WGS Statistics
Organism WGS Record. Vs Total IGHV IGLV IGKV TRAV TRBV TRGV TRDV
Eptesicus fuscus ALEH00000000.1 (ALEH01) 152 57 30 0 26 33 3 3
Vgene Table
Organism Vgene Locus contig Contig Pos. AA sequence
Eptesicus fuscus V100 iglv ALEH01041466.1 8860 CGPQPVLDQPPSVSSPLGTTVRLACTLSRDHDVSIYSIFWYQQRPGHPPRFLLRYFSHSDKKQGPKVPPRFSGSKDVAENTGYLSISELQPEDEALYYCAV
Eptesicus fuscus V238 trbv ALEH01107440.1 6873 VRAQTIHQWPSTKVQLMGSPLSLECTVKGTSNPNLYWYRQTEGGGLQMLFYSTVVGQVDSQASENFEASRPQDGHFVLHSKKLLLSDSGFYLCAWS
Eptesicus fuscus V282 iglv ALEH01129260.1 576 SRAQAALTQLPSVSGNLGQSVTISCAGSSNDIGRYNYVSWYQQRPGTAPKLMISYVNARRPGIPERFSGSKSGNTATLTISGLQAEDEADYHCFSYVGS
Eptesicus fuscus V283 iglv ALEH01129262.1 237 SWAQAALTQPPSVSGNPGQSVTISCAGSISDVGYSNYVSWYQQRPGSAPKLLIYSDSSRPSGIPERFSGSKSGNTATLTISGLQTEDEADYYCCSYRFG
Eptesicus fuscus V284 iglv ALEH01129262.1 2831 SWAQAALTQPPSVSGNPGQSVTISCAGSSNDVGRYNDVSWYQQRPGSAPKLLIYDDTKRPSGIPERFSGSKSGNTATLTISGLQAEDEADYYCCSYRSG
Eptesicus fuscus V285 iglv ALEH01129263.1 949 SVASYELSQPPSVSVNLGQTARLTCGGNSIGRKSVQWYQQKPGQAPMLVVDSDESRTSTIPERFSGSDSGDTDTLTISGAQAQDEADYYCEVWDSSGN
Eptesicus fuscus V286 iglv ALEH01129265.1 196 LCAPPVLTQPPSASAAPGASAKLTCTLSREHSSFYIYWYQQRAGQAPRFIMQLYSNGTHTKGDGIPDRFSGSSSGADRYLTISPLQSEDEAEYFCGADY
Eptesicus fuscus V287 iglv ALEH01129265.1 4186 FVASYELTQSDSLSVAPGETVSITCTGDLLDKQYTSWHQQKPGQAPVALIYKGSERPSGIPDRFKGSSSGKTATLTISNVLAEDEADYYCQSWDSNSN
Eptesicus fuscus V288 iglv ALEH01129266.1 1754 SVASYELTQPPSVSVNLGQTARLTCGGNSIGRKSVQWYQQKPGQAPQLLIYGDIGRPSGIPDRFSGSNSGNTATLTISGAQAQDEADYYCQVWGGNN
Eptesicus fuscus V289 iglv ALEH01129267.1 1547 LCGPVVLTQPPSASAAPGASAKLTCTLSQEHSNYYIDWYQQRAGQAPRYIMYINSDGSTTKGDGIPERFSGSSSGADRYLTISPLQSEDEADYYCGVYGSSD
Eptesicus fuscus V290 iglv ALEH01129272.1 1317 SVASYELTQPPSVSVNLGQTARLTCGGNNIGGRYTYWYQQKPGQAPVLVIYRNSNRPSGIPDRFSGSNSGNTATLTISGAQAQDEADYYCSVWDDSGN
Eptesicus fuscus V291 iglv ALEH01129273.1 243 LCAPVLTQPSSASAAPGASVKLTCTLSQEHSSFNHVSWYQQRAGQAPRFLMYINSDGSTTKGDGIPDRFSGSSSGADRYLTISPLQSEDETEYYCGVGY
Eptesicus fuscus V302 trdv ALEH01136096.1 10816 KGALCYQVTQKSLNQTVASGSEVTLLCTYDTQSLNPDLYWYRSRPDHFFQFILYRDNNMAYDADFTQGRFSVQHSHAHRTFHLVISSVRTEDRATYYCAMN
Eptesicus fuscus V318 trav ALEH01144566.1 2289 TAGPGVQQPAELTAMEGASAQVNCTYQTSGFNGLSWYQQRDGGAPTFLSYNVLDGWGRRGRLSSFLSRSDTYSYLLLRELQSKDSASYLCAVI
Eptesicus fuscus V319 trav ALEH01144573.1 10240 AESKDQVFQRSTMVSSEGAVVEISCNHSISNAYDFFWYLHSPGCAPRLLVKGSRPSQQGRYNMTYERFSSSLLISQVQVADAATYYCAVGDTEAEN
Eptesicus fuscus V321 trav ALEH01144575.1 10430 TLSLAKTTQPIFMLSDEGQEVNIPCNHTNIATNEYIFWYQQFHNQGPQFVIQGYKTDTANEVASLFIAADRKSSVLRLPWASLKDTAVYYCIVSG
Eptesicus fuscus V322 trav ALEH01144577.1 648 LSSQKVEQNPQSLSIQESEKAVLTCSYANYSPVFFQWYRQDPGRGPIFLLLIRENERTKLAGRLKATFDTTAKQSSFYITASQPTDSATYLCAA
Eptesicus fuscus V323 trav ALEH01144578.1 2891 DARAQSVTQPDNHISVSEGASLELRCKYSYSGAVYLYWYVQDPSQGLQLLLKYLSGDTLVKGIKNFEAELRKNESSFNLRKHFAHWSDSAEYFCAMG
