADYYCALDMGSYI
Miniopterus natalensis V366 iglv LDJU01000771.1 38788 VDSQTVVTQEPSLSVSLGGTVTLTCGLSSGPVTSSSNEPSWYQQTPGKAPRMLIYNTNSRPSGVPDRFSGSISGNKAALTITGAQPEDEADYYCALYMGSGI
Miniopterus natalensis V367 iglv LDJU01000771.1 43888 VNSQTVATQEPSLSVSPRGTVTFTCVLSSGSVSTSNYSSWYQQIPGRAPHTLISNTNSRPLGVPDRFPGSTSGNKATLIITGAQPEDEAEYYCSL
Miniopterus natalensis V368 iglv LDJU01000771.1 46983 SNSQAVVTQEPSMTVSPGRTVTLTCGSSTGAVTDGHYPYWFQQKSGQAPKTLIYNTNNKHSWTPARFSGSIQGGKAALTLSGAQPEDEALYHCWLVYSGA
Miniopterus natalensis V369 iglv LDJU01000771.1 53418 ATSQASVTQEASLSTTPGGTVTLTCGSSAGAVTTTNYAGWVQQKPNQVLQGLIGDTSNRLPGVPGRFSGSLLGNKAVLTITGAQPEDEAEYYCALWFSNH
Miniopterus natalensis V370 iglv LDJU01000771.1 104897 SWAQSPLTQPSSVSDSLGKSVTISCAGSSNDIGGYNLVSWYQQRPGTAPKLLIYEVNKRPSGIPERFSGSKSGNTATLTISGLQADDEADYYCCSYSSS
Miniopterus natalensis V371 iglv LDJU01000771.1 108762 SWAQSPLTQPSSVSDSLGKSVTISCAGSSNDIGGYNRVSWYQQRPGTAPKLLIYDVNRRPSGIPERFSGSKSGNTATLTISGLQADDEADYYCCSYRSP
Miniopterus natalensis V372 iglv LDJU01000771.1 112623 SWAQSPLTQPSSVSDSLGKSVTISCAGSSNDIGGYNLVSWYQQRPGTAPKLLIYEVNKRPSGIPERFSGSKSGNTATLTISGLQADDEADYYCCSYSSG
Miniopterus natalensis V373 iglv LDJU01000771.1 116717 SWAQPALTQLPSLSRNLGESVTISCAGSSNDIGRYNYVSWYQQRPGAAPKLLIHHVNTRPSGIPERFSGFKSGNTATLIISGLQGDDEADYHCFSYVGS
Miniopterus natalensis V374 iglv LDJU01000819.1 18944 SVASSEMTQPPAVSVSLGQTARITCQGEIVKNYYPGWFQQKPGQAPVLVMYGNNNRPSGIPDRFSTSDSEDTNTLTISGAQAEDEADYYCGLWDNNDK
Miniopterus natalensis V375 iglv LDJU01000819.1 22029 SVASYELTQSPSLSVAPGETASISCTGDLLDKKYTQWFQQKPGQVPVLVIKKDSERPSGIPDRFSGSSSGKTTTLTISGVLAEDEADYYCQSSDSSGN
Miniopterus natalensis V377 ighv LDJU01000943.1 2996 VQGEVQLVESGGAVVKPGGSLRLSCAASGFTFSSYHMHWVRQAPGKGLEWVSAISNSGGSTYYADSVKGRFTISRDNAKNTLYLQMNSLKSEDSAVYFCAR
Miniopterus natalensis V378 ighv LDJU01000943.1 7115 VQGEVQLVESGGAVVKPGGSLRLSCAASGFTFSSYYMHWVRQAPGKGLEWVAVILYDGSSKYYADSVKGRFTISRDNAKNTLYLQMNSLKSEDSAVYFCAK
Miniopterus natalensis V379 ighv LDJU01000943.1 11683 VQGEVQLVESGGSVVKPGGSLRLSCAASGFTFSSFGMNWVRQAPGKGLEWVSYINAGSDSTYYADSVKGRFTISRDNAKNTLYLQMNSLKSEDSAVYFCAA
