WGS Statistics
Organism WGS Record. Vs Total IGHV IGLV IGKV TRAV TRBV TRGV TRDV
Capra hircus LWLT00000000.1 (LWLT01) 248 6 26 6 116 54 5 35
Capra hircus AJPT00000000.2 (AJPT02) 250 6 24 6 122 59 6 27
Vgene Table
Organism Vgene Locus contig Contig Pos. AA sequence
Capra hircus V56 trbv LWLT01000003.1 14503570 VRAQTIHQWPSTRVQPAGSPLSLECTVKGTSSPNLYWYRQEAGGSLQLLFSSVGVDQIEPREFQNFEASRPQDGQFILSSKKLQLNNSGFYLCAWS
Capra hircus V64 trgv LWLT01000003.1 70200157 IQQEIRLSQRSVMVGSAGGAMTMPCQVSRSVNYVHWFRQLEGQAPERLLYLALSKRDVQWDSVLGGDKVSAARGGDGKSCTMSLRKLAKSDEGLYYCAAWD
Capra hircus V182 igkv LWLT01000009.1 46797569 SNGAIVLTQTPRSLSVIPGETASISCRASQSVQNRYGDNFLHWYVQKPSQSPQLLIYAASNRASGVSDRFTGSGSGTDFTLKISRVEAEDAGVYYCQQSKETP
Capra hircus V183 igkv LWLT01000009.1 46809110 SSGDVVLTQTPLSLSVIPGGTASISCKSSQSLKYSDGNTYLYWFQHKPGQSPRRLIYLVSNRDTGVPDRFTGSGAETDFTLTISSVQAEDAGVYYCFQAINYP
Capra hircus V184 igkv LWLT01000009.1 46841336 SIGAMMQTQTLRSLSVIHGEKASISCRASQSIQNRYGYNFLHWYVQKPSQSPQLLIYRASNWESGVPDRFTSSGLGADTILIVSRVEAEDARVYYCQQSLQ
Capra hircus V185 igkv LWLT01000009.1 46850567 SSGDVVLTQTPLSLSVIPGETASISCKSSQSLVHSDGKTYLNWIKHKPGQSPEGLIYQVSNRYSGVSDRLTGSGSGTDFTFTISRVQAEDAGVYYCYQGTEAP
Capra hircus V186 igkv LWLT01000009.1 46880249 ARCDIQVTQSPSSLSASLTERVSITCRTSQSVSNYLNWYQQKPGQAPKLLIYYATRLHTDVPSRFSGSGSGTDYTLTISSLEADDAATYYCLQGYS
Capra hircus V187 igkv LWLT01000009.1 46895807 ASGEAVLYQTPAYIAVPLGESISITCRANQSISDYLSWHKQKPGQAPMILIYDADNRRNGVPERFTATQSGTDFVFTISQIEADDAAMYYCQQSYVFP
Capra hircus V214 trav LWLT01000010.1 77331611 SAGKGVEQPTEWTAMEGASAQVNCTYQTSGFNGLFWYQQHDGGAPVFLSYNVLDGLETRGHFSSFLRRSDACSYLLLKELHMKDFASYLCAVI
Capra hircus V215 trav LWLT01000010.1 77410789 TLSLAKTSQPIIIDSYEGQEVNIPCNHTTIAISEYIFWYRQFPNQGPQFIIQGYTTTVENEVASLLIPPDRKFSTLSLPRASLGDAAVYYCIVQD
Capra hircus V217 trav LWLT01000010.1 77433341 KSRGEKVEQYPSFQSVQEGDNCVINCTYTDSASTYFVWYKQEPGKGLQLLIHTLSNVDKKEGQGLIVLLNKKNKHLSLNITATHPGDSATYFCAAR
Capra hircus V218 trav LWLT01000010.1 77470828 DSRGQSVTQPDDPVLVSEGTSLELKCNYSYGATPYLFWYVQYPGQRPQLLLKSFSGNTVVQGIRGFVAEFRSSDFSFNLRKFSAHWSDSAEYFCALS
Capra hircus V220 trav LWLT01000010.1 77487993 VSLGNKVEQSPSTLSVQQGNNCFINCTYTDVTTSYFPWYKQEPGKGPQLLIDISSNMGKNEGQRLTVLLNKTTKHLSLHITTTEPGDSAVYFCAAS
Capra hircus V221 trdv LWLT01000010.1 77496883 SIIAEKITQDPQLMLVQEKEAVTLDCTYDTSDSSYSLFWYKQPNSGAMIFLLSQDSYGKENAAEGRYSLNFQKASKSITLVISASQLEDSAVYFCALRE
Capra hircus V222 trav LWLT01000010.1 77506677 VSLGNKVEQSPSTLSVQEGNSSVITCTYTDGNSDYFPWYKQEPGKGPQLLIAIHSNKDKEEDQRLTVLLNKTAKRLSLHIATTEAGDSAVYFCAAS
Capra hircus V223 trav LWLT01000010.1 77519656 QTRGDSVSQMDGQVTLLEGATLTVNCTYSATRYPTLFWYVQYPGEGPQLLLKATKASDKGTNKGFEATYNAKTTSFHLEKASVQESDSAVYHCALS
Capra hircus V224 trav LWLT01000010.1 77523299 GVRGVKVEQSPSILSLQEGANSTLWCNFSDTVNSVQWFQQNPGGSLTRLFFIASGTKQNERLSSTVNSKEWYSTLHITASQLEDAATYLCAVE
Capra hircus V225 trav LWLT01000010.1 77527356 VSLGNKVEQSPSTLSVQEGNSSVITCTYTDTASDCFPWYKQEPGKGPQLLVAIHSNMGEKKDQRLTVLLNKTTKHLSLHIATIQPGDSAVYLCAAR
Capra hircus V226 trav LWLT01000010.1 77531178 SIIAQKVTQDQPQVLGQEKEAVTLDCKYDTSDSRYSLLWYKQPSSGGMILLIRQDSYNQQNATEGRYSLNFQKASKSITLVISASQLEDSAVYFCALSE
Capra hircus V227 trav LWLT01000010.1 77547330 VSGKNQVEQSPPSLAVLEGENCIFQCNYTVSPFNNLRWYTQDTGRGLVSLITMTYSDNKKSNGRYTATMDATAKHSSLHLTAAQLSDPAFYICVVG
Capra hircus V228 trav LWLT01000010.1 77562505 VSSQQNTVEQSPASLPVPEGAVASLGCTYSDSNSQYFTWYRQYLGKGPEFLLNVYLDKDKEEGKFTAQSNKTNKRVSLRIRDSEPSDSATYLCAV
Capra hircus V229 trav LWLT01000010.1 77576342 RTRAQTVTQPESHISVSKGDPVQVKCSYSYSGSPVLFWYVQYSRQHLQLLLKHTSRENIQGFTAELSRAEASFHLKKPSAQEGDSAVYYCALG
Capra hircus V230 trav LWLT01000010.1 77582382 VNSQQGEQNLQTLSIQEGENITMNCSYKSITITALQWYRQDSRRGFVHLILMRSNERQKHSGRLLFTLDSSIQSSSMSIMASQAEDTATYFCAP
Capra hircus V231 trav LWLT01000010.1 77602019 GTSGDSVTQTEHVVTLPETASLTLKCTYQSSYSVSLFWYVQYQNKELELLLKSSLGNQKVTSRGFEATHISSDSSFHLQKSSVKTSDSAVYYCALS
Capra hircus V232 trav LWLT01000010.1 77607451 GTNGDSVNQTEGPVTVSEGALMTLNCTYQTANLAPYLFWYIQHLNKAPRLLLKGLMSDPKPKSEGFQATLVQSDRSFHLQKRAVQASDSAVYYCALS
Capra hircus V233 trav LWLT01000010.1 77618619 GTNGDSVTQTEGPVTVSEGALMTLNCTYQTADPAPYLFWYIQRLNKAPQLLLKGSMSDLKPKSEGFQATLVKNNSSFHLQKQAVQASDSAVYYCALS
Capra hircus V234 trav LWLT01000010.1 77628223 GTNGDSVNQTEGPVTVSEGTLMTLNCTYQTTYSNPYLYWYIQHLNKAPQLLLKGLTADKKVEHEGFQATLVQSDRSFHLQKRAVQASDSAVYYCALS
Capra hircus V235 trav LWLT01000010.1 77633669 GTNGDSVTQTEGPVTVSEGALMTLNCTYQTAGLTPYLYWYVQHLNKAPQLLLKGSARDPKPKSEGFQATLVQSDRSFHLQKRAVQASDSAVYYCALS
Capra hircus V236 trav LWLT01000010.1 77641860 GTNGDSVNQTEGPVTVSEGALMTLNCTYQTANPAPYLFWYIQHLDKAPRLLLKGSMSDPKPKSEGFQATLVQSDRSFHLQKRAVQASDSAVYYCALS
Capra hircus V237 trdv LWLT01000010.1 77649225 SGVAQKVTQDQPYITSQIGQSVILNCRYEVRSSGYTHYLFWYKQLPSGEMTFLIRQESSGPNARNGRYSVNFQRARNSISLTISALQLEDSAKYFCAVWE
Capra hircus V238 trav LWLT01000010.1 77654281 VNAQQISQIPQFLLLQEGENFTTYCNSSSTLTNLQWYKQRPGGSPVLLMILAKAGEVKTEQRLTGRLGETRKHGSLHLAAAQLSDAGTYFCA
Capra hircus V239 trav LWLT01000010.1 77662632 TVINAKTTQPNSMDCAEGENVNLPCNHSTIGGDDYIHWYRQNPNQSPQYLIHGLRGTVNSSMASLHIAPDRKSSTLVLPQVTLRDAAVYYCVLRE
Capra hircus V240 trav LWLT01000010.1 77665634 VRGVDVEQSPPALSLQEGASYTLQCNFSTSPQSVNWYLQNSGGHLIQLFYVPSGTKQDGRLKATTAPAERRSSLHISSSQTTDSGTYFCAAQHSAPQ
Capra hircus V241 trdv LWLT01000010.1 77672333 SGVVQKVTQDQPDITRQVEQSVTLNCLYEVSWYMSFYSIFWYKQLPNGQMTYLIRQYSDVGNARDGRYSVNFQKADKSISLTISALQLEDTAKYFCALRE
Capra hircus V242 trav LWLT01000010.1 77677607 VRGLDVEQSPPALSLQEGASHMLRCNFSASVTNVQWYLQNPSGRLIHLFNVPSGTKQDGRLKATTIPTERRSSLHVSSSQTTDSGTYFCAAQHSAPQ
Capra hircus V243 trav LWLT01000010.1 77684179 MNGQQIKHFPEFLLLQEGENFTTYCNSSSTFYSLQWYKQRPGGSPVLLMILAKAGEAKTEQRLAGRLRETRQHGSLHLAAAQLSDAGTYFCAE
Capra hircus V244 trdv LWLT01000010.1 77691458 SGVAQKVTQNQPDVSSQVGQSVTLNCRYETSWSYYYLVWYKQLPSGQMTYLIQQYSGHSNARNGRYSVNFQRADKSISLIISSLQLEDSAKYFCALRD
Capra hircus V245 trav LWLT01000010.1 77713291 GTGAQLVTQPDGHIVSEGNRLELRCNCSYGGSIYLFWYVQYPSQGLQLLLKYLSGPTRVKGIKGFEAEFRKDENSFHLMKASAHWSDSAKYFCALC
Capra hircus V246 trav LWLT01000010.1 77736752 GTSGDSVTQTEGVVILPEKASLTLKCTYQSSYSDILFWYVQYKNKELELLLKSSLGDQKVTSRGFEATHISNDSSFHLQKSSVQTSDSAGYYCALS
Capra hircus V247 trav LWLT01000010.1 77851280 KSRGEKVEQYPSFQSVQEGDNCVINCTYIDSASDYFVWYKQEPGKGLQLLIHTLSNVDKKEGQGLIVLLNKKNKHLSLNITATHPGDSATYFCAAR
Capra hircus V248 trav LWLT01000010.1 77879506 DSRGQSVTQPDDPVLVSEGTSLELKCNYSYGATPYLFWYVQYPGQRPQLLLKYFSGNTVVQGTRGFLAEFKSSDFSFNLRKFSAHWSDSAEYFCALS
Capra hircus V250 trav LWLT01000010.1 77926239 VSSQQNTVEQSPASLPVPEGAIASLGCTYSDSASQYFTWYRQYPGKGPEFLLLVYSDKDKEEGKFTAQSNKTNKHVSLHIRDSEPSDSATYLCAV
Capra hircus V251 trav LWLT01000010.1 77942273 GTRAQTVTQPESHIPVSEGDPVQVKCSYSYSGSPVLFWYVQYPRQRLQLLLKDTSRESIQGFTAELSRAEASFHLKKPSAREEDSAVYYCALG
Capra hircus V252 trav LWLT01000010.1 77946814 VNSQQGEQNLQTLSIQEGENVTMNCSYKSITITALQWYRQDSRRGFVHLILMRSNERQKHSGRLLFTLDSSIQSSSVSIVASQAEDTATYLCAP
Capra hircus V253 trav LWLT01000010.1 77958832 GTSGDSVTQTEGVVILPEKASLTLKCTYQSSYSDFLFWYVQYKNKELELLLKSSLDNQKVTSRGFEATHISSDSSFHLQKSSVQTSDSAVYYCALS
Capra hircus V254 trav LWLT01000010.1 77994349 NVFDAKTTQPSSMDYPEGEDVSLPCNHSTISGNEYIHWYRQNPNQSPQYIIHGLRDTVNSSMASLHIASDRKSSTLVLPQVTLRDAAVYYCILRE
Capra hircus V255 trav LWLT01000010.1 78015342 TVIDAKTTQPNSMDCAEGEDVNLPCNHSTIGGNDYIHWYRQNPNQSPQYVIHGFRDTVNGSMASLTIASDRKSSTLVLPQVTLRDAAVYYCILRE
Capra hircus V256 trav LWLT01000010.1 78026669 MNGQQIKHFPEFLLLQEGENFTTYCNSSSTFYNLQWYKQSPGGSPVFLMILTKPGETKTEQRLTGRVGETRHHSSLHLAAAQLSDVGTYFCAE
Capra hircus V257 trdv LWLT01000010.1 78032602 SGVAQKVTQDQPDVSSQVGQSVTLNCRYETSWSYYYLVWYKQLPSGQMTYLIQQYSENSNTRNGRYSVNFQKADKSISLIISSLQLEDSAKYFCALCD
Capra hircus V258 trav LWLT01000010.1 78041786 NVFDAKTTQPSSMDHPEGEDVNLHCNHSTISGDDYIHWYRQNPNQSPHYVIRGFRDTVNSSMASLHIASDRKSSTLVLPQVTLRDAAVYYCIVRE
Capra hircus V259 trav LWLT01000010.1 78052567 GTGAQLVTQPDGHINVSEGNRLELRCNYSYSGSIYLFWYVQYPSQGLQFLLKYLSGPTRVKGIKGFEAEFKNDENSFHLMKASAHWSDSAKYFCALC
Capra hircus V260 trdv LWLT01000010.1 78072182 SGVAQRVIQDQPDISSQLGQSVTLNCRYGTTWSSYYLFWYKLLPSGEMIYLIHQVSSGQNARNGRYSVNFQKARKSISLTISDLQLEDSAEYFCALWE
Capra hircus V261 trav LWLT01000010.1 78076853 DSRGQSVTQPDDPVLVSEGTSLELKCNYSHSATLYLFWYIQYPRQRPQLLLKYFSGNTVVQGIRGLVAEFKSSDFSFNLRKFSAHWRDSAEYFCALS
Capra hircus V262 trav LWLT01000010.1 78087737 LSGEDRVEQSPQTLRIQEGDSLSLNCSYTVSSFSGLQWYRQDPGKGPELLFLLYSVGDEKQKERLRATLLKKGSSLLIGAPKPEDSATYLCAVE
Capra hircus V263 trav LWLT01000010.1 78099782 GAGAQSVTQPDDHITVSEGARLELKCNYSSSGSPYLFWYVQYPNQGLQLLLKYESGDNLVSGIKGFEAEFRRSEKSFHLKKIPAHWKDSAKYFCVLS
Capra hircus V264 trav LWLT01000010.1 78119606 NVIDAKTTQPDSMDCAEGENVYLPCNHSTIGGDEYVHWYQQNPNQSPQYVIHGLQGTVNSSMASLHIAPDRKSSTLVLPQVTLRDAAVYYCVLRE
Capra hircus V265 trav LWLT01000010.1 78122598 VRGVDVEQSPPALSLQEGASYTLQCNFSTSPQSVNWYLQNPGGHLIQLFYIPSGTKQDGRLKATTVPAERRSSLHISSSQTTDSGTYFCAVQHSAPQ
Capra hircus V266 trdv LWLT01000010.1 78128651 SGVAQKVTQDQPDITRQVEQSVTLNCQYEVSWYMEYYSIFWYKQLPRGQMTYLIRQYSEDGNARDGRYSVNFQKADKSISLTISALQPEDTAKYFCALRE
Capra hircus V267 trav LWLT01000010.1 78422953 GAGAQSVTQPDDHITVSEGARLELKCNYSSFFSPYLFWYVQYPNQGFQLLLKYESGDNLVSGIKGFEAEFRRSEKSFHLRKIPAHWKDSAKYFCVLS
Capra hircus V268 trav LWLT01000010.1 78427723 VRGMDVAQSPPALSLQEGASSTLWCNFSTFTGDVWWYLQNSGGRFIHLIYIPSGTKQEGRLNATTVPTERRSSLHISSSQTTDSGTYFCAVQHSAPQ