Eptesicus fuscus V324 trav ALEH01144581.1 2158 RSNGASVTQTKGQVTLSEGASLTVNCSYETTMYPTLFWYVQYPGEGPQLLLKAENASEKGSSKGFVATYQKQPNAFHLEKTSVHESDSAMYYCALG
Eptesicus fuscus V325 trav ALEH01144585.1 1220 DARAQSVTQPDNHISVSEGASLELRCKYSYTGIVYLYWYVQDPSQGLQLLLKYLSGDTLVKGIKNFEAELRKNESSFNLRKHFAHWNDSAEYFCAVS
Eptesicus fuscus V326 trav ALEH01144590.1 2602 DSRAQSVSQPDHHISVSERASLELRCKYVYAATPYLYWYVQYPSQGLQLLLKNLSGKMLVQGIKGFEAEFKKNESFFNLRKSSAHLSDSAMYFCALS
Eptesicus fuscus V327 trav ALEH01144591.1 2701 GVRGMKVEQSSSALSFQVGTSFTLRCNFSTTVLYMQWFRQNPGGGLINLFYVTSRTKRKGRLSATVDSQDLYSTLNITASQLEDSATYLCAAC
Eptesicus fuscus V328 trav ALEH01144608.1 2848 GMREMKVEQSPSVLSLQEGTTSTLRCTFSSTMYKVQWFRQNPGGGLITLFHMSSGTSHNGRLSATVNTQDLYSTLNITASRLEDSATYLCAAD
Eptesicus fuscus V341 ighv ALEH01151879.1 4986 VLSQIQLQESGPGLVKPPQTLSLTCTVYGFSITTSSYDWSWIRQPPGKGLEWMGCINHNGDTKYSPFLKSRTSISRDTSKNQFSLQLSSVTTEDTAMYYCV
Eptesicus fuscus V342 ighv ALEH01151879.1 7475 VQCEVQLVESGGGFGKPEASLRLSCSASGFTSSSYYMNWVRQNPEKGLEWICAITANGESTYYADSVKGRFTISRDNAKNTIYLQMNSLRSEDTAVYYCAT
Eptesicus fuscus V343 ighv ALEH01151879.1 35021 VQCEVKLVESGGGLVPPGGPLRLGCAASGFTFSSYRMNWVRQVPGKGLEWVSYINEDGSNTYYANSVKGQFTISRDNAKNMLYLQMNSLRSQDTAVYYCVR
Eptesicus fuscus V344 ighv ALEH01151883.1 2076 VLSQVQLQESGPGLVKPEQTLSLTCTVSGVSLTSIGVHWIRQAPGKGLEWIGVIGSAGDTYYNPTLKSRFSISRDTSKSQIYISLTSLTAEDTAVYYCA
Eptesicus fuscus V345 ighv ALEH01151887.1 2114 VQCDVQLVESGGGLVQPGESLTLSCAASGFTFRSYGMSWVRQAPGKGLEWVAVIWNDGSQKYYADSVKGRFTISRDNTNNMLYLQMNSLRTEETAMYYCVR
Eptesicus fuscus V346 ighv ALEH01151890.1 5209 VHSQVQLVQSWAEVRKPGASVKVSCKASGYTFTSYYMHWVRQAPGQGLEWVGWVYPNNGDTKYAQKFQGRVSITKDRSTNTAYMELSSLRSEDTAVYYCAR
Eptesicus fuscus V347 ighv ALEH01151894.1 4736 VQCEAQLLESGGSLVKPGGSLRLSCAASGFTFSTSWMTWVRQAPGKGLEWVSLINPDGSSTYYANSVKGRFTISRDNTKNMLYLQMNSLKVEDTAVYYCAR
Eptesicus fuscus V348 ighv ALEH01151903.1 5355 VLSQVQLQESGPGLMKPSETLSLTCTVSSYSITTSDYRWNWIRQPPRKVLEWMGGIRYDGDTKYSPSLKSRTSISRDTSKNQFSLQLSSVTTEDTAVYYCA
Eptesicus fuscus V349 ighv ALEH01151904.1 11727 VQCEVQLVESGGGLVQPGGSLRLSCAASGFTFSSYWMNWVRQAPGKGLEWISTITQTDGSTYYADSVKGRFTISRDNAKNMLYLQMNSLRSEDTTMYYCA
Eptesicus fuscus V350 ighv ALEH01151906.1 2479 VQCEVQLVESGGGLAQPGGSLRLSCAASGFTFSSYWMSWVCQAPGKGLEWVGIINTDGGTTNYANSVKGLFTISRDNAKNTLYLQMNSLRTEDTAVYYCA
Eptesicus fuscus V351 ighv ALEH01151906.1 6991 VQCEVQLVESGGDLVQPGGSLRLSCKGSGFTFSDYYISWIRQTPGKGWVWIGFIRNKAKGHTTEYAAPVKDRFTISRDDSKSTAYLQMSSLRTEETAMYYCAQE
Eptesicus fuscus V352 ighv ALEH01151906.1 22441 VHSQVQLVQSGAEVGMPGASVKVSCKASGYTFTSFIISWVRQTSGERMKYMGWINTNTGTPTYAQGFSERFVFSMDTSISTAYLQINGLKSEDTAMYYCARE
Eptesicus fuscus V353 ighv ALEH01151907.1 13606 VLSQMQLQESGPGLVKPSETLSLTCTVSGYSITSGYCWTWIRQPLGKGLEWMGCIRYDGNTYYSHSFKSRTSISRDTSKNQFSLQLSSVTTEDTAMYYCAT
Eptesicus fuscus V354 ighv ALEH01151911.1 4432 VLSQVQLQESGPGLVKPSQTLSLTCVVSGFSITTSSYDWTWIRQLPGKGLEWIGCINNNGNTYYSPSLKSRTSISRDISKNQFSLQLSSVTTKDTAVYYCA