Miniopterus natalensis V380 ighv LDJU01000954.1 8243 AAGGVWGSRGEAWGSLRLSCVASGFTFSSYYMHWVRQAPGKGLEWVSFLSSTGGSTYYADSVKGRFTISRDNSKNTLYLQMNSLKSEDSAEYFCAR
Miniopterus natalensis V381 ighv LDJU01000954.1 16310 VQAEVQLVESGGAVVKPGGSLRLSCAASGFTFSNYGMSWVRQAPGKGLEWVAAIWSDGSSKYYADSVKGRFTISRDNAKNMVYLQMNSLKSEDSAVYYCAA
Miniopterus natalensis V382 ighv LDJU01001004.1 6466 VQGEVQLVESGGGVVKPGGSLRFSCAASGFTFSSYWMHWVRQAPGKGLEWMGRIYPNDGDTNYAQKFQGRVSMTADTSTSTAFMELSRLSTEDSAVYYCAR
Miniopterus natalensis V383 ighv LDJU01001018.1 8788 VQGEVQLVESGGAVVKPGGSLKLSCAASGFTCSSYYMNWARQAPGKGLEWVSSINTDGSSTSYAESVKGLFTISRDNSKNTLYLQLNSMKSEDSAVYFCT
Miniopterus natalensis V384 ighv LDJU01001018.1 11961 GLCQVQLVESGGGLVQPGGSLSLSCKASGFTFTDYGMNWVRQAPGKGLEWVATVSKPTGKNQWYAPSVQGRFTISRDNPTSTVSLKMTNLKSEDSAVYFCAR
Miniopterus natalensis V385 ighv LDJU01001033.1 4842 VQGEVQLVESGESLVKPGGSLRLSCAASGFTFSSFGMNWVRQAPGKGLEWVAVIWYDGSQKYYADSVKGRFTISRDNSKNTLYLQMNSLKSEDSAVYFCAA
Miniopterus natalensis V386 ighv LDJU01001089.1 6193 VRGEVQLVESGGAVVKPGGSLRLSCAASGFTFSSYWMYWVRQAPGKGLEWVSHINPDGSTTNYADSVKGRFTISRDNAKNTVYLQMNSLRAEDSAVYFCT
Miniopterus natalensis V387 iglv LDJU01001131.1 3288 LCAPPVLTQPPSASASLGASAKLTCTLSSEHSTYTIAWYQQQPGKAPRYLMYLNSGGSHSKGDGIPDRFSGSSSGADRYLTISNLQPEDEADYYCSTGDSSGN
Miniopterus natalensis V453 iglv LDJU01000026.1 9962 SWAQSVLTQPSSVSGALGQKVTISCAGSSSNIGGGYYVNWYQQLPGKAPKTIIYDNSNRPSGVPDRFSGSKSGNSATLTISGLQPEDEADYYCSAWISSLS
Miniopterus natalensis V550 trbv LDJU01000132.1 117393 VRAQTIHQWPPTKVQLMGTPVSLECTVKGTSNPTLYWYRQAEGGALQLLSYSIGLNQTDPQEAQNFKVSRPQDGLFILRSEKPLLGNSGLYLCAWS
Miniopterus natalensis V573 iglv LDJU01000174.1 7866 SWAAVVLTQPASVSGSPGQKVTISCTRSSGSIGDDYVHWYQQRPGSAPTTVIYDDNQRPSGVPDRFSGAIDSSSNAARLTISGLQAEDEADYYCQSYDSNYQ
Miniopterus natalensis V574 iglv LDJU01000174.1 4535 SLSQPVLTQPPSVSVSLGATARLTCTLSSGFNVGDFWIRWYLQNPGSPPRYLLTFHSDSDKHQGSGVPSRFSGSNDASVNAGILLISGLQPEDEADYYCAT
Miniopterus natalensis V578 trgv LDJU01000184.1 1663450 GLGLSKLEQSQISITTEVKTTIDIHCKISSTNFENDVIHWYRQKPSQALEHLIYVSSTKSPARGSKDGKKKKVEARKNSQFLSSILTIDFIEKEDAAIYYCAGWY
