WGS Statistics
Organism WGS Record. Vs Total IGHV IGLV IGKV TRAV TRBV TRGV TRDV
Crotalus mitchellii pyrrhus JPMF00000000.1 (JPMF01) 82 33 24 0 23 2 0 0
Vgene Table
Organism Vgene Locus contig Contig Pos. AA sequence
Crotalus mitchellii pyrrhus Vs43 iglv JPMF01093320.1 2990 VTSQPTLTQPASQSGSPRETVKLSCAISSNPNNIYWLQQKSGGVPRFVHCDGCSRGPGIPDRFTGTRSGNNGYLTITNLQPEDEADYYCYMWYSSGKV
Crotalus mitchellii pyrrhus Vs42 iglv JPMF01093320.1 1222 AMCQYTLTQETVLSASLGEPAKLSCNISSGYHFGDFHWYQQKGGERPRFLLYYNTTSRETKFGPEASGRFSASTNTPKKSAFLNINNVQGKDEGGYYCLAG
Crotalus mitchellii pyrrhus Vs45 iglv JPMF01093381.1 2766 VTSQPTLTQPVSQSGSLGGTMKLPCAISSNPNYIYWLQQKSGEAPRFVHCDGCSRGEGIPDRFTGTRSGNNGYLTITNLQPEDEADYYCYMWYSSGSV
Crotalus mitchellii pyrrhus Vs44 iglv JPMF01093381.1 1084 VTSQPTLTQPVSQSGSLGGTVKISCGISSNPNTISWIQQRSGEGPRFVHCDGCSRGEGIPDRFTGTRSGNNGYLTITNLQPEDEANYYCNMWYSSGSV
Crotalus mitchellii pyrrhus Vs170 trav JPMF01042848.1 1431 VQCQDRVDQKPVEIIKEGDDAVIICQFNSSTVYGMHWYRQYPGEAFGFLLMVTSVKWEKKGYFRASFDRKKKESHFSIPKVQMEDAAVYFCGTQ
Crotalus mitchellii pyrrhus Vs46 iglv JPMF01093383.1 963 VNSKPAWIQPTYMSVSPGQTAKIPCTVSGTVNTISWYQQRSGQVPRYVHYSGGSRGDGIPDRFTASVSGSIGYLTITGVQAEDEADYYCAMWHSSASS
Crotalus mitchellii pyrrhus Vs125 ighv JPMF01343134.1 612 VLADVSLTESGGGLKRPGVSLRLTCTCSGFNIDSYWIHWIRQADEKGLEWISQINKGTVYYANSFKGRFTISKDSSRNLVYLDMNELKAEDIAKYYCAR
Crotalus mitchellii pyrrhus Vs270 trav JPMF01264843.1 726 VLHLVSSQVFQSEQLIFMEKEEIVLKCTHNITVINNMYWYKQTGKVLAFLGANYNGKLDLPGGFTMDVDQKSRSSKLTRDVVRLKDAGVYFCAVR
Crotalus mitchellii pyrrhus Vs273 trav JPMF01281868.1 994 CSLDAQVFQTPENLEVQEGSLFILKCNYTSQYQPYFWYHQLPGAHPSLILSIYSQESQNNKGFVTKYLDNGKESQLHRPTAQLQDSGNYFCAVQ
Crotalus mitchellii pyrrhus Vs218 ighv JPMF01136525.1 324 ISSQITLTESGDGLKKPGDTLRLTCTVSGFAITSYGVHWIRQPPGKALEWNGAIWNDGSTDYNSALQNRITITRDTSKNQVFLQLTGLKPEDTSIYYCAR
Crotalus mitchellii pyrrhus Vs136 ighv JPMF01414897.1 229 VQSQVQLVESGGDVRRPGGSLRLSCQASGFTFSTSWMQWVRQAPGQELEFVATILTGSSPSIYYPDKFKGRFTISRDDSRSQLYLQMNNLKPEDTAVYYCVR