Eptesicus fuscus V355 ighv ALEH01151911.1 11810 VQCEVQLIESGGGLVQPVGSLTLSCAASGFTFSDYEMNWVRQAPGKGLEWVSYINGGGGTAYYAASVKGRFITSRDNAKNTLYLQMNSLTAEDTAVYYCAT
Eptesicus fuscus V356 ighv ALEH01151911.1 15707 VQCEVQLVESGGGLVPPGGSLRLSCAASGFTFSDYEMDWVRQASGKGLEWVSYINPAGSTTYYANSVKGRFTISRDNAKNTLFLQMNSLTAEDTALYYCA
Eptesicus fuscus V357 ighv ALEH01151913.1 4133 VQCEVQLVESGGGLVQPGGSLRLSCAASGFTFSSYHMNWVRQAPGKGLERICAITGNGGSTHYTDSVKGRFAISRDNAKNTLYLQMNSLRAEDTAVYYCARE
Eptesicus fuscus V358 ighv ALEH01151916.1 2300 VQCEVQLVESGGGLVQPGGSLKLSCAASGFTFSSYWMAWIRQAPGKGLEWLCRMNPDGSTTNYANSVKGRFTISRDNPKNMLYLQMNNLRAEDTALYYCAR
Eptesicus fuscus V359 ighv ALEH01151929.1 831 VQCEVQLVESGGSLVQLGGSLRLSCKGSGFTFSDYYIHWIQQPPGKGWEWVGLIRNKANGHTTEYAASVKGRFTISRDDSKSTAYLQMSSLRAEDTALYYCAE
Eptesicus fuscus V362 ighv ALEH01155360.1 717 VLSQKQLHESGPGLVKPSQTLSLTCAVSGFSMTTSYTSWNWIRQPAGKELEWMGNIWYDRDTYYNPSLKSRISITRDTSKNQFSLQLSSVTTEDTAMYYCA
Eptesicus fuscus V363 ighv ALEH01155361.1 595 VLSELQLQESGPGLVKPSQTLSLTCTVSGGSVTSSYYWNWIRQPPGKGLQWMGYWTGSTSYNPAFQGRISITADTARNQFSLQLSSVSTEDTAVYYCAR
Eptesicus fuscus V364 ighv ALEH01155365.1 1998 VQCEVQLVESGGGVVQPGGSLRLSCAASGFTFSSYSMDWVRQAPGKGLEWLSQIRTDGGSTYYAASVKGRFTISRDNARNTLYLQMSSLRAEDMAMYYCAR
Eptesicus fuscus V365 ighv ALEH01155369.1 843 VQCEVQLVESGGGLVPPGGSLRLSCAASGFTFSSYSMNWVRQAPGKGLEWVAYISGPSGSTISYAESVKGRFTISRDNAKNTLYLQMSSLRTENTAMYYCAR
Eptesicus fuscus V368 ighv ALEH01156886.1 653 VLSQVQLQELGPGLVTPSQTLSLTCAVSGFSITTSGSCWSWVRQPPGKGLEWMGCICYNGSTNYNPSLKSRISISRDTSKNQFSLQLSSVTTEDTALYYCAG
Eptesicus fuscus V369 ighv ALEH01157136.1 3907 VLSQVQLQESGPGLVTPSQTLPLTCAVSGYSITTSGTCLSWIRQPPGKGLEWMGGICYDGNTYYSPSLKSQTSISRDTSKNQFSLQLSSMTTEDTAVYYCVR
Eptesicus fuscus V370 iglv ALEH01158558.1 1833 PGVQAGLTQEASLSGSLGQKVTLTCKGDSNNVGTYTVGWYQQVTGGAPKTVMLGSSRPSGIPDRFSGSRSGNTASLDITGLQPEDEGIYYCGTWDRGIS
Eptesicus fuscus V371 ighv ALEH01159688.1 1820 VHSQVQLVPSGAEVRKPGASVKVSCKASGYTFTSYYMHWVRQAPGQGLEWVGRVYPGNGDTNYAQKFQGRVSMTADKSTSTAYMELSSLRTEDTAMYYCAR
Eptesicus fuscus V372 ighv ALEH01159755.1 2839 VLSEVQLQESGPGLVKPSQTLSLTCAVSGFSITTSGYSWNWIRQPPGKGLEWMGNIWYDGDTFYSPSLKSRTSISRDTSKNQFSLQLSSVTTEDTAVYYCAR
Eptesicus fuscus V374 ighv ALEH01160353.1 54 VLSQVQLQESGPGLVKPSQTLSLTCTVSGFSITTSGYYWGWIRQSPGKGLEWIGYIHSSGSAWYNPSLKSRTSISKDTSKNQFSLQLSSVTTEDTAMYYCA
Eptesicus fuscus V377 trav ALEH01161438.1 3336 VSGQQLNQSPESMSISEGESISMSCISSSTFNTLLWYKQDAGEGPVLLVTLYKSGDIFRNEKLTAQFGGTRKDSFLNISAPELADGGTYFCAG
Eptesicus fuscus V378 ighv ALEH01162524.1 901 VLSQVQLQQSGPGLVTPSQTLFLTCTVSGYSITSGYCWSWVRQPPGKGLEWMGCINQNGNLYYSPSLKSRTSISRDVSKNQFSLQLSSVTTEDTAVYYCSR
Eptesicus fuscus V379 ighv ALEH01162615.1 313 VQCDVQLVESGGGLVPPGGSLRLSCAASGFTFSSNWMHWVRQAPGKGLEWLGVISPDGSTTNYANSVKGRFTISRDNAKNTLFLQMNRLKATDTAVYYCA
Eptesicus fuscus V381 iglv ALEH01164463.1 950 VDSQTVTQEPSMSVSPGGTVTLTCGLSSGAVSSGNYPSWYQQTPGRPPLLLIYETNRRPSGVPARFSGSISGNKAALTISGAQPEDEADYHCNLYMGSNI