Capra hircus V269 trdv LWLT01000010.1 78441340 SGVAQKVTQDQPYITSQIGQSVILNCRYEVSWSGYTHYLFWYKHLPSGEMTFLIRQESSGPNARNGRYSVNFQRARNSISLTISALQPEDSATYFCAVWE
Capra hircus V270 trav LWLT01000010.1 78446310 VNAQQISQIPQFLLLQEGENFTTYCNSSSTFYSLHWYKQSPGGSPVLLMILAKGGEVKTEQRLTGRLGETIKHGSLHLAAAQLSDAGTYFCA
Capra hircus V271 trdv LWLT01000010.1 78457770 SGVAQNVTQNQPVIISQVGKIVTLNCQYEISRNVHDYWIFWYQQLPSGEMTYLIHQYSEDRNERDGRYSVNFQKARKSISLTISFLKLEHSAKYFCALW
Capra hircus V272 trav LWLT01000010.1 78480460 VRGLDVEQSPPALSLQEGASHMLRCNFSGSVSNVQWYLQNPSGRLIQLFNVPSGTKQDGRLKATTIPKERRSSLHISSSQTTDSGTYFCAAQHSAPQ
Capra hircus V273 trav LWLT01000010.1 78506397 TVIDAKTTQPNSMDCAEGEDVNLPCNHSTVSGDDYIHWYRQNPNQSPQYVIHGLRGTVNGSMASLTIASDRKSSTLVLTQVTLRDAAVYYCALRE
Capra hircus V274 trav LWLT01000010.1 78515167 MNGQQIKHFPEFLLLQEGENFTMYCNSSSLLSSLQWYKQRPGGSPVLLMILAKSGEVKTQQRRTGQFGESRQHSSLHLTAAQLSDAGTYFCAE
Capra hircus V275 trdv LWLT01000010.1 78521564 SGVAQKVTQDQSDVSSQLGQSVTLNCRYETSWSTYYLYWYKQLPSGQMTYVIHQGSQVTNARKDRYSVNFKKADKSISLTISALQLEDSAKYFCALSV
Capra hircus V276 trav LWLT01000010.1 78530044 SVINAKTTQPSSMDCAEGEDVNLPCNHSTIGANDYIHWYRQNPNQSPQYIIHGLRDTVNSSMASLHIASDRKFCTLVLPQVTLRDAAVYYCVLRE
Capra hircus V277 trav LWLT01000010.1 78533012 VRGVDVEQSPPALSLQEGASYTLRCNFSTFPQSVNWYLQNPGGRIIHLFYIPSGTKQDGRLNATTVPKDGHSSLHISSSQTTDSGTYFCAVQHSAP
Capra hircus V278 trdv LWLT01000010.1 78546696 SSVSQKVTQYQPDITSQARNVVILNCRYETSWNVYTCWIFWYKQLPSGEMTYLIPQYSADGNERDGHYSVNFQKAHKFISLTISSLKLEHSGKYFCTLWE
Capra hircus V279 trdv LWLT01000010.1 78559402 SGVAQSVTQDQPDILSEVGKTVTLNCRYETSWNMLSYYIFWYKQLPSGQMTYLIRQHSDDGNARDGRYSVNFQKAHKSISLTISALELEDSAKYFCVLRV
Capra hircus V280 trav LWLT01000010.1 78578076 TVIDAKTTQPSSMDCAEEEDVTLPCNHSTISGNEYILWYRQNPNQSPQYVIHGLRGTVNGSMASLNIASDRKSSTLVLPQVTLRDAAVYYCIVRE
Capra hircus V281 trdv LWLT01000010.1 78589783 SSVAQRVTQDQPDISSQVGEVVTLSCRYETIQSRYNIFWYKQLPSGEMIYLIGQGSSSQNARYGRYSLNLQRSRKSISLTISDLELEDSAKYFCALWE
Capra hircus V282 trdv LWLT01000010.1 78602578 SGVAQKVTQDQPDIASQVGESAAMNCQYETSRNSYNIFWYKQLPSGEMIYLIGQNSYSPNARDGRYSINFQRSLKAISLIISALKLEDSAKYFCALWE
Capra hircus V283 trav LWLT01000010.1 78608524 VSSLLTVEQRPPLLRVQEGESTNFTCSFPSSSFYALHWYRWEPAKGPKNLFVISVNGDEKKQGRVRVTLNTKEGYSSMYIRGSQPEDSATYLCA
Capra hircus V284 trdv LWLT01000010.1 78630339 SGVAQKVTQDQSDVSSQVGQSVTLNCRYETSWGAYYLFWYKQLPSGQMTYLIQQYSGYSNARNGRYSVNFQRADKSISLIISSLQLEDSAKYFCAFCD
Capra hircus V285 trav LWLT01000010.1 78638304 NVIDAKTTQPSSMDCAEEEDVTLTCSHSTIGGNVYIHWYLQNPNQSPQYVIHGLRGTGNSSMASLTIDSDRKSSTLVLPQVTLRDATVYYCALRE
Capra hircus V286 trav LWLT01000010.1 78647930 GTGAQLVTQPDSHINVSEGNRLELRCNYSYGGSIYLFWYVQYPSQGLQFLLKYLSGPTRVKGIKGFEAEFKNDENSFHLMKASAHWSDSAKYFCALC
Capra hircus V287 trdv LWLT01000010.1 78665118 SCVAQRVIQDQPDISGQLGQSVTLNCQYATSWSYNYLFWYKLLPNGEMIYLISQVSSGQNARNGRYSVNIQKAHKSISLTISDLQLEDSAEYFCALWD
Capra hircus V288 trav LWLT01000010.1 78679718 VRGVDVEQSPPALTPQEGASSTLWCNFSTFADSVWWYLQKPGGRLIHLIYIPSGTRQEGRLNATAVPKERRSSLHISSLRTTDSGTYFCAVWHSAPQ
Capra hircus V289 trdv LWLT01000010.1 78692730 YSVAQQVTQVQTAVPSQVGQTVTLNCRYEVSWTTAFYYIFWYKQLPRGEMTLLIRQYSEHGNTRNGRYSVNLQKAHKSLSLIISALQLEDSAKYFCALWE
Capra hircus V290 trav LWLT01000010.1 78711584 MNGQQIKHFPEFLLLQEGENFTTYCNFSSTFYNLQWYKQRPGGSPVLLMILAKGGEVKTQQRLTVRFGESRQHSSLHLMGTQPSDVGTYFCAA
Capra hircus V291 trav LWLT01000010.1 78733198 ESTQQLEQNPKFLRIQEGGNVTVYCNSSSTFTFFQWYRQKPEEGPVLLVTLTKPKEVKEQKRIRAEFGEARKDSSLLITAAQPGDAGTYLCAG
Capra hircus V292 trav LWLT01000010.1 78744364 LSVQTKVEQSPGVLTLQEGRNSSLICNYSISIRSVQWFQQNPDGRLISLFYIASGMQQKGRLKSTINSKESYSQLYIRDSQPGDSATYFCAVE
Capra hircus V293 trav LWLT01000010.1 78770443 VLGDSKTTQPNSVEGTEEEPVHLPCNHSTISGSEYVYWYRQIPRQGPEYLIHGLNNNVTNRMASLSIAKDRKSSTLVLPQVTLRDTAVYYCILR
Capra hircus V294 trav LWLT01000010.1 78777597 LRVQMKVEQSPRVLTLQEGRNSSLICNYSISMTSVQWFQQNPDGRLISLFYIASGMQQKGRLKSTINSKERYSQLYIRDSQPGDSATYFCAVE
Capra hircus V295 trdv LWLT01000010.1 78787562 SSMADKVTQAQTTVTGQEGEAATIGCTYETSRTYYTLFWYRQFPGGRMEFLIYQDSNQANARRDRYSVNFQKGKKTISLTISSLHLADSAKYFCALWE
Capra hircus V296 trav LWLT01000010.1 78798897 ILGDSKTTQPNSVEGTEEDPVHLPCNHSTISGPEYIYWYRQIPRQGPEYLVHGLNNNVTNRMASLSIAKDRKSSTLVLPQVTLRDTAVYYCILR
Capra hircus V297 trav LWLT01000010.1 78806932 VSAQQLNQSPQSMSIQEGEDLSMNCNSSSTLNLLLWYKQDAGEGLILLIKLLKGGELARNGKLTAQFGGTRKDSLLNNSAFEPKDGGTYFCAG
Capra hircus V298 trav LWLT01000010.1 78819907 VKSDDDVMQSPSSLIVLEGSNATLSCSYKVTNFQSLHWYKQEEKVPTFLFALISTGIEKTSGRLRGTLDRKELLSTLHITVTKPGDSATYLCAVE
Capra hircus V299 trav LWLT01000010.1 78826088 LRRADWIRSQESEVSGAEGKTVSLFCNYYTSSRSFVSLFWYRQYPNQAPEYILYRQWGSSGKGYASFATERFYSDNTANTTNLYIRKVVPADTALYLCALE
Capra hircus V300 trav LWLT01000010.1 78870755 LSVAQTVTQPQPEESVQEADTVTLDCTYSTSESDYYLFWYKQPPSGETVFIIHQYAYEQQNATNDRYSVNFQKEAKAFSLRISDSQLEDAAMYFCAYSG
Capra hircus V301 trav LWLT01000010.1 78873958 PSVAQTVTQPQPEESVQETGTVNLHCTYTTSESNYYLFWYKQPPSAEMVFIIRQNAYEQQNATNDRYSVNFQKEAKAFSLKISDSQLEDAAMYFCAYSG
Capra hircus V302 trdv LWLT01000010.1 78937601 SNNVESADVPTVYKKEGESVTVECKFSVSYTYYMMYWYRQPSSGEMIYMINIYSQSKQTREGRYSVEFYKPNQMLKLTISALTLSDSAIYFCAIRE
Capra hircus V303 trdv LWLT01000010.1 79002723 VMSAVVLVPQDQEKTVPVGKSVTLSCSMKGAMFISKHYIFWYRKTPGNTMTFIYREEGVYGPGFEDNFRGKIDNSTNQAMLEILKASERDEGFYYCASD
Capra hircus V381 trav LWLT01000015.1 52134607 AHAQMVQVNDSMYGFIGTDVVLHCSFANPLPGVKITQVTWQKATNGSKQNVAIYNPAMGVSVLAPYRERVEFLRPSFTDGTIRLSRLELEDEGVYICEF
Capra hircus V418 iglv LWLT01000018.1 532310 SWAQAVLTQPPSVSGSPGQRVSITCSGSSSNIGGGNYVSWYQQLPGSAPKLLIYCTSSRASGVPDRFSGSRSGNTATLTISSLQAEDEADYYCATYESSSYN
Capra hircus V419 iglv LWLT01000018.1 549591 SWAQAVLTQPPSVSGSPGQRVSITCSGSSSNIGSSGVAWFQQLPGSGLRIVIYYSSNRPSGIPDRFSGSRSGNTATLTISSLQAEDEADYYCASYQSGYSY
Capra hircus V420 iglv LWLT01000018.1 556144 SWAQAVLTQPSSVSRSPGQRVFITCSGSSSNVGTGNYVGWYQQVPGSAPKLLIYGATSRASGVPDRFSGSRSGNTATLTISSLQAEDEADYYCSSYQSGYSY
Capra hircus V448 ighv LWLT01000019.1 68946569 VLSQVQLQESGPSLVKPSQTLSLTCTVSGFSLTSYAVGWVRQAPGKALEWVGGISSGGSTGYNPALKSRLSITRDTSKSQVSLSLSSVTTEDMALYYCAR
Capra hircus V449 ighv LWLT01000019.1 68961452 VLSQVQLQESGPSLVKPSQTLSLTCTVSGVSLTSYAVGWVRQAPGKALEWLGIIYSGGSTYYNSALKSRLSITRDTSKSQVSLSLSSVTTEDTAVYYCAR
Capra hircus V450 ighv LWLT01000019.1 68974828 VLSQVQLQESGPSLVKPSQTLSLTCTVSGFSLTSYGVGWVRQAPGKALEWLGGISSGGSTGYNPALKSRLSITRDTSKSQVSLSLSSVTTEDTAVYYCAR
Capra hircus V592 trav LWLT01000251.1 9552 VSLGNKVEQSPSTLSIQEGDSSVITCTYTDGNSEYFPWYKQEPGKGPQLLIAIRSNKDKEEDQRLTVLLNKTAKSLSLHIATTEAGDSAVYFCAAR
Capra hircus V593 trav LWLT01000251.1 24785 QTHGNSVTQMDGQVSRSEGTSVTINCTYSAAGYPALFWYVQYPGEGPQLLLKAMKASDKGTNKGFEATYNTETTSFHLEKASVQESDSAVYYCALS
Capra hircus V594 trav LWLT01000251.1 29046 VSLGNKVEQNPSTLNVQEGNSSVITCTYTDGYSEYFPWYKQEPGKGPQLLIAIHSNKGKEEDQKLTVLLNKTAKSLSLHIATTEAGDSAVYFCAAR
Capra hircus V595 trdv LWLT01000251.1 37636 SSIAQKVTQDQPPMSVQEKETVTLGCTYDTSITTYSLCWYKQPSSGVMTFLIRQDSSNKPNATEGRYSLNFQKASKFITLTISASQLEDSAVYFCALSE
Capra hircus V600 trav LWLT01000350.1 2451 GVRAVKVEQSPSVLNLQEGANCTLRCNFSATVKTLQWFQQNPGGSLISLFFIASGMKQNERLSSTVNSKERYSTLHITASQLEDAATYLCAVE
Capra hircus V601 trav LWLT01000350.1 9042 VSLGNKVEQSPSTLSIQEGNSCFITCTYTDVTSSYFPWYKQEPGKGPQLLIDIRSNMGKNEGQRLTVLLNKTAKHLSLHITTVEPGDSAVYFCAAS
Capra hircus V602 trav LWLT01000350.1 17518 VSLGNKVEQSPSTLSVQEGNSSVITCTYTDGNSEYFPWYKQEPGKGPQLLIAIRSNKDKEEDQKLTVFLNKTAKRLSLHIATTEAGDSAAYFCAAR
Capra hircus V603 trav LWLT01000350.1 23502 SSIAQKVTQDQPPISVQEKETVTLDCTYDISIATYSLFWYKQPSSGVMTFLIRQDSSNKANATEGRYSLNFQKASKFITLTISASQLEDSAVYFCAMSE
Capra hircus V604 trav LWLT01000392.1 2584 GNNGDSVNQTEGPVTVSEGALMTLNCTYQTAGFSPYLFWYVQHLNKAPQLLLKGLTADKKVEHEGFQATLVQSDRSFHLQKRAVQASDSAVYYCALS
Capra hircus V605 trav LWLT01000392.1 11029 GTNGDSVNQTEGPVTVSEGALMTLNCTYQTTYSDSYLFWYVQHLNKAPQLLLKGSTTNQRPEHEGFQATLVQSDSSFHLQKRAVQASDSAVYYCALS
Capra hircus V606 trav LWLT01000392.1 13194 SIMAQKVTQNRSEISVLEKEDVTLNCAYEANSYTYYLFWYKQSQSGEIIFLIHQESYNKLNTTKGQYFLNFQKATSSISLTITDLQLEDSAVYFCALR
Capra hircus V609 trav LWLT01000553.1 3010 GTNGDSVSQTEGPVTLSEGALMTLNCTYQTTYPDFYLFWYVQHLNKAPQFLLKGSMTNQRPEHEGFQATLVKSDSSFHLQKRAVQASDSAVYYCALS
Capra hircus V610 trdv LWLT01000553.1 5181 SIMAQKVTQNWSEISVLEKEDVTLNCAYEANSYTHYLFWYKQPPSGEMIFLIHQESYNELNTTKGQYFLNFQKATSSISLTITDLQLKDSAVYFCALR
Capra hircus V616 trav LWLT01004240.1 6364 GVRGVKVEQSLSVLSLQEGANSTLWCNFSDTVNSVQWFQQNPGGSLTRLFFIASGTKQNERLSSTVNSKEQYSTLHITASQLEDAATYLCAVE
Capra hircus V617 trav LWLT01004240.1 10446 VSLGNKVEQSPSTLSVQEGNSSVITCTYTDTASDYFPWYKQEPGKGPQLLVAIHSNMGEKKDQRLTVLLNKTAKHLSLHIATIQPGDSAVYLCAAR
Capra hircus V622 trav LWLT01006003.1 12593 VNAQQISQIPQFLFLQEGENFTTYCNSSSTLTNLQWYKQSPGGSPVLLMILAKAGEVKTEQRLTGRLGETRKHGSLHLAAAQLSDAGTYFCA
Capra hircus V624 trav LWLT01006070.1 9959 GTNGDSVNQTEGPVTVSEGALMTLNCTYQTAGLTPYLYWYVQHLNKAPRLLLKGSARDPKPKSEGFQATLVQSDRSFTCRNGAVQASDSAVYYCALE
Capra hircus V630 trav LWLT01008047.1 11004 VSSKQDVSQSPEALSVREGDSLVLNCSYTDGALYFLQWFRQDPRKGLTSLLSIQANQKEKASGRITVSLDKSSRHSALYIATSQHSDSTTYLCAV
Capra hircus V687 trgv LWLT01000003.1 37637794 GLGLSKVEQAQISLSTEVKKSIDIHCKIESTNFESETVYWYRQKRNQALEHLVYVISTTTAARNQVDGKNKIEARKDARMFTSTLTVNFVEKDDVGIYYCAGWS
Capra hircus V688 trgv LWLT01000003.1 37626443 GLGQLTLEQPELSVTGTREKSIIMTCKVFSKDFSKDYIHWYRQKPDQGLEQLLYVSTAPAQNHLGGKKNKLEARKDAPSSTSTLKISFLEKEDEATYYCAGWL