Crotalus mitchellii pyrrhus Vs237 trav JPMF01168039.1 1067 PSAEDAVEQTTGTLSVSEGNPFSIQCSYEADWSVTNDPFWYIQFPGQPPQFLLSENKGHNQGFQASHILGENKRTGTFNLKKATSQLSDSAFYLCA
Crotalus mitchellii pyrrhus Vs277 iglv JPMF01293740.1 398 IHGESPWTQPPSSSVSLGGSITISCSTTQSSRSIYWYQQKAGSPRFVHCDGCSRGEGIPDRFTATRSGSTGSLAITNAQAEDEADYYCGSWNTAVTQ
Crotalus mitchellii pyrrhus Vs140 trav JPMF01441247.1 74 GSMGQLVNQTSGIVTITEGQSISLRCSYEAAYSGNNYPSWYIQHPGQPLEILLDEIDNKVPGFQATHNKTRKRGTFNMQKQNIQLEDSAVYFCAFSE
Crotalus mitchellii pyrrhus Vs62 ighv JPMF01127655.1 1972 VLSNIQFTESGPAVVRPGDVLNLVCKVTGVLISVPIEWYWVRKPLGKGLEWVSAINVNSGGKWYAASVKNRATISADETRNEFYLQINSVTAADSSLYFCTRL
Crotalus mitchellii pyrrhus Vs63 iglv JPMF01128081.1 1204 TSVQQLQSLKNSESVAVHGTVTMSCSYSGGTISNNNYLRWLQQKPGKVLKLLVATSNSRPTGVPARFTGTTSGNTMSLTIAGTLGEDEATYYCAVWTGSG
Crotalus mitchellii pyrrhus Vs217 trav JPMF01134629.1 1507 KSTGQTVIQTEGRLTITEGQPVFLNCTYDRSVDYQPSPFWYIQYLGQPPKLFKSTFSTPNLDASLPRNFKVIYNKVEKTFNMKKSISQLNDSAIYFCALK
Crotalus mitchellii pyrrhus Vs60 trav JPMF01125388.1 736 VQCQDRVDQEPVEVIKEGDDSTLTCQFTSTNVYGMHWYRQYLEKVPVFLLTVTLVELEKKEHFIASFDKQKKESQLNITKVQMKDAAVYFCGAQ
Crotalus mitchellii pyrrhus Vs67 ighv JPMF01136528.1 516 ISSQITLTESGDGLKKPGDTLPLTCTVSGFAITSYGVSWIRQTPGKTLEWNGAIWAGGSTQYNSALQNRITITRDTSKNQVFLQLTGLKPEDTGTYYCAG
Crotalus mitchellii pyrrhus Vs284 ighv JPMF01340992.1 330 VQSDVQVVESGGDVRRPGQSLSLLCQTSGFNFNVFWMNWLRQYPGKDLEWVGRITTGSPPTAYYRDKVKGRFTMSRDDSNTRVYLQMNNLKPEDSAVYYCAR
Crotalus mitchellii pyrrhus Vs286 iglv JPMF01348236.1 933 SFSQVLTQPASVSGSPTETIDISCTKSSGTIGSGYSSWYQQKPGSAPKLLIYSDSSRASGIAARFSGSVENSRTSAVLTISNLEAEDDGDYYCLEYLGGGQ
Crotalus mitchellii pyrrhus Vs287 ighv JPMF01350597.1 534 VSATVTLTQPPEAFALPGRSITLTCKVSGYNINDHHLYWVRQSNGKELVFITAFRTGHTTYTANEFKGRVTPSTQGSTAQLRIDALKVDDTAIYYCTR