Eptesicus fuscus V383 iglv ALEH01165101.1 516 VDSQTVVTQEPSISVSLGGTVTLTCGLSSGAVSTSNYPSWFQQTPGKPPRSLIYHTNILHSGVPGRFSGSISGNKAALTISGAQPEDEDDYYCA
Eptesicus fuscus V384 iglv ALEH01165712.1 65 SWAQSVLTQPSSVSGAPGQRVTISCSNIKGSYVYWYQQLPGKAPKTIIYDNSNRPSGVPDRFSGSKSGSSATFTITGLQAEDEADYYCSSWDSSISS
Eptesicus fuscus V385 ighv ALEH01166502.1 357 VHSEVQLVQSGAEVRKPGASVKVSCKASGYTFTSYLMHWVRQAPGQGLEWMAKVDPEDGDTKYAQKFQGRVSITADKSMSTAYMELSSLRAEDTAVYYCG
Eptesicus fuscus V409 trgv ALEH01010141.1 41037 TSGDIQITQALTSITKRKGSTAFLECQIREILRKNSYIHWYRQKQDQTLKRILSISSDDDVIHEQGVSEERYEARKHHGNLLVSLRIHGVEEADAGLYYCACWM
Eptesicus fuscus V410 trgv ALEH01010141.1 38428 GDTKMRISQDQLSFIRRPNRTVHISCKLSGIPLENAIVHWYQQKKGEPLRRILYGSTKNSKDNKLNPRLETYRKDGTFNLIINNVVKSDEAIYYCACWD
Eptesicus fuscus V411 trgv ALEH01010145.1 331 GLGQLKLEQPEISISRERDENVHIPCKVSSNSFISDYIYWYQQKPDQSIEHLIYVASSATVFGKNSKFKASKYPQTSTSTLTINFLEKEDEAVYFCACWTG
Eptesicus fuscus V570 trbv ALEH01088555.1 6724 ILDAQITQSPSYKVVGTEKNVTLSCHQTNNRDIMYWYRQDLSHELRLIYYSIGAGITAKGDGADGYSVSRSNTENFALTLESTTLSQTSVYFCASRE
Eptesicus fuscus V571 trbv ALEH01088555.1 5481 HTYAGVSQAPRHIVTERGQNVTLRCNPISGHTRLYWYRQTLGKGLEFLLYFQGKDAPDKSGMPKERFSAERRDGSYSTLKIQRAEQGDSAVYLCASSL
Eptesicus fuscus V572 trbv ALEH01088556.1 6102 PVDSEVTQTPRHLTKARGQTVTLGCSPISGHLAVSWYQQAQGQGLQFLIEYYNREERAKGNIPDRFSGQQFDDYSSKLTMSSLEPKDSALYLCASSL
Eptesicus fuscus V573 trbv ALEH01088556.1 2127 PVDSGVTQTPKHLIKARKQQVTLRCSYISGHLSVYWYQQAQNQGPQFLTEYYNKEERTKGSIPDRFSVQQFSDYRSELTMSSLELTDSALYLCASSA
Eptesicus fuscus V619 trbv ALEH01107443.1 11966 TTEAEVTQTPRHLITETKKNLTVTCSQNMNHEVMYWYRQDPGLGLKLIYYSINVGHFEKGEVSDGFKVSRTEKRNFSLTLESASISQTSLYLCASSL
Eptesicus fuscus V620 trbv ALEH01107443.1 7346 LMDAEVTQVQRYLIKRKGEKVLMECLQDMDHERMFWYRQDPALGLQLLHFSYGVDSYEKGDFPDGYSVSRKKKEGFSLILGSASTNQTSVYLCASSI
Eptesicus fuscus V621 trbv ALEH01107443.1 3058 SVFGALLSQKPLRDICQRGTSVRIQCQADSQLALMFWYRQLPGQSLTLIATANQGSEATYESGFTKDKFPISRPNLTFSILTVSSVNPEDSSFYFCSAG
Eptesicus fuscus V622 trbv ALEH01107444.1 8960 LQDAVVTQFPRHRILGTKKELTLQCSQNMNHISMYWYRQDPGYGLQLIYYSNGVDVFAKGDVHEGYSVSRSELKYFPLTLESASTNQTSVYFCASSD
Eptesicus fuscus V623 trbv ALEH01107445.1 23814 SVDTEVTQGPGHLVKGKGQKAKMACIPIKGHIYVYWYRQKLGEELKFLVYLQNEKILEKTDMINERCSAQCPKNSQCSLEIQSTEPGDSALYFCASSQ
Eptesicus fuscus V624 trbv ALEH01107445.1 15367 SSDVQVTQTPGHLVKGKGQRAKMDCIPPKEHPIVYWYQHTQNKEFKFLIYFQNEEVLDQIELVKKRFSAQCPKNVGCSLEIQASEPGDSALYFCASSL
Eptesicus fuscus V625 trbv ALEH01107445.1 8231 HIDAGVFQTPRNKIAKTRNSIILECSQNEDHDYMYWYRQDPGLGLRLIYYSYDDKIYKGDVPDGYKVSREEQAKFPLFLKAASPNQTAVYFCSSS
Eptesicus fuscus V626 trbv ALEH01107445.1 3992 PIDADVSQTPRHCVTGTGRTITLECSQTMDHNKMYWYHQDPGMELQQMHYSYDVNSTEKGELPSESTISRIRKEHFSLRLVSTSPSHKSWYLCAS
Eptesicus fuscus V627 trbv ALEH01107446.1 5884 TVHSGITQTPKYLLREEGRDVTLDCEQNFSHDSMYWYRQDPGQGLRLIYYSPVVKDVQQGDLAEGYRASREKKPFFPLTVTSTRKSQTAVYLCASSA