Miniopterus natalensis V579 trgv LDJU01000184.1 1655116 GLGQSKLEQPKISISMARDKSALIPCKVFSSTFGIDYIHWYRQKPGQSIEHLLYVVSTTPVRGKNNKFEASKNPPTSTSILKINFLEKEDEAVYFCACWTD
Miniopterus natalensis V580 trgv LDJU01000184.1 1648278 TSGDIQITQALTSITKKKGSTAFLECQIRDILGTNVHIHWYRQKRGQPLKRILYISSNDNVIHEQGVSEERYEARRQGHLLVSLRIHRVEEADAGRYYCACWME
Miniopterus natalensis V581 trgv LDJU01000184.1 1646540 GDTKMKISQDQLSFTQRPDKTVHISCKLSGIPLKNVIVHWYQQKEGEPLRRILYGSTKNDKDNKLNPRLETYRKDDGTFYLIINNVIKSDEATYYCACWD
Miniopterus natalensis V623 trbv LDJU01000273.1 29718 PLDTAVFQTPKYLITQVGNNLSLSCEQKLGHNAMYWYKQDSKKLLKIMFAYNDKNLFLNETVPSRFLPSSSDKAHLKLDVSFLEPGDSAVYLCASSQ
Miniopterus natalensis V624 trbv LDJU01000273.1 24962 RMDPGITQIPRHLVMGMKSKKFLECQQRLGHNAMYWYKQSAQKPPELMFVYNYQKLTENRTDSRRFRPERADSSKSYLHLDALEPDDSAVYLCASSR
Miniopterus natalensis V625 trbv LDJU01000273.1 17769 GPVESGVTQTPTYSIKARKQQVTVRCSFISGHYSVYWYQQAQGQGLQFLIEYYDGQERTKGNIPGRFSVRPTDAHTSELTMSLLELTDSAVYFCASSA
Miniopterus natalensis V626 trbv LDJU01000273.1 13957 LVNASVTQTPKFQVLKTGQKMILRCTQDTNHNRMYWYRQDLGHGLRLLHYSVGPGNKAKGEIPDGYSVNRSKTEDFPLTLEAATPSQTSVYFCASSD
Miniopterus natalensis V627 trbv LDJU01000273.1 6139 SAATGVTQSPRHLIQVLGEKAVLECHPMSGHSYLYWYQQAQGQGPQFLISFYEKGESERGIFPEHFSANQSGDYSSELAISALQLADSAVYLCASSL
Miniopterus natalensis V630 trdv LDJU01000287.1 470017 QGTLCNKVTQSSPDQTVASGSEVTLLCTYESTDLDPELYWYRIRPGHFFQLIIYGNSNGFFGADFTQGRFSVRHSQTHKTFHLVIASVTTEDRATYYCAT
Miniopterus natalensis V725 ighv LDJU01000723.1 191362 VQGEVQLVESGGAVVKPGGSLRLSCAASGFTFSSTWMSWVRQPPGKGLEWVSGINTDGGSTYYAASVKGRFTISRDNAKNTLYLQMNSLKSEDSAVYFCA
Miniopterus natalensis V726 ighv LDJU01000723.1 186069 VQGEVQLVESGGAVVKPGGSLRLSCAASGFTFSSYDMSWVHQAPGKGLEWVGLIYPEGSSTHYADSVKGRFTISRDNAKNTLDLLMNSLKSEDSAVYFCA
Miniopterus natalensis V733 iglv LDJU01000834.1 25337 SLSQPVLTQPPSVSASPGSTARLTCTLSSGFSVGGYWINWFQQKPGSPPRYLLSYYSDSSKNQGAGVPSRFSGSKDTSANAGLLLISGLQPEDDADYYCAAWDS
Miniopterus natalensis V734 iglv LDJU01000834.1 17834 SWAQSVLTQPSSVSGAPGQKVTISCTGSSSNIGGNYVHWYQQLPGKAPKTIIYDSSKRPSGVPDRFSGSKSGNSATLTISGLQPEDEADYYCQTYDDNLSA
Miniopterus natalensis V735 iglv LDJU01000834.1 12695 SLSQPVLTQPPSVSASPGATARLTCTLSSDFNFGDTVIRWLQQKPGSQPRYLLSFKSDSDKHQGAGVPSRFSGSKDASANAGLLLISGLQPEDDADYYCYAWHS