Crotalus mitchellii pyrrhus Vs280 ighv JPMF01317551.1 325 VQMEVQLVESGGDVRRPAESLRLSCQASGFTFSSYEMLWVRQAPGKGPEWLAWIDNNGDGSSHTYANSVKGRFTISRRDASSMLYLQMNSLKPEDTAVYYCAGD
Crotalus mitchellii pyrrhus Vs163 iglv JPMF01034797.1 1096 TDGQSFWTQPPSSSVSLGGSVSLSCTTQSTNSIGWHQQKEGKGPRFVHCDGCSNRGQGIPNRFTATRSGSSGSLAITNVEAEDEGIYFCGSWNSAFTQ
Crotalus mitchellii pyrrhus Vs97 ighv JPMF01226861.1 1293 GLSQVALTQSDPVLKKPGEAHKLTCAATGFDVNSYDMYWIRQKPDQGLEWIVYYYSSSSNAYSPTIQGRFTASKDSSNLYLQMNNLKAEDTAVYYCAR
Crotalus mitchellii pyrrhus Vs292 ighv JPMF01391565.1 496 VLADASVTESGGGDKRPGNALRLTCTCSGFSIDSYWMEWIRQEDGKGLEWISRIKTGNTYYANSFKGRFTISKDSSRDLVYLDMNGLKAEDTAKYYCAR
Crotalus mitchellii pyrrhus Vs214 trav JPMF01124334.1 1422 ISSQARITQEHQFLSVKEGDSIQLNCSYQETEDSLQWYKQYPGGQPEFMMVLYSSNTEAKDNFEMTLDTENKTTSLYLKNTQLKDSAVYFCAW
Crotalus mitchellii pyrrhus Vs288 trbv JPMF01369533.1 1766 FIGLCHGVTVTQKERFKIIQAGTQMDIIACEHDDSSYLVIHWYRQELNSGQTELKLIGYSIQGNTPQMENGNFNIDRPDVTHASLRIPPDEAAKPAVYFCAVSQ
Crotalus mitchellii pyrrhus Vs255 ighv JPMF01216236.1 1192 VKTQVQLVESGGDLRRPGESIHISCHGSGFTMRNTWMNWERQAPGKGLEWLGRMGTSTIQYSDKVKGRFTISRDDSRSQLYLQMNNLKPDDTAVYYCA
Crotalus mitchellii pyrrhus Vs120 trav JPMF01325932.1 3127 TLFCQAEKPDQEPLLEALNGRKADLSCSHPNIQSSEYIYWYRQFPSQPPHFIARGYKEPSKSNVIERISLVVDHSRKNSTLSFTKVTFEDQALYLCAIG
Crotalus mitchellii pyrrhus Vs39 ighv JPMF01082145.1 5984 CHSEIQMIQSGGGIKAPGGSLTIVCKTSGFGFTNYYMSWVRKQPEKGLEWLCRMPSLGTNPWYNPAIVGRFIQTRDNAKASTTLQLNDLKLEDSAVYYCTR
Crotalus mitchellii pyrrhus Vs224 ighv JPMF01148509.1 1159 GFSQVVLTQSDPVLKKPREAHKLTCAATGFNVNSYSMYWIRQKPGQGLEWIVYYYSSSDNAYSPTIQGRFTASKDSSNLYLQMNNLKAEDTAVYYCAR
Crotalus mitchellii pyrrhus Vs221 ighv JPMF01140155.1 382 GLINQPFFLGVPGGDVRRPGETLRLSCQGSGFTFSNFWMSWVRQAPGKALEWIATIKYDAGEIYYSDKVKGRFTISRDNAKSQLYLQMNSLKAEDTAVYYCAR
Crotalus mitchellii pyrrhus Vs104 iglv JPMF01243644.1 314 ASAQFTMTQPPSVSASRGQTVQFTCTREGGSISSYYVSWYQQKLGTKPQLVIYGDTSRPSGIPERFSGSVDSSSNSATMSISNVQSEDEADYYCLSYDSNYQ