Capra hircus V689 trgv LWLT01000003.1 37582751 TQVSSNMEEDKLSVTRATGSSVVIDCDLTQNYIHWYKFQEGTVPRRLLYYDVYYSKVVLESGISEGKYHVYKGTGKSYTFVISNLQESDSGTYYCAVWE
Capra hircus V690 trgv LWLT01000003.1 37568866 MQVSSNMEGEKMSITKAAVPGAFVEIICDLITQTVKYIHWYKYQEGTAPRRLLYYDISYSKIVLESGISEGKYKVYKEKSYTFAISNLQESDSGMYYCAVWE
Capra hircus V692 trbv LWLT01000003.1 14907669 TWGTGVFQTPKYLLTQMGTKTSLECEQKLNHDNMYWYKQDSKKLLKAMFHYNNKELVENETVPSRFSPESPDKAHLNLHIDSLEPGDSAVYFCASS
Capra hircus V693 trbv LWLT01000003.1 14903330 VSADPGITQIPKYLVMGMTDKKSLKCEQHLGHNAMYWYKQSAQKPPELMFIHSYMKLSGNESVPSRFWPECPDSSQCRLDLSAPKPQDSAVYLCASSR
Capra hircus V694 trbv LWLT01000003.1 14885151 LVDSEVTQTPKYLIKSRKEQATLGCSPESGHRSVNWYQQALGQGPRFLVQYYRGQVSGEENMPDRFSAKQFSDFRSELNLSSLELTDSAVYLCASSQ
Capra hircus V695 trbv LWLT01000003.1 14880295 AVHAGVTQDPRFQVVRTGQRVTLRCTQDLNYDYMYWYRQDPGHGLRLIHYSDGPPATEKGDVPDGYNVSRPSTEDFPLTLESASRSQTSVYFCASSY
Capra hircus V696 trbv LWLT01000003.1 14876396 LVDSEVTQTPKYLIKSRKQQATLRCSPESGHFSVYWYQQVLGQGPQFLVQYYNQKVSGEAHLPDRFSGKQFSDSRSELNLSSLELMDSAMYLCASSQ
Capra hircus V697 trbv LWLT01000003.1 14866846 LVDSEVTQTPKFLTKSRKQQVTLRCSPESGHRSVYWFQQALGQGPQFLVQYFDGKVYQRGNMSDRFSGQQSGSELNLTSLELMDSALYLCASSQ
Capra hircus V698 trbv LWLT01000003.1 14862828 LVYSGVTQTPKYLIKSRKQQGILRCSPESGHLYVSWYQQALGQGPQFLVQYYDGKVRTKGNMPDRFSGEQFSDSHSQMNLSSLKLSDSAVYLCASSQ
Capra hircus V699 trbv LWLT01000003.1 14853039 LVDSEVTQTPKYLIKSRKQQAMLRCSPEPGHLSVYWYQQALGQGLQFLIQYYNRAENEKGNIPDRFSGKQFSDSSSELNVTSLELTDSAVYLCASSQ
Capra hircus V700 trbv LWLT01000003.1 14851235 AVHAGVTQDPGFQVVRTGESATLRCTQDLSFSYMYWYRQDPGHGLRLIHCSVIPPATEKGAVPEGYSVSRPSTENFPLTLESANASQTSVYFCSCGY
Capra hircus V701 trbv LWLT01000003.1 14848108 VVHAGVTQDPRFQVMRTGQNVTLKCTQDLGHDPMYWYRQDPGPGLRLIHYSAGPPTMVQGDVPDGYSVSRSSKENFPLMLESANLSQTSVYFCASSY
Capra hircus V702 trbv LWLT01000003.1 14845164 LVDSGVTQTPRYLIKARGQRGTLRCSPVSGHLSVYWYQQALGQGPQFLVQYYRQEVSGEAQLPDRFSGKQFGDFHSELNLTSLELTDSAVYLCASSQ
Capra hircus V703 trbv LWLT01000003.1 14829457 LVESEVTQTPKYLIKSRKEKVTLRCSPKSGHRSVYWYQQALGQGPQFLVQYYSQQVSGEAQLPDRFSGKQFSDFHSELNLTSLELTDSAVYLCASSQ
Capra hircus V704 trbv LWLT01000003.1 14824164 VVHAGVTQDPRFQVVRTGQRVTLRCTQDLSHDYMYWYRLDLGHGLRLIHYSAAAPNTEKGDVPKGYSISRPSTEDFPLTLESANRSQTSVYFCASSY
Capra hircus V705 trbv LWLT01000003.1 14821948 LVDSGVIQTPRYLIKARGQRGTLRCSPVSGHLSVYWYQQALGQGPQFLVQYYSQNVYGEAQLPDRFSGEQFSDSSSELNLTSLELTDSAVYLCASSQ
Capra hircus V706 trbv LWLT01000003.1 14810840 LVDSGVTQTPKYLIRSRKQQATLRCSPESGHRYVSWYQQALGQGPQFLVQYYDGKVHTKGNMPGQFSGEQFSDSRSQMNLSSLELTDSAVYLCASRQ
Capra hircus V707 trbv LWLT01000003.1 14805871 LVESEVTQTPKYLIKSRKEQVTLRCSPKSGHRSVYWYQQALGQGPQFLVQYYDGEIYQKENISDRFSGKQFSDARSELSLTPLELTDSAVYLCASRQ
Capra hircus V708 trbv LWLT01000003.1 14801988 LVDSGVTQTPRYLIKARGQQGTLRCSPVSGHLSVYWYQQALGQGPQFLVEYYNQDVRGETNLPDRFSGEQFSDSSSELNLTSLELRDSAVYLCASSQ
Capra hircus V709 trbv LWLT01000003.1 14800182 AVRAGVTQDPRFQVVRTGQNVTLKCTQDLGHNSMYWYRQDPGHGLRLIHYSRGPPSTERGDVPDGYSVSRSSKENFPLTLESANPSQTSVYFCASSY
Capra hircus V710 trbv LWLT01000003.1 14793752 LVDSGVTQTPKYLIKSKKQQLTLRCSPEFGHRYVSWYQQALGQGPQFLIQYYNREVNEKGNIPDRFSENQFSDSRSELNLTSLELTDSAVYLCASSK
Capra hircus V711 trbv LWLT01000003.1 14791638 AVHSGVTQVPRFQVVRTGQRVTLKCTQNLDHNSMYWYRQDPGNGLRLIHYSRGPPTTEKGDMPDGYSVFRSSKENFPLMLESANPSQTSVYFCASSY
Capra hircus V712 trbv LWLT01000003.1 14788458 AVHAGVTQDPGFQVVRTGESATLRCTQDLSFSYMYWYRQDPGHGLRLIHYSVIPPATEKGAVPEGYSVSRPSTENFPLTLESANASQTSVYFCSCGY
Capra hircus V713 trbv LWLT01000003.1 14782567 LVDSGVTQTPRYLIKARGQQGTLRCSPVSGHLYVYWYQQALGQGPQFLVLYYSQDVYGEAQLPDRFSGKQFSDSSSELNLTSLELTDSAVYLCASSQ
Capra hircus V714 trbv LWLT01000003.1 14775679 LVNSGLTVTPKYLIKSRKEHLTLRCSSDSGHRSVYWYQQALGQSPRFLFQYYDGKVYQKGNISDKVSGKQFSDDARFELSLTSLELTDSAMYLCASSQ
Capra hircus V715 trbv LWLT01000003.1 14768665 AVHAGVTQDPRFQVMTTGQSMTLKCTQDLDHNSMYWYRQDPGHGLRLIHYSRGPPSTERGDVPDGYSVSRSSKENFPLTLESANPSQTSVYFCASSYSMA
Capra hircus V716 trbv LWLT01000003.1 14763083 LVDSGVTQTPRYLIKARGQRGTLRCSPVSGHLSVYWYQQALGQGPQFLVQYYSQDVRGEAQLPDRFSGKQFSDSSSELNLTSLELMDSAVYLCASSQ
Capra hircus V718 trbv LWLT01000003.1 14746108 VVHAGVTQDPRFQVVRTGQNATLYCTQDLGHDRMFWYRQDLGHGLRLIHYSAAYPSTEKGDVPEGYNVSRPSTEDFPLTLKSASRSQTSVYFCASS
Capra hircus V719 trbv LWLT01000003.1 14743905 LVDSGVTQTPRYLIKARGQRGTLGCSPVSGHLSVYWYKLVLGQGPQFLVQYYSQDVWGETNLPDRFSGEQFSDSSSELNLTSLELMDSAVYLCASSQ
Capra hircus V720 trbv LWLT01000003.1 14735283 AVHAGVSQDPRFQVVRTGQNATLKCTQDLGHDGMYWYQDLGHGLRLIHYSAGPPSTEKGDVPDGYRVSRSSKENFPLTLESASRSQTSVYFCASSY
Capra hircus V721 trbv LWLT01000003.1 14732947 LVDSGVTQIPKYLIKSRKQQVTLRCSPESGHRYVSWYQQALGKSPQFLVQYYDGKVRTKGNMPDRFSGEQFSDSRSQMNLSALELTDSAMYLCASRQ
Capra hircus V722 trbv LWLT01000003.1 14730033 VVHAGVTQDPRFQVVRTGQRATLKCTQDLNHDSMYWYRQDPGHGLRLIHYSSFTDATYKGDVPDGYNVSRSSTENFPLTLESANPSQTSVYFCASST
Capra hircus V723 trbv LWLT01000003.1 14727186 HTGAGVVSQSPRHRVAGRGQNVTLRCDPISGHISLYWYRQTLGQGPEFLTYFQNEQELDKSGMPKNRFSAKRPQSTYSYLNIQPAEPGDSAVYLCASSP
Capra hircus V724 trbv LWLT01000003.1 14715067 PLEAEVTQTPRHLIKTKGQTATLRCSPMSGHSSVSWYQQARSQGPQFLFEFYETLQRDKGNFSNRFSAKQFRDFSSELNVNFLELTDSALYLCASSL
Capra hircus V725 trbv LWLT01000003.1 14710113 HTRAGVVSQSPGYRVTGRGQNVTLRCDPIPGHQVLYWYRQMLGQGPEYLTYFQGKEEPDKSGMPKNRFSAERPESTYSYLKIQPVEPKDSAVYLCASSP
Capra hircus V726 trbv LWLT01000003.1 14687803 TTDANLGVTQTPRHEVTEKGQAVTLSCEPIKSHTALYWYRQTSVRGLELLIYFRSEAPVDESGMPKDRFSAKMPNASFSTLKIQPTDPGDSATYLCASSK
Capra hircus V727 trbv LWLT01000003.1 14672336 PTDAGVTQTPRHEVTEKGQAVTLSCEPIKSHAALFWYRQTSVRGLELLIYFNNQSPVDESGMPKDRFSAKMPNASFSTLKIQPTEPGDSATYLCASSK
Capra hircus V728 trbv LWLT01000003.1 14669847 CISAEVAQSPSHRVIEKKQAVNLSCDPVSGHNSLFWYYHAVGTEMKLLIYFLRESVQDNSGMPKGRFTAERTQGTSSTLRVHSAELGDSGVYFCASSR
Capra hircus V729 trbv LWLT01000003.1 14667519 HVGAMVIQNPRYLVTGLGKPVTLSCSQDMKHDVMYWYQQKPSQAPKLLLYYYDKEITREKNTSENFQSSRPNTSFCSLDIRSAGLGDSAVYLCASSR
Capra hircus V730 trbv LWLT01000003.1 14662451 FLEAEVTQTPGHLVQGKGLEVEMYCVPKKGHIYVFWYQQILAKEFKFLISFQNDKVLDDKEMPKKRFSAKCPSNSPCSLKIQPAEPQDSAMYFCASSD
Capra hircus V731 trbv LWLT01000003.1 14647029 TVAGEVTQTPKYLLKKEGGAVTLECEQDFDYDSMYWYRQDPGLGLRRIFFSQVVKDVQEEDIAKGYSASREKKPFFPLTVTSAQKNQTALYLCAASR
Capra hircus V732 trbv LWLT01000003.1 14641645 GSGLGAVVSQQPRRAVSKSGASVTIECRAVDFQATTVFWYRQFPKRGLVLMATSNAGTDATYEQGYNKDKLPISQPNLTFSSLMVMNVDPADSSLYFCGAR
Capra hircus V733 trbv LWLT01000003.1 14634974 SMDTEVTQSPSHLVKGKDQKAKMDCVPIKGHSYVYWYRKKPEGAFEFLVYLQNQDVVEDTAMFKQQFSADCPPNSPCSLEIKSTKAADSALYFCASSQ
Capra hircus V734 trbv LWLT01000003.1 14629643 SMDTEVTQNPSHLVKGKDQRAKMDCVPIKGHSNVYWYRKKLEAFEFLVYLWNGKITEDTAMFKQRFSAECPQNSPCSLEIKSTEAPDSALYFCASS
Capra hircus V735 trbv LWLT01000003.1 14620617 SMDIEVTQSPSHLVKGKDQRAKMYCVPKKGHSYVYWYRRKLEEAFEFLVYLQDEKIIEDTDMFKQRFSAECPQTSPCSLGIKSTKASDSALYFCASSQ
Capra hircus V736 trbv LWLT01000003.1 14616146 SMDTEVIQSPGHLVKGKDQKAKMDCVPIKGHVHVYWYRKKPEGAFEFLVYLQNQDIVEDTEVFQQQFLAQWPQNSPCSLEIKSTKAADSALYFCASSQ
Capra hircus V737 trbv LWLT01000003.1 14612234 SMDAEVTQSPSHLVKGKGQKAKMDCVPIKGHINVYWYRRKLEEALEFLVYLQKQDIVEDTEVFKEQFSAQCPQNSPCSLEIKSTKAADSALYFCASSQ
Capra hircus V738 trbv LWLT01000003.1 14605920 SMDTEVTQRPSHLIKGKDQKAKMDCVPKEGHPYVYWYRKKLEGAFEFLVYFQNQDTMEDTVEFKQRFSAECPQNSPCSLEIKSTEAADSALYFCASSQ
Capra hircus V739 trbv LWLT01000003.1 14601466 PKDAEIYQIGFLLAEAGQDVTLECKRNLGYSAMYWYQQDPGQGLKLTYYSTLETDIQRGDLSEGYSVSREKKELFPLTVKSAHTKQTAVYLCSG
Capra hircus V740 trbv LWLT01000003.1 14595938 SMDTGVTQTPRNRIAVTGKSTVLECSQTKGHESMYWYRQDPGRGLRLVYSSYDINGINKGDVSAGYNVSRKEKAKFSLYLEPATPNQKAIYFCASSI
Capra hircus V741 trbv LWLT01000003.1 14589574 FTDADVYQTPRHCVTGTGRKITLECSQTMGHDNMYWYQQDPGMELQLIHYSYGVNTTEKGERSSRSTVSRISKEHFPLTLETASSSQTSSYFCASSD
Capra hircus V742 trbv LWLT01000003.1 14587643 LEDAAVIQFPRHRILKAEKEFTLQCSQKMNHYAMYWYRQDPGFGLQLIYYSTGPDTFKKGDVPEGYHVSRDELDHFPLTLKSASPNQTSVYFCA
Capra hircus V743 trbv LWLT01000003.1 14576261 PLEADVTQSPRHRITETRKRVTLTCSQNMNHDVMYWYRQDPGLGPKLVYFSRNVGFVEKGDISDGYTASREEKPNFPLILELTSTNQTSLYLCASSE
Capra hircus V744 trbv LWLT01000003.1 14570165 LMDAQVTQTPRYLVKRRGEKVVIECMQNMDHERMFWYRQDPALGLRLLHFSINVDVLEEGDVPYGYSVSRTKKKSFPLTLESATTNQTAMYLCASSE
Capra hircus V745 trbv LWLT01000003.1 14562692 SVFGALLSQKPSRAIRQRGTSMTIECQADSQLNFMYWYRQLPGQSLVLMATANQGSKATYESEFTEDKFPISRPNLAFSTLTVSNASSEDSSSYFCSAG
Capra hircus V870 trdv LWLT01000010.1 79134568 KGVLCNQVTQSSPEQRVASGREVTLQCTFQTTYSNPDLYWYRKRPDAVFQFVLYRDNTRSHDADFARGRFTVQHSVRSKTFHLVISSVRPEDTATYYCALEL
Capra hircus V871 trav LWLT01000010.1 78402726 GTSGDSVTQTEGVVILPEKASLTLKCTYQSSYSDFLFWYVQYKNKELELLLKSSLDNQKVTSRGFEATHISSDSSFHLQKSSVQTSDSAVYYCALS
Capra hircus V872 trav LWLT01000010.1 78398730 GTNGDSVTQTEGPVTVSEGALMTLNCTYQTAGFAPYHVWYIQHLNKAPQLLLKGSMSDPKPKSEGFQATLVQSDRSFHLQKRAVQASDSAVYYCAVS
Capra hircus V873 trav LWLT01000010.1 78387054 GTNGDSVTQTEGPVTVSEGALMTLNCTYQATYSNVYLFWYVQHLNKAPQLLLKGLTADKKVEHEGFQATLVQSDRSFHLQKRAVQASDSAVYYCALS
Capra hircus V874 trav LWLT01000010.1 78379695 GTNGDSVTQTEGPVTVSEGALMTLNCTYQATYSNVYLFWYVQHLNKAPQLLLKGSMTEQKPKREGFQATLVQSDRSFHLQKRAVQASDSAVYYCALS
Capra hircus V875 trdv LWLT01000010.1 78365769 SGVAQNVTQNQTVIISQVGKIVTLNCQYEISRNVHDYWIFWYQQLPSGEMTYLIHQYSEDRNERDGRYSVNFQKARKSISLTISFLKLEHSAKYFCALW
Capra hircus V876 trdv LWLT01000010.1 78334347 SGVAQKVTQDQSDVSSQVGQSVTLSCRYETSWSVYYLYWYKQLPSGQMTYVIRQGSEMTNARKERYSVNFKKADKSIKLTISALQLEDSAKYFCALSL