Miniopterus natalensis V736 iglv LDJU01000834.1 4761 SLSQPVLTQPPSVSASLGSTARLTCTLSSGISVGSYYIHWYQQKPRSPPRFLLWYNSDSDKHQGSGVPSRFSGSTDTSANAGLLLISGLQPEDDADYYCMI
Miniopterus natalensis V737 iglv LDJU01000834.1 335 SWAQSVLTQPSSVSGSLGQKVTISCAGSSSNIGGYYVSWYQQLPGKVPKLLIYKYSERPSGIPDRFSGSKSGNSATLTISGLQPEDEADYYCLTYDKSLS
Miniopterus natalensis V738 ighv LDJU01000848.1 45331 VQGEVQLVESGGAVVKPGGSLRLSCAASGFTFSSYDMSWVRQAPRKGLEWVGLIYPDGSSTYYADSVKGRFTISRDNAKKTLYLQMNSLKSEDSAVYFCT
Miniopterus natalensis V739 ighv LDJU01000848.1 38005 VQGEVQLVETGGAVVKPGGSLRLSCAASGFTFSSYAMSWVRQAPGKALEWVSSINPDGGSTSYADSVKGRFTISRDNAKNTLYLQMNGLKSEESAVYFCAA
Miniopterus natalensis V740 ighv LDJU01000848.1 34649 VQGEVQLVESGGGVVKPAGSLGLSCAASGFTFSSYNMDWVRQAPGKGLEWVAAIRYDGSGTYYPDAVKGRLTISRDNAKNMVYLQMNSLKSEDSAVYYCAA
Miniopterus natalensis V741 ighv LDJU01000848.1 24911 VQGEVQLVESGGAVVKPGGSLRLSCAASGFTFSSYYMHWVRQAPGKGLEWVSYISSSGGSTYYADSVKGRFTISRDNAKNTLYLQMNSLKSEDSAVYFCAR
Miniopterus natalensis V742 ighv LDJU01000848.1 21301 DIFVFAGVQGEVQLVKPGGSLRLSCAASGFTFSSNHMHWVCQAPGKGLEWVSYINPGGSSTYYADPVKGRFTISRDNAKNTLYLQMNSLRPEDSAVYFCAA
Miniopterus natalensis V743 ighv LDJU01000848.1 14510 VQSEVQLVESGGAVVKPGGSLRLYCAASGFTFSSYYMHWVRQTPGKGLEWVAVILYDGSSKYYADSVKGRFTISRDNAKNTLYLQMNSLKSEDSAVYFCEK
Miniopterus natalensis V744 ighv LDJU01000854.1 32949 GLCQVQLVESGGGLVQPRGSLSLSCKASEFTFKNYSMNWVCQAPGKGLEWVAGVSQPSGTPQWFPPSVQGRLTISRDNPTGTVSLKMTNMKSEDSAMYYCVR
Miniopterus natalensis V745 ighv LDJU01000854.1 22982 VQGEVQLVESGGAMVKPGGSLRLSCAASGFAFSSFGMNWVRQAPGKGLEWVAVIRYDGGSTYYAASVKGRFTISRDNAKNTLYLQMNSLKSEDSAVYFCAK
Miniopterus natalensis V747 ighv LDJU01000854.1 10392 VQGEVQLVESGGAVVKPGGALRLSCAASGFTFSSWEMNWVRQAPGKGLEWVSYINPDGSSTYYAASVKGRFTISRDNAKNTLYLQMNSLKSEDSAVYFCATD
Miniopterus natalensis V748 ighv LDJU01000854.1 5822 VQSEVQLVESGGALVKPGGSLRLSCAASGFTFSSYYMSWVCQAPGKGLEWVSLINPDGSSTYYAASVKGRFTISRDNAKNTLYLQMNSLKPEDSAGYYCAR
Miniopterus natalensis V749 ighv LDJU01000854.1 1301 VHSQVQLVQPGAEVRKPGASVKVSCKASGYTFTSYYMHWVRQAPGQGLEWMGWIYPNDGATKYAQKFQGRVSMTRDTSTSTAFMELSRLSTEDTAVYFCAR