Crotalus mitchellii pyrrhus Vs244 ighv JPMF01188034.1 1589 ILADVSVTESGGRLKRHGDSLRFTCTCSGFNIDSYWIHWVRQADEKGLEWISRINKGTTHYANSFKGRFTISKDSSRNLVYLDMNGLKAEDIAKYYCAR
Crotalus mitchellii pyrrhus Vs102 ighv JPMF01239962.1 486 RNFYKNGIQFKYQFKGCFSKTKECTGEFTFSSYYMEWVRQYPGKGLEWVARISTGSSSTYYSHNVKEHFLISKDDSNSLLYLQMNNLKPEDTPRYYCSR
Crotalus mitchellii pyrrhus Vs117 trav JPMF01317338.1 82 FSLDAQVFQTPENLEVQEGRLFILKCNYTRQYQPYFWYHQLPGAHPSLILSIYSQASQNNKGFVTKYLDNGKESQLHRPTAQLQDSGNYFCAVQ
Crotalus mitchellii pyrrhus Vs93 trav JPMF01216572.1 903 ILLCHAEKPEQQPLLEALNGRKTDISCSHPNIQVNEYIFWYRQFPNQPPHFIATGYKATSKSNEVEHISLVVADDRKTSTLSFTKVTLEDQALYLCGVT
Crotalus mitchellii pyrrhus Vs177 ighv JPMF01053409.1 1768 VHSTILLVESGPGTASPGGSFRLTCKVTGDSIKNAYWEWIRQAPGKGLEWVGQIDWDGSKWRTYYASSLQSRTTLSADDSLNEYYLTMRSLTAADSATYYCARR
Crotalus mitchellii pyrrhus Vs219 ighv JPMF01136526.1 380 ISSQITLTESGDGLKKPGDTLPLTCTVSGFAITSYGVSWIREPPGNALEWNGVIWYDGSTSYNSALQNRITITRDTSKNQVFLQLTGLKPEDTGTYYCA
Crotalus mitchellii pyrrhus Vs143 iglv JPMF01000936.1 1127 LSLQQLQSLKDSEFVAPGGTVTLSCRYDGGNLGDSHEPSWSQQVAGQQPRGLIYHTSSRLSGVPERFSGSRSGNVMSLTITRALVEDEATYYCSIWTSSQ
Crotalus mitchellii pyrrhus Vs99 ighv JPMF01235743.1 1282 VQSEVQLVESGGEGRRPGESLHLSCQGSGFTFGNYWMVWVRQVPGKGLEWVAHTWSSYFYYSDKVNGHFTISKDEAKIQLYLQMNSLKPQNTAIYYCVRG
Crotalus mitchellii pyrrhus Vs268 iglv JPMF01250435.1 550 IDGQSTWTQPPSSSVSLGGTISLFCTTTQSSHSISWHQQKEGKGPHFVHCSGCSSRGEGIPDRFTATRSGSTGSLAITNVQAEDEADYYCLSWNS
Crotalus mitchellii pyrrhus Vs261 iglv JPMF01229372.1 511 LSLLQLQSLKDAESVPLGGTVTLSCRYSTGIINDNNYPWWAQQHPGKPPRLLVYQTSVKPSDVPARFSGSKSGNVMSLTITGASAEDEANYYCCLNPGGS
Crotalus mitchellii pyrrhus Vs161 ighv JPMF01032988.1 848 VQSEVQLVESGGDVRRPGGSLRLSCQASGFTFSSYEMGWVRQAPGKGLEWVAYIWSSNIYYSDKVKGRFTISRDDAKSQLYLQMNSLKPEDTAIYYCAR
Crotalus mitchellii pyrrhus Vs101 ighv JPMF01239961.1 66 RNFYKNGIQFKYQFKGCFSKTKECTGEFTFSNYYMEWVRQYPGKGLEWVARISTGSSSTYYSHNVMGRFIISRDDSNSLLYLQMNNLKPEDTAVYYCAR