Capra hircus V877 trav LWLT01000010.1 78325921 TVINAKTTQPSSMDCAEGEDVNLPCNHSTIGANDYIHWYRQNPNQSPQYVIHGLRGTVNSSMASLHIAPHRKSSTLVLPQVTLRDAAVYYCALRE
Capra hircus V878 trdv LWLT01000010.1 78312029 SSVAQKVTQYQPDITSQVRNVVILNCRYETSWNVYTYWIFWYKQLPSGEMTYLIHQYSEDGNERDGHYSVNFQKAQKFISLTISSLKLEHSGKYFCALWE
Capra hircus V879 trav LWLT01000010.1 78303115 KSDQQQVKQSPRSLTVQEGEISILNCSYESSLFNYFPWYRQYPGKAPAFLIAIRSAVNEMEDGRLTVFLNKSAKQLSLHIATSQPGDSATYFCAAS
Capra hircus V880 trdv LWLT01000010.1 78298222 SCVAQKVTQEQSDIIRQVGQSVIFDCQYGIGWFTYYYSIYWYKQLPRGQMTLLIHQHSEHGNAANGRYSVNFQKAYKSISLTISALQLEDSAKYFCALRELSS
Capra hircus V881 trdv LWLT01000010.1 78280646 SGVAQSVTQDQPDILSEVGKTITLNCQYETSWDMLRYYIFWYKQLPSGQMTYLIRQYSDGGNARDGRYSVNFQKAHKSISLTISALELEDSAMYFCVLRV
Capra hircus V882 trav LWLT01000010.1 78261015 TVIDAKTTQPSSMDCAEGEDVNLPCSHSTISGNEYIHWYRQNPSQSLQYVIHGLRDTVNGSMASLHIASDRKSSILVLPQVTLRDAAVYYCALRE
Capra hircus V883 trdv LWLT01000010.1 78248735 SSVAQRVTQNQPDISTQVGEIVTLSCRYETVQSHYHIFWYKQLPSGEMIYLIGQGSSSQNARYGRYSVNFKVSRKFISLTISDLELEDSAKYFCALWE
Capra hircus V884 trdv LWLT01000010.1 78234228 SGVAQKVTQDQPDISSQVGESATMNCQYETSQNNYNIFWYKQLPSGETIYLIGQNSYSPNARDGRYSINFQRSRKAISLIISALKLEDSAKYFCALWE
Capra hircus V885 trav LWLT01000010.1 78226797 VSSLLTVEQRPPLLWVQEGESTNFTCSFPSSSFYALHWYRWEPAKGPKNLFVISVNGDEKKQGRVRVTLNTKEGYSSMYIRGSQPEDSATYLCA
Capra hircus V886 trdv LWLT01000010.1 78216641 SCVAQKVTQNQPDISGQVGQSVTLNCRYETSWTYYYLVWYKQLPSGQMTYLIQQYSENSNARNGRYSVNFQKADKSISLIISSLQLEDSAKYFCAFHD
Capra hircus V887 trav LWLT01000010.1 78209262 TVIDAKTTQPSSMDCAEEDVTLSCSHSTIGGNDYIHWYRQNPNQSPQYVIHGLRSTVNSSMASLTIDSDRKSSTLVLPQVTLRDAAMYYCILRE
Capra hircus V888 trav LWLT01000010.1 78198477 GTGAQLVTQPDSHINVSEGNRLELRCNYSYSGSIFSFWYIQYPSQGLEFLLKYLSGPTRVKGIKGFKAEFKNDENSFHLMKASAHWSDSAKYFCALC
Capra hircus V889 trav LWLT01000010.1 78193688 GTGAQLVTQPDSHINVSEGNRLELRCNYSYSGSISLFWYIQYPSQGLEFLLKYLSGPTRVKGIKGFKAELKNDENSFHLMKASTHWSDSAKYFCALC
Capra hircus V890 trdv LWLT01000010.1 78175359 SGVAQKVIQDQQDISSQLGQSVTLNCRYATAWTYYYLFWYKLLPNGEMIYLISQVSSGQNARNGRYSVNFQKARKSVSLTISDLQLEDSAEYFCALWE
Capra hircus V891 trav LWLT01000010.1 78161171 VRGVYVEQSPPALTPQEGASSTLWCNFSTFADSVWWYLQKPGGRLIHLIYIPSGTRQEGRLNATAVPKERRSSLHISSLWTTDSGTYFCAVWHNAPQ
Capra hircus V943 trav LWLT01000013.1 39434238 SRGQSGTQPDDPVLVSEGTSLELKCNYSYGATPYLFWYVQYPPQRPQLLLKHFLGNTVIQGIRGFVAEFESSDFSFNLRKFSAHWSDSAEYFCALS
Capra hircus V1028 iglv LWLT01000018.1 647866 SWAHAVLTQPPSVSGSLGQSVTISCSGSSNIGILGVSWYQQLQGSAPKTLIYGSNKRPSGVPDRFSGTKSGNTGTLTITSLQAEDEADYYCASADLILNS
Capra hircus V1029 iglv LWLT01000018.1 645084 SLSQPLLTQPASLSASPGASARLTCTLSSGYNVGNYSIYWYQQKAGSPPRYLLRFKSDSDKHQGSGVPNRFSGSKDASTNAGLLLISEVQPEDEADYYCAVWHG
Capra hircus V1030 iglv LWLT01000018.1 637563 SWAQAVLTQPPSVSASLGQRVSIFCNGSSSNIGGGNYVGWYQLIPGSGLRTIIYGTTGRPSGVLDRFSGSRSGNTATLTITSLQAEDEVDYYCATYDSSSYN
Capra hircus V1031 iglv LWLT01000018.1 616478 SWAQAVLTQPSSVSKSLGQSVSITCSGSSSNVGYGNYVGWYQQVPGSAPKLLIYGATSRASGVPARFSGSRSGNTATLSISSLQAEDEADYYCASYDSSGYN
Capra hircus V1032 iglv LWLT01000018.1 607665 SWAQAVLTQPSSVSRSPGQRVFITCSGSSSNVGTGNYVGWYQQVPGSAPKLLIYGATSRASGVPDRFSGSRSGNTATLTISSLQAEDEADYYCSSYQSGYSY
Capra hircus V1033 iglv LWLT01000018.1 600330 CWAQAVLTQPSSVSRSLGQSVSITCSGSSSNIGGGYYVGWYQQIPGSAPRTLIYQNSKRPTGVPNRFSGSKSGSTATLTISSLQAEDEADYYCSAYDSSISA
Capra hircus V1034 iglv LWLT01000018.1 593240 SWAQAVLTQPSSVSGSLGQRVSITCSGSSSNIGRGYGSWYQQVPGSAPKLLIYGATSRASGVPDRFSGSRSGNTATLTISSLQAEDEADYYCAAYDSSSSN
Capra hircus V1035 iglv LWLT01000018.1 589134 SLFQPVLTQPASLSASPVTSARLSCTLSSGYNVGDFSLSWFQQKPGSPPWYVVRVKSDSDKNQSSGVPSNFFGSKDASANAGLLLISGLQPEDEADYYCAVWHG
Capra hircus V1036 iglv LWLT01000018.1 578333 SWAQAVLTQPPSVSGSPGQRVSITCTGSSSNIGGGNYVGWYQQLPGSGLRTIIYSTSSRPSGVPDRFSGSRSGNTATLTISSLQAEDEADYYCATYESSSYN
Capra hircus V1037 iglv LWLT01000018.1 509454 SWAQAVLTQPSSVSRSLGQRVSITCSGSSSNVGYGNYVGWYQQVPGSGLRTLIYGATSRASGVPDRFSSSKSGNTATLTISSLQAEDEADYFCSSYDSSGYN
Capra hircus V1038 iglv LWLT01000018.1 489925 SWAQAVLTQPPSVSGSPGQSVSITCTGSSSNIGRYGVAWYQQLPGSAPKLLIYCTTSGALGSSDRFSCSMSGNTATLTISSLQAEDEADYYCATYDSSSYN
Capra hircus V1039 iglv LWLT01000018.1 450996 SRAQAVLTQPSSVSRSLGQRVTITCSGSSSNTGGNFVGWCQQLPGMAPKTLIYGDSNRPSGVPGWFSGSKSGNSASMTIASLQAKEEAGYYCLSWDDSLNC
Capra hircus V1040 iglv LWLT01000018.1 434558 SWAQAVLTQPSSVSGSPGQRVSITCSGSNIGSSGVGWYQQLPGSGLKTVIYYNSNRPSGVPDRFSGSKSGNTATLTISSLQAEDEADYYCGSYDSSSYN
Capra hircus V1041 iglv LWLT01000018.1 417143 SWAQAVLTQPSSVSKSLGQSVSITCSGSSSNVGYGNYVSWYQQVPGSAPKLLIYGATSRASGVPARFSGSRSGNTATLSISSLQAEDEADYYCASYDSSSYN
Capra hircus V1042 iglv LWLT01000018.1 309820 SWAQSALTQPASVSGNPGQTVTISCTGTSSDIGGYNYVGWYQQLPGSAPKTLIYNVNNRPSGIPARFSGSKSGNTATLTISGLQAEDEADYYCS
Capra hircus V1043 iglv LWLT01000018.1 302230 SWAQSALTQPASVSGNPGQTVTISCTGTSSDIGGYNYVGWYQQLPGSAPKTLIYEVSKRPSGIPARFSGSKSGNTATLTISGLQAEDEADYYCS
Capra hircus V1044 iglv LWLT01000018.1 287347 SWAQSALTQPASVSGNPGQTVTISCTGTSSDIGGYNYIGWYQQLPGSAPKTLIYNLNKRPSGIPARFSGSKSGNTATLTISGLQAEDEADYYCSSYKSGGT
Capra hircus V1045 iglv LWLT01000018.1 263988 SWAQSGLTQPASVSGNPGQTVTISCTGTSSDIGSYNGVGWYQQLPGSAPKTLIYNLNKRPSGIPARFSGSKSGNTATLTISGLQAEDEADYYCSSYKSGGT
Capra hircus V1046 iglv LWLT01000018.1 248205 SVVSYELTQPTSVSVALGQTAKVTCQGDNLGSSYVQWHQQKPGQAPVTVIYQDSKRPSGIPDRFSGSNSGNTATLTISGARTEDEADYYCQSADSSNN
Capra hircus V1047 iglv LWLT01000018.1 243386 SVVSYELTQPTSVSVALGQTAKVTCSGDLLDENFAHWYQQKPGQAPVLVIYLNSERASGIPDRFSGSSSGSTATLTISGVQAEDEADYFCQSYDSSNN
Capra hircus V1048 iglv LWLT01000018.1 230422 SVVSYELTQPTSVSVALGQTAKITCQGDLLDEKYTAWYQQKPGQAPVKVICKDSERPSGILDRFSGSSSGKTATLTISGARTEDEADYYCLSADSSNN
Capra hircus V1049 iglv LWLT01000018.1 222044 SVVSYELTQPTSVSVVLGQTAKVTCSGDLLDEQYTQWHQQKPGQAPELVIYEDSKRRSGIPDRFSGSSSSKTAILTISGVRAEDEADYYCVSWDSGNYN
Capra hircus V1050 iglv LWLT01000018.1 217286 HLASSQLTQPPAVSVSLGQTASITCQGDDLAFLSANWYQLKPGQAPVTVIYGGSDRASGIPDRFSGSKSDTTATLTIRGAQAEDEADYYCQSGGIDVD
Capra hircus V1196 trav LWLT01000272.1 36165 VSSKQDVSQSPEALSVREGDSLVLNCSYTDGALYFLQWFRQDPRKGLTSLLSIQANQKRKASGRITVSLDKSSRHSALYIATSQHSDSTTYLCAV
Capra hircus V1197 trav LWLT01000272.1 30368 AGAQSVTQPDDHITVSEGARLELKCDYSSSFSPYLFWYVQYPNQGLQLLLKYESGDNLVSGIKGFEAELRRSEKSFHLRKIPAHWKDSAKYFCVLS
Capra hircus V1198 trav LWLT01000272.1 27371 VSGMDVVQSPPALSLQEGASSTLRCNFSTLAGNVQWYLQNPGGHLIHLFYIPSGTKQDGRLNATTVPTERRSSLHISSSQTTDSGTYFCVAQHSAPQ
Capra hircus V1199 trav LWLT01000291.1 32836 GTNGDSVNQTEGPVTVSEGALMTLNCTYQATYSTVYLFWYVQHLNKAPQVLLKGLTADKKVEHEGFQATLVKSDRSFHLQKRAVQASDSAVYYCALS
Capra hircus V1200 trav LWLT01000291.1 16569 GTNGDSVNQTEGPVTVSEGALMTLNCTYQTAGLTPYLYWYVQHLNKAPQLLLKGLTADKKVEHEGFQATLVQSDRSFHLQKRAVQASDSAVYYCALS
Capra hircus V1201 trav LWLT01000291.1 9782 GTNGDSVNQTEGPVTVSEGALMTLNCTYQATYSDSYLFWYVQHLNKAPQFLLKGSTTNQRPEHEGFQATLVQSDSSFHLQKRAVQASDSAVYYCALG
Capra hircus V1202 trdv LWLT01000291.1 7602 SIMAQKVTQNQSEISVLEKEDVTLNCAYEANSYTYYLFWYKQPPSREMIFLIHQESYNELNTTKGQYFLNFQKATSSISPTISDLQLEDSAVYFCALR
Capra hircus V1203 ighv LWLT01000331.1 31721 VLSQVQLQESGPSLVKPSQTLSLPCTDSGFSLTSCGAGWVRQAPGKRRSGLGYHICGTQASTLKSRLSITRDTSKSQVSLSRSSVTTEDTALYYCAR
Capra hircus V1204 ighv LWLT01000364.1 23792 VLSQVQLQESGPSLVKPSQTLSLTCTDSGVSLTSYGAGWVRQAPGKALHWVGGVDYDGDTSYNPALKSRLSITRDTSKSQVSLSLSSVTTEDTAVYYCAR
Capra hircus V1205 ighv LWLT01000364.1 6201 VLSQVQLQESGPSLVKPSQTLSLTCTDSGFSLTSYGAGWVRQAPGKAPEWVGGIDYDGDTSYNPALKSRLSITRDTSKSQVSLSRSSVTTEDTALYYCAR
Capra hircus V1206 trdv LWLT01000396.1 20899 SSIAQKVTQDQPPMSVQEKETVTLGCTYDTSITTYSLCWYKQPSSGVMTFLIRQDSSNKPNATEGRYSLNFQKASKFITLTISASQLEDSAVYFCALSE
Capra hircus V1207 trav LWLT01000396.1 12923 QTHGDSVRQMDGQVTLLEGATLTVNCTYSAIGYPTLFWYVQYAGEAPELLLKATKANDKGTNEGFEATKDAKTTSFHLEKASVQESDSAVYHCALS
Capra hircus V1208 trav LWLT01000396.1 8622 GVRGVKVEQSLSVLSLQEGANSTLWCNFSDTVNSVQWFQQNPGGSLTRLFFIASGTKQNERLSSTVNSKEQYSTLHITASQLEDAATYLCAVE
Capra hircus V1209 trav LWLT01000396.1 4541 VSLGNKVEQSPSTLSVQEGNSSVITCTYTDTASDYFPWYKQEPGKGPQLLVAIHSNMGEKKDQRLTVLLNKTAKHLSLHIATIQPGDSAVYLCAAR
Capra hircus V1224 trav LWLT01002245.1 13007 GTNGDSVSQTEGPVTVSEGALMTLNCTYQTADSASYLYWYVQHLNKALQLLLKGSARDPKPKSEGFQATLVQGDRSFHLQKRAVQASDSAVYYCALG
Capra hircus V1226 trav LWLT01002583.1 8473 GTNGDSVNQTQGPVTVSEGALMTLNCTYQTTYLNSYLFWYAQHLNKAPQLLLKGLTADKKVEHEGFQATLVKSDRSFHLQKRAVQASDSAVYYCALS
Capra hircus V1230 trav LWLT01003158.1 8923 GTNGDSVNQTEGPVTVSEGALMTLNCTYQTADFSPYLFWYVQHLNKAPQLLLKGLTADKKVEHEGFQATLVKSDSSFHLQKQAVQTSDSAVYYCALS
Capra hircus V1232 trav LWLT01003386.1 15398 GTNGDSVNQTEGPVTVSEGALMTLNCTYQATYSIVYLFWYIQHLNKAPRLLLKGSMSDPKPKSEGFQATLVQSDSSFHLQKWAVQTSDSAVYYCALS
Capra hircus V1233 trav LWLT01003386.1 4310 GTNGDSVNQTQGPVTVSEGALMTLNCTYQTTYLNSYLFWYAQHLNKAPQLLLKGLTADKKVEHEGFQATLVKSDRSFHLQKRAVQASDSAVYYCALS
Capra hircus V1237 trav LWLT01005320.1 5041 VSSKQDVSQSPEALSVREGDSLVLNCSYTDGALYFLQWFRQDPRKGLTSLLSIQANQKEKASGRITVSLDKSSRHSALYIATSQHSDSTTYLCAV
Capra hircus V1238 trav LWLT01005688.1 5413 GTNGDSVNQTEGPVTVSEGALMTLNCTYQTADFSPYLFWYVQHLNKAPQLLLKGLTADKKVEHEGFQATLVKSDSSFHLQKQAVQTSDSAVYYCALS
Capra hircus V1245 trav LWLT01007251.1 8413 VSSQQNTVEQSPASLPVPEGAVASLGCTYSDSNSQYFTWYRQYPGKGPEFLLQVYADKDKEEGKFTAQSNKTNKRVSLRIRDSEPSDSATYLCAV
Capra hircus V1247 trav LWLT01008144.1 6342 GTNGDSVNQTEGPVTVSEGALMTLNCTYQATYSTVYLFWYVQHLNKAPQVLLKGLTADKKVEHEGFQATLVKSDRSFHLQKRAVQASDSAVYYCALS