Miniopterus natalensis V750 ighv LDJU01000884.1 30314 VQGEVQLVESAGAVVKPGGSLRLSCVASGFTFNSYDMHWVRQPPGKGLEWVSYISSGGGSTYYADSVKGRFTISRDNSKNTLYLQMNSLKSEDSAEYFCAR
Miniopterus natalensis V751 ighv LDJU01000884.1 27758 GLCQVQLAESGGGLVQPGGSLSLSCKASGFTFINYSMNWVRQAPGKGLEWVAGVSQPSGTTQWFAPSVQGRFTISRDSPTGTVSLKMTNLKSEDSAMYYCAR
Miniopterus natalensis V752 ighv LDJU01000884.1 24470 VQGEVQLVESGGAVVKPGGSLRLSCAASGFTFSSNAMSWVRQAPGKGLEWVSAISSSGSSTYYADSVKGRFTISRDNAKNTLYLQMNSLKSEDSAVYYCAA
Miniopterus natalensis V753 ighv LDJU01000891.1 28918 VQGEVQLVESGGAVVKPGGSLRLSCAASGFTFSSYAMSWVRQAPGKGLEWVSYISSSGGSTYYADSVKGRFTISRDNAKNTLYLQMNSLKSEDSAVYFCAK
Miniopterus natalensis V754 ighv LDJU01000891.1 13521 VQGEVQLVESGGAVVKPGGSLRLSCAASGFTFSSYAMHWVRQAPGKGLEWVSLISSSGGSTYYADAVKGRFTISRDNAKNMVYLQMNSLKSEDSAVYYCAA
Miniopterus natalensis V755 ighv LDJU01000891.1 6045 VLSQVQLQESGPGLVKPSQTLSLTCTVSGGSVTSSYYWHWIRQSPGKGLQWMGYWTGSTSYNPAFQGRISITADTSRNQFSLELRSVTTEDTAVYYCA
Miniopterus natalensis V756 ighv LDJU01000929.1 24896 VQGEVQLVESGGGVVKPGGSLRLSCAASGFTFSNYAMSWVRQAPGKGLEWVAVIWSDGSSKYYADSVKGRFTISRDNAKNMVYLQMNSLKSEDSAVYYCAR
Miniopterus natalensis V757 ighv LDJU01000929.1 16972 VQGEVQLVESGGAVVKPGGSLRLSCAASGFTFSSYAMHWVRQAPGKGLEWVAAISYDGSSKYDAASVKGRFTISRDNAKNIEYLQMNSLKSEDSAVYFCAK
Miniopterus natalensis V758 ighv LDJU01000929.1 2088 VQGEVQLVESGGAVVKPGGSLRLSCAASGFTFSSYNMDWVRQAPGKELEWVSYISSTGGSTYYADSVKGRFTISRDNAKNMLYLQMNSLKSEDSAVYFCA
Miniopterus natalensis V759 ighv LDJU01000946.1 19422 VQGEVQLVESGGAVVKPGGSLRLSCAASGFTFSSYWMHWVRQAPGKGLEWVSGMGISGTTYADSVKGRFTISRDNAKNTLYLQMNSLKSEDSAVYFCAK
Miniopterus natalensis V760 iglv LDJU01000975.1 17994 LCAPPVLTQPPSASASLGASAKLTCTLSSEHSNYAIAWHQQQPGKAPRYLMYLNSDGSQSKGDGIPDRFSGSSSGADRYLTISNLQPEDEADYYCQTWGSGN
Miniopterus natalensis V761 iglv LDJU01000975.1 12797 LCAPPVLTQPPSASASLGASAKLTCTLSSEHSTYTIAWHQQQPGKAPRYLMYLNSDGSHSKGDGIPDRFSGSSSGADRYLTISNLQPEDEADYYCHTWDSSGN
Miniopterus natalensis V762 iglv LDJU01000975.1 6393 LCAPPVLTQPPSASASLGASAKLTCTLSSEHRTYTIAWYQQQPGKAPRYLMYVRSDGSHGKGDGIPNRFSGSSSGADRYLTISNLQPEDEADYYCNTWDGNTN