Crotalus mitchellii pyrrhus Vs50 iglv JPMF01103862.1 897 SFAQYVLTQPSSMSVSLGQNERITCSGNGIEEKSVHWYQQKPGNPPVLIIYNDSIRPTGISDRFSGTNSGNTATLSISRAQAQDEAVYYCQVWDSDHDQ
Crotalus mitchellii pyrrhus Vs51 iglv JPMF01103863.1 879 SFAQYVLTQPSSMSVSLGQNERIACSGNGIGRKSVHWYQQKPGNPPVLIIYGDSSRPTGISDRFSGANSGNMATLSISRAQAQDEAIYYCQVYDSSQ
Crotalus mitchellii pyrrhus Vs121 ighv JPMF01325987.1 1208 VFPNVQLSQPLFKTQRSGRSVKLDCTVSGVEVGGWYWGWNRKGPGKRLEWLGGIKSTNDGGEAYYNSRFNNRIVITRDTSKNEFYLELRSPAAADSGVYFCA
Crotalus mitchellii pyrrhus Vs122 iglv JPMF01327482.1 54 CTNSATLPVSSPWRQSCDLLHKEHCKHQQIPHISWYQQKPNSLPKLLIYQHNKRPPGIPERFSGFTGGSSATLTINNVQAEHLADYYCSSSDSNWL
Crotalus mitchellii pyrrhus Vs96 ighv JPMF01224020.1 2856 GLSQIVLTQSDPVLKKPGESHKLTCAVTGFDVNSYYMGWIRQKPGQGLEWLVYYYTSSINYYSPTIQGRFTASKDSSNFYLQMNNLKAEDSAVYYCAR
Crotalus mitchellii pyrrhus Vs168 trav JPMF01041592.1 1415 SPGRAQTINQPGSATALERKPYHLSCNLSSVTTEMIQWYQQFSGQIPQYLGGAYPNNEDEVANPKGKLYFSQDKTSSMLVIDEVTLADAAVYFCALR
Crotalus mitchellii pyrrhus Vs228 ighv JPMF01153588.1 697 GLSQIVLTQSDPVLKKPGEAHKLTCAVTGFNVNSYWMGWIRQKPGQGLEWLVWYYDPRNTIYYSPAVQGRFTPSKDSSNFYLQMNNLKTEDTAVYYCAR
Crotalus mitchellii pyrrhus Vs59 iglv JPMF01119282.1 657 SPLVSQPQSTSVPLGQNIQITCTGNNMHANHQQWLQQPPGKTPKLIIYSGATRPAGISERYSGSVTGNTAVLSIAKAQAEDEAVYFCLLWWD
Crotalus mitchellii pyrrhus Vs78 ighv JPMF01163454.1 1343 RSYSVRPSDENTWRNCIIDVCGHCFDINRYFMDWIRQEPGKGLEWLVSYHTPAHNFYSPDIKGRFAASKSGSNFYLKMDHLKENDTATYYCTR
Crotalus mitchellii pyrrhus Vs79 ighv JPMF01166010.1 290 ALSQITLTQSSPVIKNQGESLQLKCSITGFDIYNHYMQWSMKQPGNPLKWLVHYRIPKYRAYSPTIQGRFTASKDSSNFYLQMNDLKVEDTAVYYCTSTI
Crotalus mitchellii pyrrhus Vs30 iglv JPMF01048567.1 1354 DAAISFLQPVSMSASLGSAIQISCTPSNGTMATYTISWFQHQQPSPPKYLLYYKDGSNQRRKTGVSERFAASKDASLNACYLTISEVQAADEGTYYCLASTGSE
Crotalus mitchellii pyrrhus Vs31 ighv JPMF01051389.1 1402 VQSEIQLVESGGDVRRPGGSLRLSCQASGFTFSSYYMDWVRQAPGKGLEWVAEIGTSSSPIRYSDKVKGRFTISRDDSRSQLYLQMDSLKLEDTAVYYCAR