Eptesicus fuscus V628 trbv ALEH01107446.1 3289 GSGLGALVSQHPSRAICTSGATVKIQCHPVDLQASTMLWYRQFPKQGLILMATSNMGSSVTYEQGFTEAKFPISHPNLTFSSLTVTRAHPADSSFYLCGAS
Eptesicus fuscus V629 trbv ALEH01107447.1 20034 LSDAVVTQIPRSMVTKKGQEVTLSCEPISGDTYLYWYRQTLVQGPRMLIYFGNQASLDKKGMPNDRFSAQMPNESFSTLKIQSTEPGDSGVYLCASSL
Eptesicus fuscus V630 trbv ALEH01107447.1 17968 HTDGGVAQTPRHKVIKMGQAVTLNCEPISGHNDLYWYRQTLEQGPKFLIYFSSQEPVDDTGMPKERFSAKMPNGSFSTLKIQPTESGDSAVYLCASSL
Eptesicus fuscus V631 trbv ALEH01107447.1 15034 LSDAGVTQTPRHKVTKIGQEVTLSCKPISGHDSLYWYRQTSLQGLKLLVYFRNQAPIDETGMPKGRFSAKMTNGSFSTLKIQPTETGDSAVYLCASSL
Eptesicus fuscus V632 trbv ALEH01107447.1 12070 HTSAGVTQFPSHRVIGKEQAVALRCDPISGHETLLWYQHAIGKDMTFLISFLKEYVQDKSGMPADRFSAERPGGTFSILMVQPARPEDSGVYFCASSL
Eptesicus fuscus V633 trbv ALEH01107447.1 10146 YTGAMVTQNPRYQVTRMGKPVTLSCAQDLNHDVMYWYQQKLSQAPKLLFYYYDQEFINETDTSDNFQPSRLNASFCSLGIRSPGLGDSAVYLCASSK
Eptesicus fuscus V634 trbv ALEH01107447.1 728 PTSASSVTQNPRHLVLGRGQEATLRCNPVKGHVYVYWYRQLLQEELKFMIYLRREEILDESGMPTKRFSAEFPKEGPSRFKIQLAELGDSAVYFCASSL
Eptesicus fuscus V635 trbv ALEH01107449.1 330 PTDAGVTQTPRHKVTQKGQEVTLSCEPISGHTYLYWYRQTSVQGMEFLISFSSKTPLDNTGLPKERFSAKMFNESFSILKIQPTEAGDSAVYLCASSL
Eptesicus fuscus V636 trbv ALEH01107450.1 12039 SVAAGVTQSPRHLIKSRGAEAVLKCHPISGHDTVYWYQQAPGQGLEFLISFYEKEERQKGNIPDRFSGKQFDNYSSELAMSTLQLGDSAVYLCASSL
Eptesicus fuscus V637 trbv ALEH01107450.1 7403 HLNARITQSPRYKVTQTEKKVTIKCHQTDNHDYMYWYRQDLGHGLTLIHYSYGIGSIGKGDVLEGYSVTRSKTENFPLTLESATTSQTSVYFCASSE
Eptesicus fuscus V638 trbv ALEH01107451.1 9429 SVAAGVTQSPRHVIKGQGGKAILKCHPISGHRSVYWYQQAPGQGPKFLIEYFEKEEREKGSIPDRFSGKQFSDYSSELSMSTLQLGDSAVYLCASSL
Eptesicus fuscus V639 trbv ALEH01107451.1 3837 HLNARITQSPTYKVTGREKKVTLRCQQTYNHNNMYWYRQDLGHGLRLIYYSVGAGLTTKGDVADGYSASRSNIENFALTLESMTPSQTSVYFCASSE
Eptesicus fuscus V640 trbv ALEH01107451.1 2081 HTNAGVSQSPRVIVTERGQNVSLRCDPISGHVGLYWYQQRLGQGLEFLLYFQNKKALDTSGMPKERFSAERCGGSYSTLNIQRAEQGDSAVYLCASSL
Eptesicus fuscus V641 trbv ALEH01107452.1 9501 HTKAGVSQSPRHIVRKKGQNVTLRCDPISGHTAIYWYRQTLGQGLEFFIYFQGKDAPDKSGMPKERFSAERRDGSYSTLKIQRAEQGDSAVYLCASSL
Eptesicus fuscus V642 trbv ALEH01107452.1 4012 SVAAGVTQSPRHLIKSRGGEAVLKCQPISGHSSVYWYQQAPGQGPEFLISFYEKEEGQKGNIPDRFSRKQFDNYSSELAMSALQLGDSAMYLCASSL
Eptesicus fuscus V643 trbv ALEH01107455.1 1558 YLDARITQSPRYKVTGAEKKATLICHQTNNHNVMYWYRQDLSHGLRLIYYSVSVGITAKGDVANGYSVLRQNKENFVLTLESATPSQTSVYFCGSSEG
Eptesicus fuscus V644 trbv ALEH01107456.1 7919 LVNAAITQTPKFQIWKTGQKVTLRCAQDMSHTCMCWYRQDLGRGMRLIHYSVGAGVTEKGDVPEGYSVTRSNTEDFLLTLESATPSQTSVYFCASSI
Eptesicus fuscus V645 trbv ALEH01107456.1 2936 HTNAGVSQSPRHLVTKRGQNVTLRCDPISGHQVLYWYRQTLGQGPEFLLYFQGKDALDKSGMPKERFSAERRDGSYSTLNIQPAEQGDSAVYLCASSL
Eptesicus fuscus V646 trbv ALEH01107460.1 2955 SLDTAVFQTPKYLITRVGNKKSLSCEQKLNHNAMYWYKQDSKQLLKIMFSYNNKELILNETVPSRFLPESSDKAHLKLHVSSLEPGDSAMYLCASSQ
Eptesicus fuscus V693 iglv ALEH01129289.1 2433 SWAQSVLTQPSSLSGAPGQRVTISCTGSSTNIGGYHVSWHQQLPGKAPKCIIYTSNIRPSGVPDRFSGSRSGNSASLAITGLQAEDEAVYYCSTWDGSLSG