Capra hircus V1252 trav LWLT01011086.1 563 GTNGDSVNQTEGPVTVSEGALMTLNCTYQATYSTVYLFWYVQHLNKAPQVLLKGLTADKKVEHEGFQATLVKSDRSFHLQKRAVQASDSAVYYCALS
Capra hircus V1259 trdv LWLT01014462.1 6366 SSIAQKVTQDQPPMSVQEKETVTLDCTYDISITTYSLCWYKQPSSGVMTFLIRQDSSNKANATEGRYSLNFQKASKFITLTISASQLEDSAVYFCAMSE
Capra hircus V208 iglv AJPT02075574.1 647 SWAQSALTQPASVSGNPGQTVTISCTGTSSDIGGYNYVGWYQQLPGSAPKTLIYEVSKRPSGIPARFSGSKSGNTATLTISGLQAEDEADYYCS
Capra hircus V209 trav AJPT02077385.1 76110 TVINAKTTQPNSLDCAEGENVNLPCNHSTIGGDDYIHWYRQNPNQSPQYLIHGLRGTVNSSMASLHIAPDRKSSTLVLPQVTLRDAAVYYCVLRE
Capra hircus V0 trav AJPT02004162.1 1005 MNGQQIKHFPEFLLLQEGENFTTYCNSSSTFYSLQWYKQSPGGSPVLLMILAKAGEAKTEQRLTGRLRETRQHSSLHLAAAQLSDAGSYFCAE
Capra hircus V1 trdv AJPT02004162.1 7613 SGVAQKVTQDQPDISSQVGQSVTLNCQYEISWGLYYLFWYKQLPSGQMTYLIQQYSGYSNARDGRYSVNFQKADKSISLIISSLQLEDSAKYFCALSV
Capra hircus V2 trav AJPT02004162.1 12235 MNGQQIKHFPEFLLLQEGENFTTYCNSSSLLSSLKWYKQRPGGSPVLLMILAKSGEVKTQQRWTGRFGESRQHSSLHLTAAQLSDAGTYFCAEA
Capra hircus V3 trav AJPT02004178.1 6047 SVINAKTTQPSSMDCAEGEDVNLPCNHSTIGANDYIHWYRQNPNQSPQYVIHGLRGTVNRSMASLHIALDRKSSTLVLPQVTLRDAAVYYCALRE
Capra hircus V4 trav AJPT02004178.1 9038 VRGVDVEQSPPALSLQQGASYMLQCNFSPFPQSVNWYLQNPGGRIIHLFYITSGTKQDGRLNATTVPTERRSSLHISSSQTTDSGTYFCAAQHSAPQ
Capra hircus V5 trav AJPT02005019.1 2758 GTNGDSVNQTEGPVTVSEGALMTLSCTYQTTYSNPYLYWYVQHLNKAPQLLLKGLTADKKVEHEGFQATLVQSDRSFHLQKRAVQASDSAVYYCALS
Capra hircus V6 trav AJPT02005019.1 10716 GTNGGSVNKTEGPVTVSEGALMTLNCTYQATYSDSYLFWYVQHLNKAPQLLLKGSMTNQRPEHEGFQATLVQSDRSFHLQKRAVQASDSAVYYCALS
Capra hircus V7 trav AJPT02005087.1 5362 TNGQQIKHFPEFLLLQEGENFTTYCNSSSTFYNLQWYKQSPGGSPVLLMILAKAGEAKTEQRLTGRLRETRQHSSLHLAAAQLSDAGTYFCAE
Capra hircus V8 trav AJPT02005236.1 2938 VSSLLTVEQRPPLLWVQEGESTNFTCSFPSSSFNTLHWYIWKPAKGLKNLFVISVNGDEKKQGRVRVTLNTKEGYSSMYIRGSQPEDSATYLCA
Capra hircus V9 trdv AJPT02005236.1 11004 SGVAQKVTQDQPDISSQVGQSVTLNCRYETSWRVYYLFWYKQLPSGQMTYLIQQYSGYSNARDGRYSVNFQKADKSISLIISSLQLEDSAKYFCALSV
Capra hircus V10 trav AJPT02005373.1 5857 GTNGDSVSQTEGPVPVSEGALMTLNCTYQTADSAPYLYWYVQHLNKALQLLLKGSARDPKPKSEGFQATLVQSDRSFHLQKRAVQASDSAVYYCALS
Capra hircus V11 trav AJPT02005423.1 3030 GVRGVKVEQSPSVLSLQEGANSTLWCSSSDTVKSVQWFQQNPKGSLITLFFIASGMKQNERLSSTVNSKERYSTLHITASQLEDTATYLCAVE
Capra hircus V12 trav AJPT02005423.1 7061 VILGNKVEQSPSTLSVQEGNSSVITCTCTDTASAYFPWYKQEPGKCPQLLVAIHSNMGEKNDQRVTVLLNKTANHLSLHIATIQPGDSAVYFCAAR
Capra hircus V13 trav AJPT02006044.1 8129 VSLGNKVEQSPSTLSIQEGDSSVITCTYTDGNSEYFPWYKQEPGKGPQLLIAIRSNKDKEEDQRLTVLLNKTAKRLSLHIATTEAGDSAVYFCVAG
Capra hircus V14 trav AJPT02007078.1 5611 SIVAQKVTQDPQPILVQEKEAVTLDCTYDTSDSSYSLFWYKQPNSGAMIFLLSQDSYGKQNAAEGRYSLNFQKASKSITLVISASQLEDSAVYFCALRE
Capra hircus V15 trav AJPT02008387.1 517 VSSQQNTVEQSPASLPVPEGAVASLGCTYSDSASQYFTWYRQYPGKGPEFLLQVYADKDKEEGKFTAQSNKTNKRVSLHIRDSEPSDSATYLCAV
Capra hircus V16 trav AJPT02009428.1 2215 VSLGNKVEQSPSTLSVQEGNSSVITCTYTDTASDYFPWYKQEPGKGPQLLIAIRSNMGEKKDQRLTVLLNKTAKHLSLHIATIQPGDSAVYFCAAR
Capra hircus V17 trav AJPT02009428.1 4025 GVRGVKVEQRPSILSLQEGANSTLWCNSSDTVNSVQWFQQNPGGSLITLFFIASGTKQNERLSSTVNSKERYSTLHITASQLEDSATYLCAVE
Capra hircus V18 trbv AJPT02010084.1 2206 AVHAGVTQDPRFQVVRTGQRATLKCTQDLGHDSMYWYRQDLGHGLRLIHYSAAYPSTEKGDVPEGYSVSRPSTENFPLTLKSANRSQTSVYFCASSY
Capra hircus V19 trbv AJPT02010084.1 4433 LVDSGVTQTPRYLIKARGQRGTLRCSPVSGHLSVYWYQQALGQGPQFLVQYYSQDVSGEAQLPDRFSGKQFSDSSSELNLTSLELTDSAVYLCASSQ
Capra hircus V20 trav AJPT02010902.1 236 MNGQQIKHFPEFLLLQEGENFTTYCNSSSLLSSLQWYKQRPGGSPVFLMILTKSGEVKTQQRWTGRFGESRQHSSLHLTAAQLSDAGTYFCAE
Capra hircus V21 iglv AJPT02012005.1 2205 SWAQAVLTQPSSVSGSPGQRVSITCSGSNIGSSGVGWYQQLPGSGLKTVIYYNSNRPSGVPDRFSGSKSGNTATLTISSLQAEDEADYYCGSYDSSSYN
Capra hircus V22 trav AJPT02012761.1 2457 GVRGVKVEQSPSVLSLQEGANSTLWCNFSATVNSVQWFQQNPEGSLISLFFIASGMKQNERLSSTVNTKERYSTLHITAFQLEDAATYLCAVE
Capra hircus V23 trav AJPT02013975.1 3541 NVIDAKTTQPNSMDCAEGENVYLPCNHSTIGGDEYVHWYQQNPNQSPQYVIHGLQGTVNSSMASLHIAPDRKSSTLVLPQVTLRDAAVYYCVLRE
Capra hircus V24 trav AJPT02015907.1 1004 SIVAQKVTQDPQPILVHEKEAVTLDCTYDTSDSSYSLFWYKQPSSGAMIFLLSQDSYGKQNASEGRYSLNFQKASKSITLVISASQLEDSAVYFCALRE
Capra hircus V25 trav AJPT02016704.1 640 VNSQQGEQNLQTLSIQEGENVTMNCSYKSITITALQWYRQDSRRGFVHLILMRSNERQKHSGRLLFTLDSSIQSSSVSIAASQAEDTATYLCAP
Capra hircus V26 trdv AJPT02019612.1 373 SGVAQKVTQDQPYITSQIGQSVILNCRYEVRSSGYTHYLFWYKQLPSGEMTFLIRQESSGPNARNGRYSVNFQRARNSISLTISALQLEDSAKYFCAVWE
Capra hircus V29 trbv AJPT02025587.1 3846910 TWGTGVFQTPKYLLTQMGTKTSLECEQKLNHDNMYWYKQDSKKLLKAMFHYNNKELVENETVPSRFSPESPDKAHLNLHIDSLEPGDSAVYFCASS
Capra hircus V30 trbv AJPT02025587.1 3851261 VSADPGITQIPKYLVMGTTDKKSLKCEQHLGHNAMYWYKQSAQKLPELMFIHNYRKLNGNESVPSRFWPECPDSSQCRLDLSAPKPQDSAVYLCASSR
Capra hircus V31 trbv AJPT02025587.1 3869499 LVDSEVTQTPKYLIKSRKEQATLGCSPESGHRSVNWYQQALGQGPRFLVQYYRGQVSGEENMPDRFSAKQFSDFRSELNLSSLELTDSAVYLCASSQ
Capra hircus V32 trbv AJPT02025587.1 3874355 AVHAGVTQDPRFQVVRTGQRVTLRCTQDLNYDYMYWYRQDPGHGLRLIHYSDGPPATEKGDVPDGYNVSRPSTEDFPLTLESASRSQTSVYFCASSY
Capra hircus V33 trbv AJPT02025587.1 3878359 LVDSEVTQTPKYLIKSRKQQATLRCSPESGHFSVYWYQQVLGQGPQFLVQYYNQKVSGEAHLPDRFSGKQFSDSRSELNLSSLELMDSAMYLCASSQ
Capra hircus V34 trbv AJPT02025587.1 3889170 LVDSGVTQTPIYLIKSRKQQGILRCSPESGHRYVSWYQQALGQGPLFLVQYYDGKVRTKGNMPDRFSGEQFSDSSSQMNLSSLELTDSAVYLCASGQ
Capra hircus V35 trbv AJPT02025587.1 3899134 LVDSEVTQTPKYLIKSRKQQAMLRCSPEPGHLSVYWYQQALGQGLQFLIQYYNRAENEKGNIPDRFSGKQFSDSSSELNLTSLELTDSAVYLCASSQ
Capra hircus V36 trbv AJPT02025587.1 3900936 AVHAGVTQDPGFQVVRTGESATLRCTQDLSFSYMYWYRQDPGHGLRLIHYSVIPPATEKGAMPEGYSVSRPSTENFPLTLESANASQTSVYFCSCGY
Capra hircus V37 trbv AJPT02025587.1 3907637 LVDSGVTQTPRYLIKARGQRGTLRCSPVSGHLSVYWYQQALGQGPQFLVQYYRQEVSGEAQLPDRFSGKQFSDFHSELNLTSLELTDSAVYLCASSQ
Capra hircus V38 trbv AJPT02025587.1 3914363 LVDSGVTQTPRYLIKARGQRGTLRCSPVSGHLSVYWYQQALGQGPQFLVQYYSQEVSGEAQLPDRFSGKQFSDFHSELNLTSLELTDSAVYLCASSQ
Capra hircus V39 trbv AJPT02025587.1 3936377 LVESEVTQTPKYLIKSRKEQMTLRCSPKSGHRSVYWYQQALGQGPQFLVQYYSQQVSREAQLLDRFSGKQFSDFHSELNLTSLELTDSAVYLCASSQ
Capra hircus V40 trbv AJPT02025587.1 3943163 VVHAGVTQDPRFQVVRTGQRVTLRCTQDLSHDYMYWYRLDLGHGLRLIHYSAAAPNTEKGDVPKGYSVSRPSTEDFPLTLKSANRSQTSVYFCASSY
Capra hircus V41 trbv AJPT02025587.1 3946413 LVDSGVTQTPRYLIKARGQRGTLRCSPVSGHLSVYWYQQALGQGPQFLVQYYSQNVYGEAQLPDRFSGEQFSDSSSELNLTSLELTDSAVYLCASSQ
Capra hircus V42 trbv AJPT02025587.1 3956183 VVHAGVTQDPRFQVVRTGQRVTVTCTQDLGHDPMYWYRQDPGPGLRLIHYSAGPPSTEKGDVPHGYRVSRSSKENFPLTLESTSRSQTSVYFCASSYSM
Capra hircus V43 trav AJPT02026867.1 1165 GTRAQTVTQPESHIPVSEGDPVQVKCSYSYSGSPVLFWYVQYPRQRLQLLLKDTSRESIQGFTAELSRAEASFHLKKPSAREEDSAVYYCALG
Capra hircus V44 trbv AJPT02041626.1 995225 VRAQTIHQWPSTRVQPAGSPLSLECTVKGTSSPNLYWYRQEAGGSLQLLFSSVGVDQIEPREFQNLEASRPQDGQFILSSKKLQLNNSGFYLCAWS
Capra hircus V45 iglv AJPT02041843.1 4534 SWAQSGLTQPASVSGNPGQTVTISCTGTSSDIGSYNGVGWYQQLPGSAPKTLIYNLNKRPSGIPARFSGSKSGNTATLTISGLQAEDEADYYCSSYKSGGT
Capra hircus V46 iglv AJPT02041843.1 28463 SVVSYELTQPTSVSVALGQTAKVTCQGDNLGSSYVQWHQQKPGQAPVTVIYQDSKRPSGIPDRFSGSNSGNTATLTISGARTEDEADYYCQSADSSNN
Capra hircus V47 iglv AJPT02041843.1 33273 SVVSYELTQPTSVSVALGQTAKVTCSGDLLDENFAHWYQQKPGQAPVLVIYLNSERASGIPDRFSGSSSGSTATLTISGVQAEDEADYFCQSYDSSNN
Capra hircus V48 iglv AJPT02041843.1 49634 SVVSYELTQPTSVSVALGQTAKITCQGDLLDEKYTAWYQQKPGQAPVKVICKDSERPSGILDRFSGSSSGKTATLTISGARTEDEADYYCLSADSSNN
Capra hircus V49 iglv AJPT02041843.1 50916 SVVSYELTQPTSVSVALGQTAKITCQGDLLDEKYTAWYQQKPGQAPVKVICKDSERPSGILDRFSGSSSGKTATLTISGARTEDEADYYCLSADSSNN
Capra hircus V50 iglv AJPT02041843.1 59075 SVVSYELTQPTSVSVVLGQTAKVTCSGDLLDEQYTQWHQQKPGQAPELVIYEDSKRRSGIPDRFSGSSSSKTAILTISGVRAEDEADYYCVSWDSGNYN
Capra hircus V51 iglv AJPT02041843.1 63834 HLASSQLTQPPAVSVSLGQTASITCQGDDLAFLSANWYQLKPGQAPVTVIYGGSDRASGIPDRFSGSKSDTTATLTIRGAQAEDEADYYCQSGGIDVD
Capra hircus V52 trav AJPT02061686.1 512 KSRGEKVEQYPSFQSVQEGDNCVINCTYTDSASTYFVWYKQEPGKGLQLLIHTLSNVDKKEGQGLIVLLNKKNKHLSLNITATHPGDSATYFCAAR
Capra hircus V53 trdv AJPT02077343.1 17197 SSVAQKVTQYQPDITSQVRNVVILNCRYETSWNVYTYWIFWYKQLPSGEMTYLIHQYSEDGNERDGHYSVNFQKAQKFISLTISSLKLEHSGKYFCALWE
Capra hircus V54 trav AJPT02077343.1 26109 KSDQQQVKQSPRSLTVQEGEISILNCSYESSLFNYFPWYRQYPGKAPAFLIAIRSAVNEMEDGRLTVFLNKSAKQLSLHIATSQPGDSATYFCAAS
Capra hircus V55 trdv AJPT02077343.1 31002 SCVAQKVTQEQSDIIRQVGQSVIFDCQYGIGWFTYYYSIYWYKQLPRGQMTLLIHQHSEHGNAANGRYSVNFQKAYKSISLTISALQLEDSAKYFCALRELSS
Capra hircus V56 trdv AJPT02077343.1 48561 SGVAQSVTQDQPDILSEVGKTITLNCQYETSWDMLRYYIFWYKQLPSGQMTYLIRQYSDGGNARDGRYSVNFQKAHKSISLTISALELEDSAMYFCVLRV
Capra hircus V57 trav AJPT02077343.1 68194 TVIDAKTTQPSSMDCAEGEDVNLPCSHSTISGNEYIHWYRQNPSQSLQYVIHGLRDTVNGSMASLHIASDRKSSILVLPQVTLRDAAVYYCALRE
Capra hircus V58 trdv AJPT02077343.1 80475 SSVAQRVTQNQPDISTQVGEIVTLSCRYETVQSHYHIFWYKQLPSGEMIYLIGQGSSSQNARYGRYSVNFKVSRKFISLTISDLELEDSAKYFCALWE
Capra hircus V59 trdv AJPT02077343.1 93897 SGVAQKVTQDQPDISSQVGESATMNCQYETSQNNYNIFWYKQLPSGETIYLIGQNSYSPNARDGRYSINFQRSRKAISLIISALKLEDSAKYFCALWE
Capra hircus V60 trav AJPT02077669.1 5166 GTSADSVTQTEGVVTLPETASLTLKCTYQSSYSVSLFWYVQYQNKELELLLKSSLGNEKVTSRGFEATHISSDSSFHLQKSSVKTSDSAVYYCALS
Capra hircus V61 trav AJPT02077669.1 10522 GTNGDSVNQTEGPVTVSEGALMTLNCTYQTANLAPYLFWYIQHLNKAPRLLLKGLMSDPKPKSEGFQATLVQSDRSFHLQKRAVQASDSAVYYCALS