Miniopterus natalensis V763 iglv LDJU01000986.1 15670 SWAQSVVTQPSSVSGALGQTVTISCAGSSSNIGSGYYVQWYQQLPGKAPKTIIYENSDRPSGVPERFSGSTSGNSATLTISGLQPEDEADYYCQTYDNSLS
Miniopterus natalensis V764 iglv LDJU01000986.1 7998 SLSQPVLTQPPSVSASPGSTARLTCTLSSGFSVGGYWINWFQQKPGSPPWYLLEYKSDSEKHQGAGVPSRFSGSKDASANAGLLLISGLQPEDDADYYCAAWDG
Miniopterus natalensis V765 iglv LDJU01000986.1 1711 VNSQTVVTQEPSLSVSPGGTVTLTCGVSSGSVTTGNYPGWFQQTPGKAPRRLIYSTNSWPSGVPDRFSGSISGNKAALTIRGAQPEDEAEYHCILHLGSSLH
Miniopterus natalensis V766 ighv LDJU01001006.1 13015 VQGEVQLVESGGAVVKPGGSLRLSCAASGFTFSSYHMHWVRQAPGKGLEWVAVILYDGSSKYYADSVKGRFTISRDNAKNTVYLQMNSLKSEDSAVYYCAA
Miniopterus natalensis V767 ighv LDJU01001006.1 4673 VQGEVQLVESGGAVVKPGGSLRLSCAASGFTFSSYGMHWVRQAPGKGMEWVSHISSTGGSIYYPDTVKGRFTITRDNAKNTLYLQMNSLKSEDSAVYYCAR
Miniopterus natalensis V768 iglv LDJU01001016.1 6289 SSSQAVVTQEPSLTVSPGVTVTLTCTSSTGAVTSGHYPYWIQQKSGQVPKTLIYNTNNKHSWTPARFSGSIQGGKAALTLSGAQPEDEAEYYCALWYSDH
Miniopterus natalensis V769 ighv LDJU01001026.1 4047 VHSQVQLIQPGAEVRKPGASVKVSCKASGYSFTSYGMNWVRQAAGKSLQYIGWINTNTGKPTYAQGFSERFVFSMDTTVSTAFLQINDLKSEDSAVYYCAR
Miniopterus natalensis V770 ighv LDJU01001051.1 9447 VQGEVQLVESGGAVVKPGGSLRLSCAASGFTFSSYYMSWVRQAPGKGLEWVSHISNTGGSTYYADSVKGRFTISRDNAKNTLYLQMNSLNSEDSAVYFCATD
Miniopterus natalensis V771 ighv LDJU01001085.1 7060 VQGEVQLVESGGAVVKSGGSLRLSCAASGFTFSSRDMSWVCQAPGKGMEWASGINTDGSSTSYAESVKGRFTISRDNAKNTFYLQMNSLKSEDSAVYFCT
Miniopterus natalensis V772 ighv LDJU01001085.1 1316 VQGEVQLVESGGVVVKPGGSLRLSCAASGFTVSSCYMHWVRQAPGKGLEWVSYISSGGGSTYYAASVKGRFTISRDNAKNTLYLQMNSLKSEDSAVYFCAR
Miniopterus natalensis V773 ighv LDJU01001108.1 591 VQGEVQLVESGGAVVKPGGSLRLSCAPSGFTFSSYWMHWVRQAPGKGLEWVAVISYDGSSKYYANSVKGRFTISRDNAKNTLYLQMNSLKSEDSAVYFCAK
Miniopterus natalensis V774 iglv LDJU01001216.1 5552 LCAPPVLTQPPSASASLGASAKLTCTLSSEHRTYTIAWYQQQPGKAPRYLMYVRSDGSHGKGDGIPNRFSGSSSGADRYLTISNLQPEDEADYYCNTWDGNTN
Miniopterus natalensis V775 ighv LDJU01001232.1 2407 VQGEVQLVESGGAVVKPGGSLRLSCAASGFTFSSYDMSWVRQTPGKGLEWVSYINPDESSTYYADSVKGRFTTSRDNAKNMLYLQMNSLKSEDSAVYFCAA