Eptesicus fuscus V694 iglv ALEH01129290.1 1672 SWAQSVLTQPSSVSGAPGQRVTISCTGSSSNIGSYYVNWYQQLPGKAPKLLIYGDSDRDSGVPYRFSGSMSGNSATLTITGLQAEDEADYYCLSWNDSLEG
Eptesicus fuscus V695 iglv ALEH01129291.1 1612 SWAQSVPTQPPSVSGAPGQRVTISCTGSSSNIGDNYVSWYQQIPGKAPKVLIYGDSVRDSGVPDRFSGSKSGSTATLAIMGLQAEDEADYYCGSYDSSISG
Eptesicus fuscus V696 iglv ALEH01129299.1 739 SWAQPVLTQPSSVSGAPGQRVTISCTGSSSNIGVNHVSWHQQVPGKAPKCIIYASNSRPSGVPDRFSGSRSGNSASLAITGLQAEDEADYYCSAWDDSLSG
Eptesicus fuscus V697 iglv ALEH01129300.1 1062 SWAQSVLTQPSSVSESPGQRVTISCSGSSSNIGGNTVHWYQQVPGKAPKFLIYGNSRPSGVPDRFSGSQSGNSASLTITGLLAEDEADYYCSAWDGSISG
Eptesicus fuscus V698 iglv ALEH01129301.1 882 SWAQSVPTQPPSVSGAPGQRVTISCTGSNSNIGGNYVRWYQQLPGKAPKLIIYDTNSRPSGIPDRFSGSKSGNSASLTITGLLAEDEADYYCGSYDDNLKG
Eptesicus fuscus V713 trdv ALEH01136097.1 39277 VSLDIVLEPDTQTLTVPVGETATFHCRVTGADLKNYQMSWYKKHEDNSLTLVYRPSNNSNDHLRSNIKGKIDVLNSQYILDIQKTTTKDVGTYYCGSD
Eptesicus fuscus V714 trdv ALEH01136097.1 17792 VMSAIVLVSQDQEVTVSLGMSATFRCSLEGETISNYYISWYRQTQGNTMTYIHREGGMYGRGFFGKFRASINASSNEAELEILKASERDEGIYYCASD
Eptesicus fuscus V716 trav ALEH01136106.1 10911 VNGKNGVEQSPQHLSAQEGEVITINCSYSIGMTTLHWMQQNPGGGIVSLFILSLEMKKKGRLSATINTKESRSSLHISAAQPGDSAIYFCAVE
Eptesicus fuscus V717 trav ALEH01136110.1 6676 SSLAQKVTQPQQEMSVQEAETATLACTYDPSSTDYYLFWYKQPPNGEMIFIIRQESFKQQNATDHRFSVNFQKATKNFSLRISDCQLEDAAVYFCALSE
Eptesicus fuscus V718 trav ALEH01136112.1 11062 PGGADWIKSQETEVSATEGRSVKLLCNYGTSRGAVDLYWFRQYPNRAPEFILYRGWGYSGKEDADFAKEKFYSNSTADTIYLDFRKLELADTALYHCALKK
Eptesicus fuscus V719 trav ALEH01136113.1 5692 IMGDAKSTQPGAMESTTEEAVHLPCNHSTISGSEYIYWYRQIPHQGPEYVIHGLKGTETKGTFSLIIATDRKSSTLVLPHVSLRDSAVYYCIVRD
Eptesicus fuscus V720 trav ALEH01136117.1 1781 VRSQEMHQSPQSLIIQEGEEVTIECNSTQSVYSLHWYWQKHSEGPIFLIILRKSGKESLDKITATLDESKQHSFLYITASQPSHSGTYFCAGG
Eptesicus fuscus V721 trav ALEH01136124.1 2407 ESTQQLEQTPRFLRIQEGENCTVSCSSSSVFSTFQWYRQEPGEGPVLLMILNKGGEKKVQKRLTFQFGEERKDSSLLITAAQPGDAGIYICAG
Eptesicus fuscus V722 trav ALEH01136127.1 2115 ETRAQSVTQPDGHITVSEGAHLELRCSYSYGGSFSLFWYVQYPNQGLQFLLKYVTGSTLVTGIKGFQAEFRKNGTSFHLRKLSAHWNDWAVYFCAIS
Eptesicus fuscus V757 ighv ALEH01153369.1 587 VLSQVQLQESGSRMVKPSQTLSLTCAISGDSVSSNSATWNWVRQPPGKGLQWLGRTFFRSKWYREYAPSLQSRLVIDPDTSKIQFSLQLISVTTEDTAMYYCA
Eptesicus fuscus V758 ighv ALEH01153372.1 1594 VQCEVQLVESGGGLVPPGGSLRLSCAASGFTFSSYWMSWVRQAEGKRLEWVSYINPDGSTTSYADTVKGRFTISRGNAKNTLYLQMNNLRAEDTALYYCAR
Eptesicus fuscus V759 ighv ALEH01153381.1 6020 VQCEVQLVESGGGLVPPGGSLRLSCAASGFTFSSNYMSWIRQAPGKGLEWLGEINPGGSNTYYANSVKGRFTISRDNAKNTLFLQMNRLRATDTAVYYCA
Eptesicus fuscus V760 ighv ALEH01153382.1 3042 VQCDVQLVGSGGGVVPLGGSLRLSCAASGFTFSSSWMSWVRQAPGKGLEWLGEIYPDGSNTYYADSVKGRFTISRDNAKSTVYLQMNSLTALDTAMYYCG
Eptesicus fuscus V761 ighv ALEH01153387.1 3246 GLCQFQLVESGGGVVPPGGSLSLSCKASGFTFTDYGMHWVHQAPGKGLQWVAGVSQPTGKDQWYAPAVQGRFTISRDNPTSTVSLKMTKLISEDTAVYYCTR