Capra hircus V62 trav AJPT02077669.1 22164 GTNGDSVNQTEGPVTVSEGALMTLNCTYQTAVFSPYLFWYIQHLNKAPRLLLKGSMSDPKPKTEGFQATLVQSDRSFHLQKWAAQASDLAVYYCALS
Capra hircus V63 trav AJPT02077669.1 32800 GTNGDSVNQTEGPVTVSEGALMTLNCTYQTADFSSYLYWYVQHLNKAPQLLLKGLTADKKVEHEGFQATLVQSDRSFHLQKRAVQTSDSAVYYCALS
Capra hircus V64 trav AJPT02077669.1 40889 GINGDSVNQTEGPVTVSEGALMTLNCTYQTANPAPYLFWYVQHLNKAPRLLLKGSISDPKPKSEGFQASLVQSDRSFHLQKRAVQASDSAVYYCALS
Capra hircus V65 trav AJPT02077669.1 64702 GTNGDSVNQTEGPVTVSEGALMTLNCTYQTAVFSPYLFWYVQHLNKAPQLLLKGLTADKKVEHEGFQATLVKTDSSFHLQKWAVQASDSAVYYCALS
Capra hircus V66 trav AJPT02078317.1 21532 NVFDAKTTQPSSMDYPEGEDVSLPCNHSTISGNEYIHWYRQNPNQSPQYIIHGLRDTVNSSMASLHIASDRKSSTLVLPQVTLRDAAVYYCILRE
Capra hircus V67 trav AJPT02078317.1 53325 MNGQQIKHFPEFLLLQEGENFTTYCNSSSTFYSLQWYKQSPGGSPVLLMILAKAGEAKTEQRLTGRLRETRQHSSLHLAAAQLSDAGSYFCAE
Capra hircus V68 trav AJPT02079008.1 5769 LSGEDRVEQSPQTLRIQEGVSLSLNCSYTVSNFRGLQWYRQDPGKGPELLFLLYSVGDEKQEERLRATLLKKGSSLHIEAPKPEDSATYLCAVE
Capra hircus V69 trav AJPT02079008.1 13583 VSSKQDVSQSPEALSVREGDSLVLNCSYTDGALYFLQWFRQDPRKGLTSLLSIQANQKEKASGRITVSLDKSSRHSALYIATSQHSDSTTYLCAV
Capra hircus V70 trav AJPT02079008.1 18241 GAGAQSVTQPDDHITVSEGARLELKCNYSSSFSPYLFWYVQYPNQGLQLLLKYESGDSLVSGIKGFEAEFRRSEESFHLRKIPAHWKDSAKYFCVLS
Capra hircus V71 trav AJPT02079008.1 40297 VNAQQISQIPQFLLLQEGENFTTYCNSSSTFYSLHWYKQSPGGSPVLLMILAKGGEVKTEQRLTGRLGETIKRGSLHLAAAQLSDAGTYFCA
Capra hircus V72 iglv AJPT02086694.1 8046 SWAQSALTQPASVSGNPGQTVTISCTGTSSDIGGYNYVGWYQQLPGSAPKTLIYEVSKRPSGIPARFSGSKSGNTATLTISGLQAEDEADYYCS
Capra hircus V73 trav AJPT02088385.1 18053 GTNGDSVSQTEGPVTVSEGALMTLNCTYQTTYSDFYLFWYVQHLNKAPQFLLKGSMTNRRPDHEGFQATLVQSDRAFHLQKRAVQASDSAVYYCALS
Capra hircus V74 trdv AJPT02088385.1 20213 SIMAQKVTQNRSEISVLEKEDVTLNCAYEANSYTYYLFWYKQPPSGEMIFLIHQESYNELNTAKGQYLLNFQKATSSISLTITDLQLKDSAVYFCALR
Capra hircus V75 trav AJPT02088385.1 28604 LSGEDRVEQSPQTLRIQEGVSLSLNCSYTVSNFRGLQWYRQDPGKGPELLFLLYSVGDEKQEERLRATLLKKGSSLHIEAPKPEDSATYLCAVE
Capra hircus V76 iglv AJPT02088388.1 15009 SRAQAVLTQPSSVSRSLGQRVTITCSGSSSNTGGNFVGWCQQLPGMAPKTLIYGDSNRPSGVPGWFSGSKSGNSASMTIASLQAKEEAGYYCLSWDDSLNC
Capra hircus V77 iglv AJPT02088388.1 23617 SWAQAVLTQPPSVSGSPGQRVSITCSGSSSNIGSSGVAWFQQLPGSGLRIVIYYSSNRPSGVPDRFSGSRSGNTATLTISSLQAEDEADYYCASYQSGYSY
Capra hircus V78 trav AJPT02092659.1 29517 ISLGNKVEQSPSTLSVQEGNSCFITCTYTDVTSSYFSWYKQEPVKGPQLLIDIRSNMDKNEGQRLTVLLNKTAKHLSLHITTIEPGDSAVYFCAAS
Capra hircus V79 trdv AJPT02095408.1 13564 SGVAQKVIQDQQDISSQLGQSVTLNCRYATAWTYYYLFWYKLLPNGEMIYLISQVSSGQNARNGRYSVNFQKARKSVSLTISDLQLEDSAEYFCALWE
Capra hircus V80 trav AJPT02095408.1 27530 VRGVDVEQSPPALTPQEGASSTLWCNFSTFADSVWWYLQKPGGRLIHLIYIPSGTRQEGRLNATAVPKERRSSLHISSLWTTDSGTYFCAVWHNAPQ
Capra hircus V82 trav AJPT02099260.1 16228 GARAQTVTQPESHISVSKGDPVQVKCSYSYSGSPVLFWYVQYPRQHLQLLLKHTSRENIQGFTAELSRAEASFHLKKPSAQEGDSAVYYCALG
Capra hircus V83 iglv AJPT02100589.1 524 SWAQAVLTQPPSVSGSPGQRVSITCTGSSSNIGRYGVAWYQQLPGSAPKLLIYCTTSGALGSSDRFSCSMSGNTATLTISSLQAEDEADYYCATYDSSSYN
Capra hircus V84 iglv AJPT02100589.1 13467 SWAQAVLTQPSSVSRSPGQRVFITCSGSSSNVGTGNYVGWYQQVPGSAPKLLIYGATSRASGVPDRFSGSRSGNTATLTISSLQAEDEADYYCSSYQSGYSY
Capra hircus V86 trav AJPT02102482.1 11976 GTGAQLVTQPDSHINVSEGNRLELRCNYSYSGSISLFWYIQYPSQGLEFLLKYLSGPTRVKGIKGFKAELKNDENSFHLMKASTHWSDSAKYFCALC
Capra hircus V87 iglv AJPT02103158.1 1643 SRAQAVLTQPFSVSRSLGQRVTITCSGSSSNNGGNFVGWCQQLPGTAPKTPIYGDSNRPSGGPEWFSGSKSGNSASMTIASLQAEEEAGYYCLSWDDSLNG
Capra hircus V88 iglv AJPT02103158.1 7237 SRAQAVLTQPSSVSRSLGQRVTITCSGSSSNNGGNFVGWCQQLPGTAPKTPIYGDSNRPSGGPEWFSGSKSGNSASMTIASLQAEEEAGYYCLSWDDSLNG
Capra hircus V89 iglv AJPT02103158.1 12075 SRAQAVLTQPFSVSRSLGQRVTITCSGSSSNNGGNFVGWCQQLPGTAPKTPIYGDSNRPSGGPEWFSGSKSGNSASMTIASLQAEEEAGYYCLSWDDSLNG
Capra hircus V90 trbv AJPT02103227.1 1001 LVDSEVTQTPKFLTKSRKQQVTLRCSPESGHRSVYWFQQALGQGPQFLVQYFDGKVYQRGNMSDRFSGQQSGSELNLTSLELMDSALYLCASSQ
Capra hircus V91 trbv AJPT02103227.1 2742 AVHAGVTQDPRFQVVRTGQSTTLKCTQDLGHDRMYWYQQDLAHGLRLIHYSAGMHTSKPGSVPDGYSASRSNTENFSLTLESANHSQTSAYFCASSY
Capra hircus V92 trbv AJPT02103227.1 4998 LVDSGVTQTPIYLIKSRKQQGILRCSPESGHRYVSWYQQALGQGPLFLVQYYDGKVRTKGNMPDRFSGEQFSDSSSQMNLSSLELTDSAVYLCASGQ
Capra hircus V93 trbv AJPT02103227.1 11711 AVHAGVSQDPRLQVVRTGQRETVTCTQDLGHNSVYWYRLDPGHGLRLIHYSAAYPSTEKGDMPEGYSVSRPSTEDFPLTLRSANRSQTSVYFCASSYSRV
Capra hircus V94 trbv AJPT02103227.1 13958 LVDSGVTQTPRYLIKARGQRGTLRCSPVSGHLSVYWYQQALGQGPQFLVEYYNQDVRGETNLPDRFSGEQFSDSSSELNLTSLELTDSAVYLCASSQ
Capra hircus V95 trbv AJPT02103227.1 22331 LVDSGVTQTPKYLIKSKKQQLMLRCSPEFGHRYVSWYQQALGQGPQFLIQYYNREVNEKGNIPDRFSGNQFSDSRSELNLTSLELTDSAVYLCASSK
Capra hircus V96 trbv AJPT02103227.1 27679 AVHAGVTQDPGFQVVRTGESATLRCTQDLSFSYMYWYRQDPGHGLRLIHYSVIPPATEKGAMPEGYSVSRPSTENFPLTLESANASQTSVYFCSCGY
Capra hircus V97 trbv AJPT02103227.1 33580 LVDSGVTQTPRYLIKARGQRGTLRCSPVSGHLSVYWYQQALGQGPQFLVQYYSQDVRGEAQLPDRFSGKQFSDSSSELNLTSLELTDSAVYLCASSQ
Capra hircus V98 trav AJPT02103263.1 11779 VSSQQNTVEQSPASLPVPEGAVASLGCTYSDSNSQYFAWYRQYLGKGPEFLLNVYLDKDKEEGKFTAQSNKTNKRVSLHIRDSEPSDSATYLCAV
Capra hircus V99 ighv AJPT02103366.1 10823 VLSQVQLQESGPSLVKPSQTLSLTCTVSGVSLTSYAVGWVRQAPGKALEWLGGISSGGSTGYNPALKSRLSITRDTSKSQVSLSLSSVTTEDTAVYYCAR
Capra hircus V100 ighv AJPT02103366.1 22894 VLSQVQLQESGPSLVKPSQTLSLTCTVSGFSLTSYAVGWVRQAPGKALEWLGIIYSGGSTYYNSALKSRLSITRDTSKSQVSLSLSSVTTEDTAVYYCAR
Capra hircus V101 ighv AJPT02103366.1 36474 VLSQVQLQESGPSLVKPSQTLSLTCTVSGVSLTSYGVGWVRQAPGKTPEWLGGIDSDGDTSYNPALKSRLSITRDTSKSQVSLSLRSVTTEDTAVYYCAR
Capra hircus V102 ighv AJPT02103366.1 45364 VLSQVQLQESGPSLVKPSQTLSLTCTDSGFSLTSYGVGWVRQAPGKAPEWVGGIDYDGDTSYNPALKSRLSITRDTSKSQVSLSRSSVTTEDTALYYCAR
Capra hircus V111 trdv AJPT02103407.1 11276847 KGVLCNQVTQSSPEQRVASGREVTLQCTFQTTYSNPDLYWYRKRPDAVFQFVLYRDNTRSHDADFARGRFTVQHSVRSKTFHLVISSVRPEDTATYYCALEL
Capra hircus V118 igkv AJPT02103452.1 11986465 SNGAIVLTQTPRSLSVIPGETASISCRASQNVQNRYGDNFLHWYVQKPSQSPQLLIYAASNRASGVSDRFTGSGSGTDFTLKISRVEAEDAGVYYCQQSKETP
Capra hircus V119 igkv AJPT02103452.1 11997992 SIGDVVLTQTPLSLSVIPGGTASISCKSSQSLKYSDGNTYLYWFQHKPGQSPRRLIYLVSNRDTGVPDRFTGSGAETDFTLTISSVQAEDAGVYYCFQAINYP
Capra hircus V120 igkv AJPT02103452.1 12030220 SIGAMMQTQTLRSLSVIHGEKASISCRASQSIQNRYGYNFLHWYVQKPSQSPQLLIYRASNWESGVPDRFTSSGLGADTILIVSRVEAEDARVYYCQQSLQ
Capra hircus V121 igkv AJPT02103452.1 12040356 SSGDVVLTQTPLSLSVIPGETASISCKSSQSLVHSDGKTYLNWIKHKPGQSPEGLIYQVSNRYSGVSDRLTGSGSGTDFTFTISRVQAEDAGVYYCYQGTEAP
Capra hircus V122 igkv AJPT02103452.1 12069207 ARCDIQVTQSPSSLSASLTERVSITCRTSQSVSNYLNWYQQKPGQAPKLLIYYATRLYTDVPSRFSGSGSGTDYTLTISSLEADDAATYYCLQDYS
Capra hircus V123 igkv AJPT02103452.1 12084758 ASGEAVLYQTPAYIAVPLGESISITCRANQSISDYLSWHKQKPGQAPMILIYDADNRRNGVPERFTATQSGTDFVFTISQIEADDAAMYYCQQSYVFP
Capra hircus V126 trgv AJPT02103489.1 21357496 IQQEIRLSQRSVMVGSAGGAMTMPCQVSRSVNYVHWFRQLEGQAPERLLYLALSKRDVQWDSVLGGDKVSAARGGDGKSCTMSLRKLAKSDEGLYYCAAWD
Capra hircus V129 trav AJPT02004593.1 1661 GTNGDSVNQTEGPVTVSEGAFMTLNCTYQTAGPAPYLFWYIQHLNKAPRLLLKGSMSDLKPKSEGFQATLVQSDSSFHLQKQAVQASDSAVYYCALS
Capra hircus V130 trav AJPT02005847.1 8740 GTNGDSVNQTEGPVTVSEGALMTLNCTYQTTYSDSYLFWYVQHLNKAPQFLLKGSTTNQRPEHEGFQATLVQSDRSFHLQKRAVQASDSAVYYCALS
Capra hircus V132 trav AJPT02006443.1 6951 GTNGDSVNQTEGPVTVSEGALMTLNCTYQTAVFSPYLFWYVQHLNKAPQLLLKGLTADKKVEHEGFQATLVKTDSSFHLQKWAVQASDSAVYYCALS
Capra hircus V133 trav AJPT02006575.1 606 VRGLDVEQSPPALSLQEGASHMLRCNFSGSVSSVQWYLQNPSGRLIHLFNVPSGTKQDGRLKATTIPTERRSSLHVSSSQTTDSGTYFCAAQHSAPQ
Capra hircus V134 trav AJPT02008226.1 4869 GTSGDSVTQTEGVVILPEKASLTLKCTYQSSYSDFLFWYVQYKNKELELLLKSSLGDQKVTSRGFEATHISSDSSFHLQKSSVQKSDSAGYYCALS
Capra hircus V135 trav AJPT02008226.1 4179 GTSGDSVTQTEGVVILPEKASLTLKCTYQSSYSDILFWYVQYKNKELELLLKSSLGDQKVTSRGFEATHISSDSSFHLQKSSVQTSDSAGYYCALS
Capra hircus V136 trbv AJPT02012427.1 472 LVDSEVTQTPKYLIKSRQQQVTLSCSPESAHHSVYWYQQALGQGPQFLVQYYNREMIQKGKISDRFSGKQFSDFHSELNLTSLELTDSAVYLCASSQ
Capra hircus V137 trav AJPT02013973.1 513 GTSGDSVTQTERVVTLPETASLTLKCTYQSSYSVSLFWYVQYQNKELELLLKSSLGNQKVTSRGFEATHISSDSSFHLQKSSVKTSDSAVYYCALS
Capra hircus V138 trav AJPT02015467.1 2011 GAGAQSVTQPDDHITVSEGARLELKCNYSSSVSPYLFWYMQYPNQGLQLLLKYQSGDNLVSGIKGFEAEFRRSEESFHLRKIPAHWKDSAKYFCALS
Capra hircus V139 trav AJPT02017548.1 481 QTRGDSVSQMDGQVTLLEGAALTVNCTYSATRYPTLFWYAQYPGEGPQLLLKATKASDKGTNKGFEATYNAKTTSFHLEKASVQESDSAVYHCALS
Capra hircus V140 trav AJPT02023204.1 575 VSGMDVVQSPPALSLQEGASSTLRCNFSTLADNVQWYLQNPGGHLIHLFYIPSGTKQDGRLNATTVPTERRSSLHISSSQTTDSGTYFCAAQHSAPQ
Capra hircus V143 trav AJPT02025070.1 1565 VSLGNKVEQSPSTLSVQEGNSSVITCTYTDGNSEYFPWYKQEPGKGPQLLIAIRSNKDKEEDQKLTVFLNKTAKRLSLHIANTEAGDSAVYFCAAR
Capra hircus V145 trdv AJPT02029153.1 1713 SGVAQKVTQDQSDVSSQVGQSVTLNCRYETSWTAYYIFWYKQLPSGQMTYVIRQGSLVTNATKDRYSINFQKADKSISLIISSLQLEDSAKYFCALCD
Capra hircus V146 trav AJPT02030345.1 401 GARAQTVTQPESHISVSKGDPVQVKCSYSYSGSPVLFWYVQYSRQHLQLLLKHTSRENIQGFTAELSRAEASFHLKKPSAQEGDSAVYYCALG
Capra hircus V147 trbv AJPT02041626.1 1318327 LVNSGLTVTPKYLIKSRKEQLTLRCSSDSGHRSVYWYQQALGQSPRFLFQYYDGKVYQKGNISDKVSGKQFSDDARFELSLTSLELTDWAMYLCASSQ
Capra hircus V148 trbv AJPT02041626.1 1307857 LIHAGVTQDPRFQVVRTGQSTTLKCTQDLDHNSMYWYRQDPGLGLRLIHYSAAYPSTEKGDVPEGYSVSRPSTEDFPLTLKSASRSQTSVYFCASSY