Crotalus mitchellii pyrrhus Vs233 trav JPMF01163865.1 2496 RSRGQSVDQTSGIVAATEGQPVVLYCSYEAQTIGSYYPYWYIQYPGQPLKFLLGSYENNAPGFQAAHHKDKKNGTFNLQKDSSQLKDSAAYFCAFS
Crotalus mitchellii pyrrhus Vs15 iglv JPMF01025022.1 177 SFSQFVLNQPASVSGSLRETVQISCKKSSGTIGSGYSSWYQQKSGGPPKLLIYADSSRASGIPERFSGSVENSRTSAVLSISNLQAEDEGNYFCGSYTGSDS
Crotalus mitchellii pyrrhus Vs229 trav JPMF01155613.1 10502 RSTGQSVDQTSGIVTVTGGQLVSLNCSYEKEFPVTNDLFWYIQHPGQPLKFFLASYLKNPQGFQATHVSHENKKGTFNLQIRACQLKDSAVYFCASSE
Crotalus mitchellii pyrrhus Vs75 trbv JPMF01156710.1 2387 CIRAEQVLLTQEPAWISGELGDQIQMNCQQTNTDHNWMYWYRQTAAKQQLELIGYIVKGAPQATYEDGFEKQRFEIQQKHSKHCSLQINKMSSEDAAVYFCASS
Crotalus mitchellii pyrrhus Vs199 iglv JPMF01093319.1 2055 VTSQPTLTQPASQSGSLAGTVKISCGISSNPNYIGWIQQRSGEAPRFVHCDACSRGPGIPDRFTGTRSGNNGYLTITNLQPEDEASYYCLMWYSSGSV
Crotalus mitchellii pyrrhus Vs205 ighv JPMF01106154.1 555 PVGGVWRGCEKTWTGGSLHLSCQASGFTFSSYQMVWVRQAPGKVLEWLAWIDNPADGNTQYYANSVKGRFTISRHDASSMLYLQMSSLKPEDTAVYFCATD
Crotalus mitchellii pyrrhus Vs138 ighv JPMF01430303.1 267 VELQKILTQPTSEIKLPGETLTLTCKGISSFLQYWIQWTYKIGDEGIKWIGESNLDGSRSSVRQSLRDRFAISRDNSRDIGSLEIRQLTVGDSGLYYCS
Crotalus mitchellii pyrrhus Vs274 trav JPMF01283759.1 881 GSTGQSVDQTSGILTVTEEQPVSLNCSYEGQFSINYPFWYIQHPGQPLEILLTKFDNKNQDFQAIHNENKNKGTFNMRKPAIQLQDSAVYFCAFKE
Crotalus mitchellii pyrrhus Vs111 ighv JPMF01280008.1 674 TLSQITLTQSSLIIKNQGESIQLKCSITGFDINHHYMNWVMQRPGKPLEWLVYYRILKYSGYSPRIQGRFTASKDSSNFYLQMNDLKVEDTAVYYCTTHIDP
Crotalus mitchellii pyrrhus Vs87 iglv JPMF01202811.1 243 INGQSTWTQPPSSSVSLGGTITISCTTTQSSYCIGWYQQKPGEAPRYVQCSGYSRGEGIPDRFTATKSGTTGSLAITNVQAEDDGDYYCGSWNSAATQ
Crotalus mitchellii pyrrhus Vs68 ighv JPMF01137948.1 1011 SLSDVQLVSSGPETVKPGQNLNLLCKVTGVSITSSRYAWNWVRQPPGKGLEWIARIYPYDGRKWFSSSLQSRTTITSDNSKNEFSLQLNSLSAADSAIYYCARE
Crotalus mitchellii pyrrhus Vs114 ighv JPMF01309992.1 181 ITITQSAAQVKRPGERMRFTCTVSGFSLGSSGISWIRQVSGKELEWIGDIWHNGGTAYSTIFRSQASITKDNSRSQVILQLNALKAEDTATYYCI