Eptesicus fuscus V762 ighv ALEH01153390.1 2023 VLSQVLLQGWGTGLVNASQTLSLTCAVYGLSITSGYCWNWIRQSPGKGLEWMGCISYNGNTYYSLSIKSRTSISRDTSKNQFSLQLSSVTTEDMALYYCA
Eptesicus fuscus V763 ighv ALEH01153395.1 6690 VQCEVHLVETGGGLVHPGESLRLSCAASGFTFSSYGMNWIRQASGKGLEWVAVIWNDGSQKYYADSVKGRFTISRDNTKNMLYLQMNSLKAQDTAMYYCAR
Eptesicus fuscus V764 ighv ALEH01153395.1 3091 VLSQEQLRQWGPGWVKPSQTLSLTCADHGLPITTSGYCWNWIRQAPGKGLEWMGCINYDGSTYYNTNLKSRTSISRDTSKNQISLQLSSVTTEDTAVYYCAR
Eptesicus fuscus V765 ighv ALEH01153399.1 1662 VLSQVQLQESGPGLVKPSQTLSLTCAVSGYSITSGSDWSWIRQPQGKGLEWMGLINSNGYTYYSPSLKSRTSISRDTSRNQFSLQLSSVTTEDTAVYYCAG
Eptesicus fuscus V766 ighv ALEH01153410.1 2241 GLCQVQLVESGGGVVLPGGSLSLSCKASGFTFTNYSMNWVRQAPGKGLQWVAEVSKPTGKKQWYAPAVQGRFTISRDNPTNTVSLKMTKLTSEDTAMYYCTR
Eptesicus fuscus V768 trav ALEH01154729.1 488 VSSELNVEQSPQSLHVQEGKSTNFTCRFPTSSFYALHWYRREPAKSPTILLVISVNGDVKKEGRVTATLNTTEGYSYLYIKGSQPEDSATYLCAF
Eptesicus fuscus V769 trav ALEH01154737.1 1147 VRGVQVEQSPPALILQEGASFTMWCNFSTSVNNVQWFRQNPGGRLINLFYIPSGTKWNGNLKATTDPKERRSSLHVSSSQTTNSAIYFCAVDPQCFA
Eptesicus fuscus V770 trav ALEH01154740.1 1491 LSGEDQVEQSPQTLRVQEGDSVSFTCSYTVSNFIGLLWYRQDPGKGPKHLISLYSVGKEEQKGRLSASLSQKESSLNITTPKAEDSATYLCAVE
Eptesicus fuscus V771 trav ALEH01154746.1 3972 GTSGDSVNQTEGPVTLIEGAFLTLKCTYQTTYSSFLFWYVQYQNKEPVLLLKSSSDNQEVSNGDFRARLVKTDSTFHLKKSSVQVSDSAVYYCALG
Eptesicus fuscus V772 trav ALEH01154746.1 1745 SSMTQNVIQAQSAISVVEKEAVTLNCVYEVSSYNYYLFWYKQPSSGKITFLIHQESYNEQNTTEGRYSLNFQKSASSINLTITDSQLGDSAVYFCALRD
Eptesicus fuscus V773 trav ALEH01154752.1 1484 GTGAQSAIQPDGHVTVSEGAPLELRCKYSSSSSPYLYWYVQHPNQGLQFLLRYISGDPVVKGMKDFEAVFRKNETSFNLKKHSAHWNDSAVYFCAVS
Eptesicus fuscus V774 trav ALEH01154755.1 2199 GIRAQTVTQPEDHISVLEGASVQVKCNYVYSGSPELLWYVQYPRQSPRLLLKQFSRESVKGFTAVHDKSESSFHLKKSLAQEEDSAVYYCAVS
Eptesicus fuscus V775 trav ALEH01154756.1 10291 GTGAQSANQPDGHVTVSEGAPLELRCKYSSSTSPYLYWYMQYPNQGLQFLLRYYSGDPVVKGTKGFEAVFRKNETSFNLKKHSAHWNDSAVYFCAVS
Eptesicus fuscus V776 ighv ALEH01155718.1 4460 VQCDVQLVESGGGVVQPGGSLRLSCAASGFTFSSYDMHWVRQAPGKGLEWVSYISSGSSTIYYADSVKGRFTISRDNAKNTLYLQMSSLRAEDTAVYYCA
Eptesicus fuscus V777 ighv ALEH01155721.1 3641 VLSEVQLQESGPGLVKPSQTLSLTCAVSGSSITTSYTSWNWIRQPPGKGLEWMGYIGYDGNTYYSPSLKSRTSISRDTSKNQFSLQLSSVTTEDTAVYYCAR
Eptesicus fuscus V779 ighv ALEH01156656.1 2435 VLTQVQLQESGSTVVQPSQTLSLTCAISGDSVSSNSAIWNWVRQPPGKGLQWLGRTYFRSKWYREYVPSLQSRFVIDPDTSKNQFSLQLSSVTSEDTAVYYCAR
Eptesicus fuscus V780 ighv ALEH01156658.1 624 VLSQVQLQESGPGLLTPSQTLSLTCTVSGFSITSSSCWSWVRQPPGKGLEWMGYICSSGNSNYSPSLKSRTSISRDTSKNQFSLQLISVTTEDTAIYFCAG
Eptesicus fuscus V781 ighv ALEH01156659.1 11254 VQCEVQLVRSGGDMVPPGESLRLSCAASGFTFSSSWMSWVRQAPGKGLEWVSDIMGDSSTTYYAASVKGRFTITRDNDKNTLYLHMRSLRAKDTTVYYCAR
Eptesicus fuscus V782 iglv ALEH01156661.1 563 SVASYELTQPPSVSVNLGQTARLTCGGNNIGGRYTYWYQQKPGQAPVLVIYDDSKRPSGIPDRFSGSNSGNTATLTISGALAQDEADYYCQVWDSDD