Capra hircus V149 trbv AJPT02041626.1 1305633 LVDSGVTQTPRYLIKARGQRGTLRCSPVSGHLSVYWYQQALGQGPQFLVQYYSQDVRGEAQLPDRFSGEQFSDSSSELNLTSLELTDSAVYLCASSQ
Capra hircus V151 trbv AJPT02041626.1 1288455 AVHAGVTQDPRFQVVRTGQNTTLYCTQDLGHDRMFWYRQDLGHGLRLIHYSAAYPSTEKGDVPEGYNVSRPSTEDFPLTLKSASRSQTSVYFCASSY
Capra hircus V152 trbv AJPT02041626.1 1286251 LVDSGVTQTPRYLIKARGQRGTLGCSPVSGHLSVYWYKLVLGQGPQFLVQYYSQDVWGETNLPDRFSGEQFSDSSSELNLTSLELMDSAVYLCASSQ
Capra hircus V153 trbv AJPT02041626.1 1277591 AVHAGVSQDPRFQVVRTGQNATLKCTQDLGHDGMYWYQDLGHGLRLIHYSAGPPSTEKGDVPDGYRVSRSSKENFPLTLESTSRSQTSVYFCASSY
Capra hircus V154 trbv AJPT02041626.1 1275274 LVDSGVTQIPKYLIKSRKQQVTLRCSPESGHRYVSWYQQALGKSPQFLVQYYDGKVRTKGNMPDRFSGEQFSDSRSQMNPSALELTDSAMYLCASRQ
Capra hircus V155 trbv AJPT02041626.1 1272375 VVRAGVTQDPRFQVVRTGQRATLKCTQDLNHDSMYWYRQDLGHGLRLIHYSSFTDATYKGDVPDGYNVSRSSTENFPLTLESANPSQTSVYFCASST
Capra hircus V156 trbv AJPT02041626.1 1269529 HTGAGVVSQSPRHTVAGRGQNVTLRCDPISGHISLYWYRQTLGQGPEFLTYFQNEQELDKSGMPKNRFSAKRPQSTYSYLNIQPAEPGDSAVYLCASSP
Capra hircus V157 trbv AJPT02041626.1 1257396 PLEAEVTQTPRHLIKTKGQTATLRCSPMSGHSSVSWYQQARSQGPQFLFEFYETLQRDKGNFSNRFSAKQFRDFSSELNVNFLELTDSALYLCASSL
Capra hircus V158 trbv AJPT02041626.1 1252424 HTRAGVVSQSPGYRVTGRGQNVTLRCDPIPGHQVLYWYRQMLGQGPEYLTYFQGKEEPDKSGMPKNRFSAERPESTYSYLKIQPVEPKDSAVYLCASSP
Capra hircus V159 trbv AJPT02041626.1 1229016 TTDANLGVTQTPRHEVTEKGQAVTLSCEPIKSHTALYWYRQTSVRGLELLIYFRSEAPVDESGMPKDRFSAKMPNASFSTLKIQPTDPGDSATYLCASSK
Capra hircus V160 trbv AJPT02041626.1 1213536 PTDAGVTQTPRHEVTEKGQAVTLSCEPIKSHAALFWYRQTSVRGLELLIYFNNQSPVDESGMPKDRFSAKMPNASFSTLKIQPTEPGDSATYLCASSK
Capra hircus V161 trbv AJPT02041626.1 1211047 CISAEVAQSPSHRVIEKKQAVNLSCDPVSGHNSLFWYYHAVGTEMKLLIYFLRESVQDNSGMPKGRFTAERTQGTSSTLRVHSAELGDSGVYFCASSR
Capra hircus V162 trbv AJPT02041626.1 1208721 HVGAMVIQNPRYLVTGLGKPVTLSCSQDMKHDVMYWYQQKPSQAPKLLLYYYDKEITREKNTSENFQSSRPNTSFCSLDIRSAGLGDSAVYLCASSR
Capra hircus V163 trbv AJPT02041626.1 1203658 FLEAEVTQTPGHLVQGKGLEVEMYCVPKKGHIYVFWYQQILAKEFKFLISFQNDKVLDDKEMPKKRFSAKCPSNSPCSLKIQPAEPQDSAMYFCASSD
Capra hircus V164 trbv AJPT02041626.1 1163829 TVAGEVTQTPKYLLKKEGGAVTLECEQDFDYDSMYWYRQDPGLGLRRIFFSQVVKDVQEEDIAKGYSASREKKPFFPLTVTSAQKNQTALYLCAASR
Capra hircus V165 trbv AJPT02041626.1 1158621 GSGLGAVVSQQPRRAVSKSGASVTIECRAVDFQATTVFWYRQFPKRGLVLMATSNAGTDATYEQGYNKDKLPISQPNLTFSSLMVTNVDPADSSLYFCGAR
Capra hircus V166 trbv AJPT02041626.1 1151957 SMDTEVTQSPSHLVKGKDRKAKMDCVPIKGHSYVYWYRKKPEGAFEFLVYLQNQDVVEDTAMFKQQFSADCPPNSPCSLEIKSTKAADSALYFCASSQ
Capra hircus V167 trbv AJPT02041626.1 1146623 SMDTEVTQNPSHLVKGKDQRAKMDCVPIKGHSNVYWYRKKLEAFEFLVYLWNGKITEDTAMFKQRFSAECPQNSPCSLEIKSTEAPDSALYFCASS
Capra hircus V168 trbv AJPT02041626.1 1137173 SMDIEVTQSPSHLVKGKDQRAKMDCVPKKGRSYVYWCCRKLEEAFEFLVYLQDEKIIEDTDMFKQRFSAECPQTSPCSLGIKSTKASDSALYFCASSQ
Capra hircus V169 trbv AJPT02041626.1 1126860 SMDTEVIQSPGHLVKGKDQKAKMDCVPIKGHVHVYWYRKKPEGAFEFLVYLQNQDIVEDTEVFQQQFLAQWPQNSPCSLEIKSTKAADSALYFCASSQ
Capra hircus V170 trbv AJPT02041626.1 1122948 SMDAEVTQSPSHLVKGKGQKAKMDCVPIKGHINVYWYRRKLEEALEFLVYLQKQDIVEDTEVFKEQFSAQCPQNSPCSLEIKSTKAADSALYFCASSQ
Capra hircus V171 trbv AJPT02041626.1 1116760 SMDTEVTQRPSHLIKGKDQKAKMDCVPKEGHPYVYWYRKKLEGAFEFLVYFQNQDTMEDTVEFKQRFSAECPQNSPCSLEIKSTEAADSALYFCASSQ
Capra hircus V172 trbv AJPT02041626.1 1112312 PKDAEIYQIGFLLAEAGQDVTLECKRNLGYSAMYWYQQDPGQGLKLTYYSTLETDIQRGDLSEGYSVSREKKELFPLTVKSAHTKQTAVYLCSG
Capra hircus V173 trbv AJPT02041626.1 1106783 SMDTGVTQTPRNRIAVTGKSTVLECSQTKGHESMYWYRQDPGRGLRLVYSSYDINGINKGDVSAGYNVSRKEKAKFSLYLEPATPNQTAIYFCASSI
Capra hircus V174 trbv AJPT02041626.1 1100411 FTDADVYQTPRHCVTGTGRKITLECSQTMGHDNMYWYQQDPGMELQLIHYSYGVNTTEKGERSSRSTVSRISKEHFPLTLETASSSQTSSYFCASSD
Capra hircus V175 trbv AJPT02041626.1 1098480 LEDAAVIQFPRHRILKAEKEFTLQCSQKMNHYAMYWYRQDPGFGLQLIYYSTGPDTFKKGDVPEGYHVSRDELDHFPLTLKSASPNQTSVYFCA
Capra hircus V176 trbv AJPT02041626.1 1082712 PREADVTQSPRHRITETRKRVTLTCSQNMNHDVLYWYRQDPGLGPKLVYFSRNVGFVEKGDISDGYTASREEKPNFPLILELTSTNQTSLYLCASSE
Capra hircus V177 trbv AJPT02041626.1 1076618 LMDAQVTQTPRYLVKRRGEKVVIECMQNMDHERMFWYRQDPALGLQLLHFSINVDVLEEGDVPYGYSVSRTKKKSFPLTLESATTNQTAMYLCASSE
Capra hircus V178 trbv AJPT02041626.1 1069032 SVFGALLSQKPSRAIRQRGTSMTIDCQVDSQLTLMYWYRQLPGQSLVLMATANQGSKATYESGFTEDKFPISRPNLAFSTLTVSNASSEDSSSYFCSAG
Capra hircus V179 trav AJPT02050181.1 74467 SAGKGVEQPTEWTAMEGASAQVNCTYQTSGFNGLFWYQQHDGGAPVFLSYNVLDGLETRGHFSSFLRRSDACSYLLLKELHMKDFASYLCAVI
Capra hircus V180 trav AJPT02066484.1 127272 NVFDAKTTQPSSMDHPEGEDVNLHCNHSTISGDDYIHWYRQNPNQSPHYVIRGFRDTVNSSMASLHIASDRKSSTLVLPQVTLRDAAVYYCIVRE
Capra hircus V181 trav AJPT02066484.1 116798 GTGAQLVTQPDGHIVSEGNRLELRCNCSYGGSIYLFWYVQYPSQGLQFLLKYLSGPTRVKGIKGFEAEFKNDENSFHLMKASAHWSDSAKYFCALC
Capra hircus V182 trdv AJPT02066484.1 97277 SGVAQRVIQDQPDISSQLGQSVTLNCRYGTTWSSYYLFWYKLLPSGEMIYLIHQVSSGQNARNGRYSVNFQKARKSISLTISDLQLEDSAEYFCALWE
Capra hircus V183 trav AJPT02066484.1 76411 VSLGNKVEQSPSTLSIQEGDSSVITCTYTDGNSEYFPWYKQEPGKGPQLLIAIRSNKGKEEDQRLTVLLNKTAKRLSLHIATTEAGDSAVYFCAAR
Capra hircus V184 trav AJPT02066484.1 61619 QTHGNSVTQMDGQVSHSEGTSVTINCTYSAAGYPALFWYVQYPGEGPQLLLKAMKASDKGTNKGFEATYNTETTSFHLEKASVQESDSAVYYCALS
Capra hircus V185 trav AJPT02066484.1 56706 QTHGNSVTQMDGQVSHSEGTSVTINCTYSAAGYPALFWYVQYPGEGPQLLLKAMKASDKGTNKGFEATYNTETTSFHLEKASVQESDSAVYYCALS
Capra hircus V186 trav AJPT02066484.1 52445 VSLGNKVEQNPSTLNVQEGNSSVITCTYTGGYSEYFPWYKQEPGKGPQLLIAIHSNKGKEEDQKLTVLLNKTAKSLSLHIATTEAGDSAVYFCAAR
Capra hircus V187 trav AJPT02066484.1 43953 SSIAQKVAQDQPPMSVQEKETVTLDCTYDTSITTYSLFWYKQPSSGVMTFLIRQDSSNKPNATEGRYSLNFQKASKFITLTISASQLEDSAVYFCALSE
Capra hircus V188 trav AJPT02066484.1 35971 QTRGDSVSQMDGQVTLLEGATLTVNCTYSAIGYPTLFWYVQYAGEGPQLLLKATKADNKGTNEGFEATKDAKTTSFHLEKASVQESDSAVYHCALS
Capra hircus V189 trav AJPT02066484.1 32819 GVRGVKVEQSPSVLSLQEGANSTLWCNFSDTVNSVQWFQQNPGGSLTRLFFIASGTKQNERLSSTVNSKEQYSTLHITASQLEDAATYLCAVE
Capra hircus V190 trav AJPT02066484.1 28773 ISLGNKVEQSPSTLSVQEGNSSVITCTYTDTASAYFPWYKQEPGKGPQLLVAIHSNMGEKKDQRLTVLLNKTANHLSLHIATIQPGDSAVYFCAAR
Capra hircus V191 trav AJPT02066484.1 24952 SIIAQKVTQAQPQVLGQEKEAVTLDCKYDTSDSRYSLLWYKQPSSGGMILLIRQDSYNQQNATEGCYSLNFQEARKSFTLVISASQLEDSAVYFCALSE
Capra hircus V192 trav AJPT02066484.1 4934 VSGKNQVEQSPPSLAVLEGENCTFQCNYTVSPFNNLRWYTQDTGRGLVSLITMTYNDNKKSNGRYTATMDATAKHSSLHLTAAQLSDPAFYICVVG
Capra hircus V193 trav AJPT02075060.1 38490 DSRGQSVTQPDDPVLVSEGTSLELKCNYSYGATPYLFWYVQYPGQRPQLLLKSFSGNTVVQGIRGFVAEFRSSDFSFNLRKFSAHWHDSAEYFCALS
Capra hircus V194 trav AJPT02075060.1 28024 GVKAVKVEQSPSGLNLQEGANCTLKCNFSATVKTLQWFQQNPGGSLISLFFIASGMKQNERLSSTVNSEERYSTLHITASQLEDAATYLCAVE
Capra hircus V195 trav AJPT02075060.1 21474 VSLGNKVEQSPSTLSVQEGNSSVITCTYTDGNSEYFPWYKQEPGKGPQLLIAIRSNKDKEEDQRLTVFLNKTAKRLSLHIATTEAGDSAVYFCAAR
Capra hircus V196 trav AJPT02075060.1 15465 SSIAQKVTQDQPPISVQEKETVTLDCTYDISIATYSLFWYKQPSSGVMTFLIRQDSSNKPNATEGRYSLNFQKASKFITLTISASQLEDSAVYFCALSE
Capra hircus V197 trav AJPT02075060.1 3729 GVRGVKVEQSPSVLSLQEGANSTLWCNSSDTVNRVQWFQQNPGGSLTRLFFIASGTKQNERLSSTVNSKERYSTLHITASQLEDTATYLCAVE
Capra hircus V198 trav AJPT02075446.1 76057 GTSGDSVTQTERVVTLPETASLTLKCTYQSSYSVSLFWYVQYQNKELELLLKSSLGNEKVTSRGFEATHISSDSSFHLQKSSVKTSDSAVYYCALS
Capra hircus V199 trav AJPT02075446.1 70281 GTNGDSVNQTEGPVTVSEGALMTLNCTYQTANLAPYLFWYIKHLNKAPRLLLKGLMSDPKPKSEGFQATLVQGDRSFHLQKRAVQASDSAVYYCALS
Capra hircus V200 trav AJPT02075446.1 57602 ENNGDSVNQTEGPVTVSEGALMTLNCTYQTANSAPFLFWYIQHLNKAPQLLLKGLTADKKVEHEGFQATLVQSDRSFHLQKRAVQASDSAVYYCALS
Capra hircus V201 trav AJPT02075446.1 49208 GTNGDSVSQTEGPVTVSEGALMTLNCTYQTADSAPYLYWYVQHLNKALQLLLKGSARDPKPKSEGFQATLVQSDRSFHLQKRAVQASDSAVYYCALS
Capra hircus V202 trav AJPT02075446.1 33446 GTNGDSVSQTEGPVTLSEGALMTLNCTYQTTYPDFYLFWYVQHLNKAPQFLLKGSMTNQRPEHEGFQATLVKSDSSFHLQKRAVQASDSAVYYCALS
Capra hircus V203 trdv AJPT02075446.1 31302 SIMAQKVTQNWSEISVLEKEDVTLNCAYEANSYTHYLFWYKQPPSGEMIFLIHQESYNELNTTKGQYFLNFQKATSSISLTITDLQLKDSAVYFCALR
Capra hircus V204 trav AJPT02075446.1 15828 VSSKQDVSQSPEALSVREGDSLVLNCSYTDGALYFLQWFRQDPRKGLTSLLSIQANQKEKASGRITVSLDKSSRHSALYIATSQHSDSTTYLCAV
Capra hircus V205 trav AJPT02075446.1 11371 GAGAQSVTQPDDHITVSEGARLELKCNYSSSFSPYLFWYVQYPNQGLQLLLKYESGDNLVSGIKGFEAEFRRSEKSFHLRKIPAHWKDSAKYFCVLS
Capra hircus V206 iglv AJPT02075574.1 11608 SWAQSALTQPASVSGNLGQMVTISCTGTSSDIGGYNYVGWYQQLPGSAPKTLIYNVNNRPSGIPARFSGSKSGNTATLTISELQAEDEADYYCSSARS
Capra hircus V207 iglv AJPT02075574.1 8086 SWAQSALTQPASVSGNPGQTVTISCTGTSSDIGGYNYVGWYQQLPGSAPKTLIYNVNNRPSGIPARFSGSKSGNTATLTISGLQAEDEADYYCS
Capra hircus V210 trav AJPT02077385.1 72486 NVIDAKTTQPDSMDCAEGENVYLPCNHSTIGGDEYVHWYQQNPNQSPQYVIHGLQGTVNSSMASLHIAPDRKSSTLVLPQVTLRDAAVYYCVLRE
Capra hircus V211 trav AJPT02077385.1 69559 VRGVDVEQSPPALSLQEGASYTLQCNFSTSPQSVNWYLQNPGGHLIQLFYIPSGTKQDGRLKATTVPAERRSSLHISSSQTTDSGTYFCAAQHSAPQ
Capra hircus V212 trdv AJPT02077385.1 63485 SGVAQKVTQDQPDITRQVEQSVTLNCQYEVSWYMDYYSIFWYKQLPRGQMTYLIRQYSEDGNARDGRYSVNFQKADKSISLTISALQLEDTAKYFCALRE
Capra hircus V213 trav AJPT02077385.1 33624 VRGLDVEQSPPALSLQEGASHMLRCNFSGSVSNVQWYLQNPSGRLIQLFNVPSGTKQDGRLKATTIPKERRSSLHISSSQTTDSGTYFCAAQHSAPQ
Capra hircus V214 trav AJPT02077385.1 7357 TVIDAKTTQPNSMDCAEGEDVNLPCNHSTIRGDDYIHWYRQNPNQSPQYVIHGLRGTVNRSKASLHIASDRKSSTLVLPQVTLRDAAVYYCALRE