Crotalus mitchellii pyrrhus Vs115 iglv JPMF01310220.1 473 LSVQQLKNLKDPESVAPGETVVLSCSYSVGTISDNNYPLWIQKKSEEVPQLLIYTTSTRASGTPARFSASKSANTMSLIITESQVEDDATYYCVVWSGSG
Crotalus mitchellii pyrrhus Vs116 trav JPMF01311940.1 1280 WISISQVTQTPVYQDLKEGDRVTITCKNNAAYSYFHWYRQVPRMPLSYLLSITSSKNITEKGYTAEYLDNGQRSCLHLPSSLLQDSGTYFCAVN
Crotalus mitchellii pyrrhus Vs250 iglv JPMF01203648.1 543 PSLQQLQTLKDPEFVAVGQTVTLSCRYDGGNLGDSNHPWWAQQISENKPRMLIYATSSRPSGVPERFSGSRSGNVMSLTITRALVEDEATYYCCIWTSSQ
Crotalus mitchellii pyrrhus Vs293 trav JPMF01417481.1 1175 CRLEAQVFQTPENLEVQEGNPFTLKCNYSSQYRPYFWYHQLPGAQPSLILSVDSVGSTSKKHFVAEYLENGKESHLRSSRSQLQDSGNYLCAVE
Crotalus mitchellii pyrrhus Vs119 trav JPMF01325932.1 691 TSQSDLVSQPQNNMEVLEGEAATLPCNFTTLSSSPYLYWYRQYGNQSPERILTAHKYGNNPFQEGKFSTTLVLENQNSVPLNIRNVTLLDGAVYFCALN
Crotalus mitchellii pyrrhus Vs215 trav JPMF01124334.1 653 VQCQDRMDQKAVEVIKEGDDSTIACQFNPNNVYGMHWYRQYPGEAPAFLLTVTLVNWEKEGHFSASLDKQKKESQFNITKVQLKDAAVYFCVAQ
Crotalus mitchellii pyrrhus Vs290 trav JPMF01382796.1 1022 GSTGQLVNQTSGIVTITQGQSISLRCSYEASYSGNNYPSWYIQLPGQPLEILLDEIDNKAPGFQATHNKSRNKGTFNMQKQNIQLEDSAIYFCAFSE
Crotalus mitchellii pyrrhus Vs294 trav JPMF01434659.1 777 VSGQVTQEYQFLSVKEGDSIRLKCSYSETASSLQWYKQCPGGPPKFLMALYSSKTEAKDNLEMTLNTKNKTTSLYLKNTQFNDSAVYFCAWNHSARK
Crotalus mitchellii pyrrhus Vs129 trav JPMF01358339.1 1046 RSTGQSVDQTSGIVTVMEGQFVSLSCSYEAQYSGMHYPFWYIQHPGQPLKILLTRFNKNAQGFQAGHYENDKKGTFNMQKQAIQLEDSAVYFCAFKAVFLNE
Crotalus mitchellii pyrrhus Vs234 trav JPMF01163865.1 322 QSTGQTVNQTSGVVTVTAGQSLSLYCSYEAQFTGEFETYWYIQHPGQPPKYLLDLYFKNAQGFQATHIPHENKKKGTFSMRKPAIQLKDSAVYFCAFR
Crotalus mitchellii pyrrhus Vs65 ighv JPMF01128360.1 2445 AFSEVQLVSTGAGVVRPGDNLWLVCKVTGFSLQTQNYVWHWFRQPFGKGVEWVTGIHAYNGDKWYSHSMKNRVSISADNSKNEFYLQLNTVSVADSAVYFCSRE
Crotalus mitchellii pyrrhus Vs263 iglv JPMF01233563.1 829 TDGQSPWTQPPSSSVSLGGSITISCRTQSTYCIAWYQQKPGEAPRYVQCSGYSRGEGIPDRFTATRSGTTGSLAITNVEAEDEADYFCGSWNSGGTQ