Eptesicus fuscus V783 iglv ALEH01156665.1 6130 LCALPVLTQPPSASAAPGASVKLTCTLSREHSKYFIWWYQQRAEQAPRYLMYINRDGSTNKGDGIPDRFSGSSSGADRYLTINNIQSEDEAEYYCGE
Eptesicus fuscus V784 iglv ALEH01156665.1 2325 PVASSEVTQPPAVSVALGQTARITCQGELIKKYYPSWYQQKPGQVPVLLIHADKNRTSTIPERFSSSHSGDTDTLTISGAQAQDEADYYCLGTEDNAH
Eptesicus fuscus V785 iglv ALEH01156667.1 878 PVASSEVSQPPVVSVTPGQMARITCQGELVEKAYASWYQQKPGQAPMLVVDSDESRTSTIPERFSGSDSGDTDTLTISGAQAQDEADYYCSVWDDSGN
Eptesicus fuscus V786 iglv ALEH01157095.1 2636 SLSQPVLTQPPSLSASLGATARVTCTLSSDISVGSYWINWYQQKPGSRPRYLLAYYSDSNKHQGSGVPSRFSGSKDASANAGLLLISGLQPEDEADYYCSTWD
Eptesicus fuscus V787 ighv ALEH01157101.1 1135 VQCKVQLVESGGGVVQPGGSLRLSCAASGFTFSSYAMDWVRQAPGKGLEWVSAISTGGGSTYYAASVKGRFTISRDNAKNTLYLQMSSLKAEDTALYYCAS
Eptesicus fuscus V788 ighv ALEH01157102.1 3227 VHSQVQLVQSGAEVRQPGASVKVSCKASGYTFTDYYMHWVRQAPGQGLEWMGRVYPGDGDTRYAQKFQGRVSITADKSTSTAYMELSSLRAEDTAVYYCAR
Eptesicus fuscus V789 ighv ALEH01157104.1 2650 VLSEVQLQESGPGLVKPTETLSLTCTVSGFSITTSGYCWGWIRQPPGKGLEWMGNIWYNGNTYYSPSLKSRTSISRDTSKNQFSLQLSSVTTKDTAVYYCAR
Eptesicus fuscus V791 iglv ALEH01157760.1 963 SLSQPVLTQPPSLSASLGATARVTCTLSSGSVVAGYHIVWYQQNLGSPPRYLLRFKGDSDKHQGSGVPSRFSGSKDTSANAGLLLISGLQPEDEADYYCAT
Eptesicus fuscus V793 ighv ALEH01158637.1 4289 VQCEVQLVESGGGLVQPGGSLRISCEASGFTFSSYGMNWVHQVPGKGLEWVSGVSSSGTTYYADSVKGRFTVSRDNAKNMLYLQMNSLRTEDTAMYYCAR
Eptesicus fuscus V794 ighv ALEH01158988.1 1624 VHSQVQLVQSGAEVRQPGASVKVSCKASGFTFTDYYMYWVRQAPGQGLEWVGRVDPEDGETKYSQKFQGRVSITADKSTSIAYMELSSLRAEDTAVYYCA
Eptesicus fuscus V795 ighv ALEH01159046.1 582 FLSQKQLQESGPGMVKPSQTLSLTCTVSGYSITSNYSWGWIREPVRKGLEFMRCIWYDSDTKYSPSIKSRTSISRDKSKNQFSLQLSSLTIKDMVLYYCVR
Eptesicus fuscus V796 ighv ALEH01159048.1 3097 VQCEVQLVESGGGLVQPGGSLRISCEASGFTFSSYGMNWVHQVPGKGLEWVSGVSSSGTTYYADSVKGRFTVSRDNAKNMLYLQMNSLRTEDTAMYYCAR
Eptesicus fuscus V797 iglv ALEH01159098.1 1270 VDSQTVTQEPSMSVSAGGTVTLTCGLSSGAVASGNYPGWFQQTPGNPPRLLIYNINNRPSGVPARFSGSISGNKAALTISGAQPEDEADYHCL
Eptesicus fuscus V798 ighv ALEH01160126.1 1443 VLSQVQLQESGPGLVTPSQTLSLTCAVSGFSITTSGSCWTWIRQPPGKGLEWMGRICYDGSTNYSPSFKSRISISRDMSKNQFSLQLSSVTTEDTALYYCAG
Eptesicus fuscus V800 ighv ALEH01161079.1 1384 VLSEVQLQESGPGLVKPTETLSLTCTVSGYSITSGYCWDWIRQPPGKGLEWMGRICSSGSTYYSPSLKSRTSISRDTSKNQFSLKLSSVTTEDMAVYYCAR
Eptesicus fuscus V801 iglv ALEH01161629.1 1963 PVASSEPTQPPAVAVAPGQTARITCQGELLRKYYPSWYQQKPGQAPVLVIYGDKNRTSTIPERFSSSHSGDRNTLTISGAQAQDEAEYYCLGKEDDAH
Eptesicus fuscus V802 iglv ALEH01162032.1 1288 PVASSEPTQPPAVAVAPGQTARITCQGELLRKYYPSWYQQKPGQAPVLVIYGDKNRTSTIPERFSSSHSGDRNTLTISGAQAQDEAEYYCLGKEDDAH
Eptesicus fuscus V803 ighv ALEH01163324.1 387 VHSQVQLVQSGAEVRKPGASVKVSCKTSGYTFASYNLHWVRQAPGQGLEWVWLVYPGNGETSYEQKFQGRVSMTGDKSTSTAYVELSSLRAEDTAVYYCT
Eptesicus fuscus V804 ighv ALEH01164064.1 1418 VQCEVQLVESGGGLVPPGGSLKLSCAASGFILSSYHMDWVRQAPEKGLEWVSRITNKGGSTYYADSVKGRFTVSRDNAKNTLYLQMNSLRAEDTAVYYCTA