Capra hircus V215 trav AJPT02082281.1 47743 GTNGDSVNQTEGPVTVSEGALMTLNCTYQTANLAPYLFWYIKHLNKAPRLLLKGLMSDPKPKSEGFQATLVQGDRSFHLQKRAVQASDSAVYYCALS
Capra hircus V216 trav AJPT02082281.1 36443 GTNGDSVTQTEGPVTVSEGTLMTLNCTYQTADPAPYLFWYIQRLNKAPQLLLKGSMSDLKPKSEGFQATLVKTDRSFHLQKQAVQASDSAVYYCALS
Capra hircus V217 trav AJPT02082281.1 26695 GTNGDSVNQTEGPVTVSEGTLMTLNCTYQTTYSNPYLYWYIQHLNKAPQLLLKGLTADKKVEHEGFQATLVQSDRSFHLQKRAVQASDSAVYYCALS
Capra hircus V218 trav AJPT02082281.1 21274 GTNGDSVNQTEGPVTVSEGALMTLNCTYQTANLAPYLFWYIQHLNKAPRLLLKGLMSDPKPKSEGFQATLVQGDRSFHLQKRAVQASDSAVYYCALS
Capra hircus V219 trav AJPT02082281.1 11388 GTNGDSVNQTEGPVTVSEGALMTLNCTYQATYSNVYLFWYVQHLNKAPQLLLKGLTADKKVEHEGFQATLVQSDRSFHLQKRAVQASDSAVYYCALS
Capra hircus V220 trav AJPT02082281.1 4623 VTNGDSVSQTEGPVTLSEGALMTLNCTYQATYSDFYLFWYVQHLNKSPQLLLKGSTTNQRPEQEGFQATLVQSDRSFHLQKLGVQASDSAVYYCALSDAV
Capra hircus V221 trav AJPT02082281.1 2438 SIMAQKVTQNQSEISVLEKEDVTLNCAYEANSYTYYLFWYKQPPSGEMIFLIHQESYNELNTTKGQYFLNFQKATSSISLTITDLQLEDSAVYFCALR
Capra hircus V222 trav AJPT02085509.1 29686 VRGVDVEQSPPALSLQEGASYTLQCNFSTSPQSVNWYLQNSGGHLIQLFYIPSGTKQDGRLKATTVPAERRSSLHISSSQTTDSGTYFCAAQHSAPQ
Capra hircus V223 trdv AJPT02085509.1 23936 SGVAQKVTQDQPDITSQVGQSVTLNCKYEVSWYRISYSIFWYKQLPSGQMTYLIRQYSENGNARDGRYSVNFQKADKSISLTIPALQLEDTAKYFCA
Capra hircus V224 iglv AJPT02086925.1 27447 SWAQAVLTQPSSVSRSLGQRVSITCSGSSSNVGYGNYVGWYQQVPGSGLRTLIYGATSRASGVPDRFSSSKSGNTATLTISSLQAEDEADYFCSSYDSSGYN
Capra hircus V225 ighv AJPT02087512.1 29763 VLSQVQLQESGPSLVKPSQTLSLTCTDSGFSLTSYGAGWVRQAPGKAPEWVGGIDYDGDTSYNPALKSRLSITRDTSKSQVSLSRSSVTTEDTALYYCAR
Capra hircus V226 ighv AJPT02087512.1 26357 VLSQVQLQESGPSLVKPSQILSLTCTVSGFSLTSYGVGWVRQAPGKALHWVGGVDYDGDTSYNPALKSRLSITRDTSKSQVSLSLSSVTTEDTAVYYCAR
Capra hircus V227 trav AJPT02090071.1 46909 GVRGVKVEQSPSVLSLQEGANSTLWCNFSATVNSVQWFQQNPEGSLISLFFIASGMKQNERLSSTVNTKERYSTLHITAFQLEDAATYLCAVE
Capra hircus V228 trav AJPT02090071.1 8734 DSRGQSVTQPDDPVLVSEGTSLELKCNYSYGATPYLFWYVQYPGQRPQLLLKYFSGNTVVQGTRGFLAEFKSSDFSFNMRKFSAHWSDSAEYFCALS
Capra hircus V229 trav AJPT02091817.1 18471 QTRGDSVSQMDGQVTLLEGATLTVNCTYSATRYPTLFWYVQYPGEGPQLLLKATKASDKGTNKGFEATYNAKTTSFHLEKASVQESDSAVYHCALS
Capra hircus V230 trav AJPT02091817.1 14191 GVRGVKVEQSPSILSLQEGANSTLWCNSSDTVNRVQWFQQNPGGSLTRLFFIASGTKQNERLSSTVNSKEQYSTLHITASQLEDTATYLCAVE
Capra hircus V231 trav AJPT02091817.1 9188 VSLGNKVEQSPSTLSVQEGDSSVITCTCTDTASAYFPWYKQEPGKCPQLLVAIHSNMGEKNDQRVTVLLNKTANHLSLHIATIQPGDSAVYFCAAR
Capra hircus V232 trav AJPT02103073.1 12842 GTRAQTVTQPESHIPVSEGDPVQVKCSYSYSGSPVLFWYVQYPRQRLQLLLKDTSRESIQGFTAELSRAEASFHLKKPSAREEDSAVYYCALG
Capra hircus V233 trav AJPT02103073.1 8310 VNSQQGEQNLQTLSIQEGENVTMNCSYKSITITTLQWYRQDSRRGFVHLILMRSNERQKHSGRLRFTLDSSIKSSSMSITASQAEDTATYLCAP
Capra hircus V234 trbv AJPT02103310.1 12885 LMDAQVTQTPRYLVKRRGEKVVIECMQNMDHERMFWYRQDPALGLQLLHFSINVDVLEEGDVPYGYSVSRTKKKSFPLTLESATTNQTAMYLCASSE
Capra hircus V235 trbv AJPT02103310.1 568 LMDAQVTQTPRYLVKRRGEKVVIECMQNMDHERMFWYRQDPALGLQLLHFSINVDVLEEGDVPYGYSVSRTKKKSFPLTLESATTNQTAMYLCASSE
Capra hircus V241 iglv AJPT02103384.1 19614 SWAHAVLTQPPSVSGSLGQSVTISCSGSSNIGILGVSWYQQLQGSAPKTLIYGSNKRPSGVPDRFSGTKSGNTGTLTITSLQAEDEADYYCASADLILNS
Capra hircus V242 iglv AJPT02103384.1 17990 SLSQPLLTQPASLSASPGASARLTCTLSSGYNVGNYSIYWYQQKAGSPPRYLLRFKSDSDKHQGSGVPNRFSGSKDASTNAGLLLISEVQPEDEADYYCAVWHG
Capra hircus V243 iglv AJPT02103384.1 14786 SLSQPLLTQPASLSASPGASARLTCTLSSGYNVGNYSIYWYQQKAGSPPRYLLRFKSDSDKHQGSGVPNRFSGSKDASTNAGLLLISEVQPEDEADYYCAVWHG
Capra hircus V244 iglv AJPT02103384.1 7275 CADSAALRVSSLGQRVSIFCNGSSSNIGGGNYVGWYQLIPGSGLRTIIYGTTGRPSGVLDRFSGSRSGNTATLTITSLQAEDEVDYYCATYDSSSYN
Capra hircus V245 trav AJPT02103407.1 11904750 MNGQQIKHFPEFLLLQEGENFTMYCNSSSLLSSLQWYKQRPGGSPVLLMILAKSGEMKTQQRQTGQFGESRQHSSLHLTAAQLSDAGTYFCAVA
Capra hircus V246 trdv AJPT02103407.1 11898436 SGVAQKVTQDQSDVSSQLGQSVTLNCRYETSWNTYYLYWYKQLPSGQMTYVIHQGSQVTNARKDRYSVNFKKADKSISLTISALQLEDSAKYFCALSV
Capra hircus V247 trav AJPT02103407.1 11890176 TVINAKTTQPSSMDCAEGEDVNLPCNHSTIGANDYIHWYRQNPNQSPQYVIHGFRDTVNSSMASLHIAPDRKSSTLVLPQVTLRNAAVYYCALRE
Capra hircus V248 trav AJPT02103407.1 11887210 VRGVDVEQSPPALSLQEGASYTLRCNFSTFPQSVNWYLQNPGGRIIHLFYIPSGTKQDGRLNATTVPKDGHSSLHISSSQTTDSGTYFCAVQHSAP
Capra hircus V249 trdv AJPT02103407.1 11873325 SSVSQKVTQYQPDITSQARNVVILNCRYETSWNVYTYWIFWYKQLPSGEMTYLIPQYSADGNERDGHYSVNFQKAHKFISLTISSLKLEHSGKYFCTLWE
Capra hircus V250 trdv AJPT02103407.1 11860576 SGVAQSVTQDQPDILSEVGKTITLNCRYETSWNMLRYYIFWYKQLPSGQMTYLIRQHSDDGNARYGRYSVNFQKAHKSISLTVSALELEDSAKYFCVLRA
Capra hircus V251 trdv AJPT02103407.1 11830247 SSVAQRVTQDQPDISSQVGEVVTLSCRYETIQSRYNIFWYKQLPSGEMIYLIGQGSSSQNARYGRYSVNLQRSRKSISLTISDLELEDSAKYFCALWE
Capra hircus V252 trdv AJPT02103407.1 11817413 SGVAQKVTQDQPDIASQVGESAAMNCQYETSRNSYNIFWYKQLPSGEMIYLIGQNSYSPNARDGRYSTNFLRSLKAISLIISALKLEDSAKYFCALWE
Capra hircus V253 trav AJPT02103407.1 11811481 VSSLLTVEQRPPLLRVQEGESTNFTCSFPSSSFYALHWYRWEPAKGPKNLFVISVNGDEKKQGRVRVTLNTKEGYSSMYIRGSQPEDSATYLCA
Capra hircus V254 trdv AJPT02103407.1 11786975 SGVAQKVTQDQSDVSSQVGQSVTLNCRYETSWGAYYLFWYKQLPSGQMTYLIQQYSGYSNARNGRYSVNFQRADKSISLIISSLQLEDSAKYFCAFCD
Capra hircus V255 trav AJPT02103407.1 11779481 NVIDAKTTQPSSMDCAEEEDVTLTCSHSTIGGNVYIHWYLQNPNQSPQYVIHGLRGTGNSSMASLTIDSDRKSSTLVLPQVTLTDATVYYCALRE
Capra hircus V256 trav AJPT02103407.1 11769527 GTGAQLVTQPDGHINVSEGNRLELRCNYSYGGSIYLFWYVQYPSQGLQFLLKYLSGPTRVKGIKGFEAEFKNDENSFHLMKASAHWSDSAKYFCALC
Capra hircus V257 trdv AJPT02103407.1 11752327 SCVAQRVIQDQPDISGQLGQSVTLNCQYATSWSYNYLFWYKLLPNGEMIYLISQVSSGQNARNGRYSVNIQKAHKSISLTISDLQLEDSAEYFCALWD
Capra hircus V258 trav AJPT02103407.1 11737917 VRGVDVEQSPPALTPQEGASSTLWCNFSTFADSVWWYLQKPGGRLIHLIYIPSGTRQEGRLNATAVPKERRSSLHISSLRTTDSGTYFCAVWHSAPQ
Capra hircus V259 trdv AJPT02103407.1 11724898 YSVAQQVTQVQTAVPSQVGQTVTLNCRYEVSWTTAFYYIFWYKQLPRGEMTLLIRQYSEHGNTRNGRYSVNLQKAHKSLSLIISALQLEDSAKYFCALWE
Capra hircus V260 trav AJPT02103407.1 11706083 MNGQQIKHFPEFLLLQEGENFTTYCNFSSTFYNLQWYKQRPGGSPVLLMILAKGGEVKTQQRLTVRFGESRQHSSLHLMGTQPSDVGTYFCAA
Capra hircus V261 trav AJPT02103407.1 11696582 IMVDVEITQLSSMDCAEGEDVNLPCNHSTIDALDYIHWYRQTPNQSPQYVIHGFRDTVNSSMSSLNIASDRKSSTLVLSQVTLRDTAVYYCVLRE
Capra hircus V262 trav AJPT02103407.1 11682643 ESTQQLEQNPKFLRIQEGGNVTVYCNSSSTFTFFQWYRQKPEEGPVLLVTLTKPKEVKEQKRIRAEFGEARKDSSLLITAAQPGDAGTYLCAG
Capra hircus V263 trav AJPT02103407.1 11671558 LSVQMKVEQSPGVLTLQEGRNSSLICNYSISIRSVQWFQQNPDGRLISLFYIASGMQQKGRLKSTINSKERYSQLYIRDSQPGDSATYFCAVE
Capra hircus V264 trav AJPT02103407.1 11644560 VLGDSKTTQPNSVEGTEEEPVHLPCNHSTISGPEYIYWYRQIPHQGPEYLVHGLNNNVTNRMASLSIAKDRKSSTLVLPQVTLRDTAVYYCILR
Capra hircus V265 trav AJPT02103407.1 11637407 LRVQMKVEQSPRVLTLQEGRNSSLICNYSISMTSVQWFQQNPDGRLISLFYIASGMQQKGRLKSTINSKERYSQLYIRDSQPGDSATYFCAVE
Capra hircus V266 trdv AJPT02103407.1 11627556 SSMADKVTQAQTTVTGQEGEAATIGCTYETSRTYYTLFWYRQFPGGRMEFLIYQDSNQANARRDRYSVNFQKGKKTISLTISSLHLADSAKYFCALWE
Capra hircus V267 trav AJPT02103407.1 11616421 ILGDSKTTQPNSVEGAEEDPVHLPCNHSTISGPEYIYWYRQIPHQGPEYLVHGLNNNVTNRMASLSIAKDRKSSTLVLPQVTLRDTAVYYCILR
Capra hircus V268 trav AJPT02103407.1 11608387 VSAQQLNQSPQSMSIQEGEDLSMNCNSSSTLNLLLWYKQDAGEGLILLIKLLKGGELARNGKLTAQFGGTRKDSLLNNSAFEPEDGGTYFCAG
Capra hircus V269 trav AJPT02103407.1 11594394 VKSDDDVMQSPSSLIVLEGSNATLSCSYKVTNVQSLHWYKQEEKVPTFLFALISTGIEKTSGRLRGTLDRKELLSTLHITVTKPGDSATYLCAVE
Capra hircus V270 trav AJPT02103407.1 11588224 LRRADWIRSQESEVSGAEGKTVSLFCNYYTSSRSFVSLFWYRQYPNQAPEYILYRQWGSSGKGYASFATERFYSDNTANTTNLYIRKVVPADTALYLCALE
Capra hircus V271 trav AJPT02103407.1 11545784 LSVAQTVTQPQPEESVQEADTVTLDCTYSTSESDYYLFWYKQPPSGETVFIIHQYAYEQQNATNDRYSVNFQKEAKAFSLRISDSQLEDAAMYFCAYSG
Capra hircus V272 trav AJPT02103407.1 11542581 PSVAQTVTQPQPEESVQETDTVNLHCTYTTSESNYYLFWYKQPPSAEMVFIIRQNAYEQQNATNDRYSVNFQKEAKAFSLKISDSQLEDAAMYFCAYSG
Capra hircus V273 trav AJPT02103407.1 11509216 VSGKNGVEQSPQYLSAQEGDLITINCNYLEGMTTLQWLQQNPGGSIISLLTLSLEMKRKGRVSATINRRERYSSLNITASQPTDSAIYLCAVE
Capra hircus V274 trdv AJPT02103407.1 11479081 SNNVESADVPTVYKKEGESVTVECKFSVSYTYYMMYWYRQPSSGEMIYMINIYSQSKQTREGRYSVEFYKPNQMLKLTISALTLSDSAIYFCAVRE
Capra hircus V275 trdv AJPT02103407.1 11412366 VMSAVVLVPQDQEKTVPVGKSVTLSCSMKGAMFISKHYIFWYRKTPGNTMTFIYREEGVYGPGFEDNFRGKIDNSTNQAMLEILKASERDEGFYYCASD
Capra hircus V282 trav AJPT02103436.1 5968452 SRGQSGTQPDDPVLVSEGTSLELKCNYSYGATPYLFWYVQYPPQRPQLLLKHFLGNTVIQGIRGFVAEFESSDFSFNLRKFSAHWSDSAEYFCALS
Capra hircus V291 trgv AJPT02103454.1 5095471 GLGLSKVEQAQISLSTEVKKSIDIHCKIESTNFESETVYWYRQKRNQALEHLVYVISTTTAARNQVDGKNKIEARKDARMFTSTLTVNFVEKDDVGIYYCAGWS
Capra hircus V292 trgv AJPT02103454.1 5084123 GLGQLTLEQPELSVTGTREKSIIMTCKVFSKDFSKDYIHWYRQKPDQGLEQLLYVSTAPVQNHLGGKKNKLEARKDAPSSTSTLKISFLEKEDEATYYCAGWLS
Capra hircus V293 trgv AJPT02103454.1 5077344 GDIKMKISQHQLSSTRRPDRTVHISCKLSVVPLENAIVHWYQEKEGEPLKRILYGSANSYKLDKPNSRLEMDNKKNEIFYLVINDVVKSDEATYYCACWD
Capra hircus V294 trgv AJPT02103454.1 5040660 TQVSSNMEEDKLSVTRATGSSVVIDCDLTQNYIHWYKFQEGTVPRRLLYYDVYYSKVVLESGISEGKYHVYKGTGKSYTFVISNLQESDSGTYYCAVWE
Capra hircus V295 trgv AJPT02103454.1 5025196 MQVSSNMEGEKMSITKAAVPGAFVEIICDLITQTVKYIHWYKYQEGTAPRRLLYYDISYSKIVLESGISEGKYKVYKEKSYTFAISNLQESDSGMYYCAVWE