WGS Statistics
Organism WGS Record. Vs Total IGHV IGLV IGKV TRAV TRBV TRGV TRDV
Oryzias latipes BAAF00000000.4 (BAAF04) 216 54 0 61 36 22 4 39
Oryzias latipes BAAE00000000.1 (BAAE01) 98 21 0 31 30 8 3 5
Vgene Table
Organism Vgene Locus contig Contig Pos. AA sequence
Oryzias latipes Vs211 igkv BAAF04111178.1 6321 SRGQVTVTQPGAVSSAVGGNVSISCSASQSVYGGDEMHWYQQKNGESPKLLIYEANSRVAGTPSRFSGSGSNSDFTLTISGIQAEDAAVYYCQSYHSGYV
Oryzias latipes Vs210 igkv BAAF04109812.1 696 SRGQVTVTQPGPVSSAVGGSVSISCRTSQNVYSNWLAWYQQKDGESPKLLIYYISTQVSGTPTRFTGSGSNSDFTLTISGIQAEDAAVYYCQS
Oryzias latipes Vs217 trav BAAF04115319.1 2715 DSLEDGITASRAEVFSSEELTVTLSCNYSVKANNLQWYRQDPGSAPRFLLLITDTKEPSVVEAKPPNPRLTAVLNQERNQVHLQISSAAVTDSAVYYCALE
Oryzias latipes Vs215 trdv BAAF04112379.1 5944 LTAGDSISPDQDQLTGTEGKSVSIKCNYQTDYSTPMLYWYKHDSDLQAPRFILRKGAKSSSHIELIPDKRYESRTTDTSTELTIRELTLADTALYYCAI
Oryzias latipes Vs46 igkv BAAF04046433.1 2584 SRGQVTVTQPGAVSSAVGGSVSISCRTNNDVQYWSSYHLLSWYQQKDGETPKLLIYYASTRESGTPTRFTGSGSNSDFTLSISGIQAEDAAVYYCMGQ
Oryzias latipes Vs49 igkv BAAF04046439.1 6243 SSEKLLTQTPGAQSVVQGQTVSIRCKASSSVGTCLNWYLQKNGESPKLLIYSATNRQSGVSSHFSGSGSGTDFTLTLSGIEPEHAGVYYCQQCNSLP
Oryzias latipes Vs48 igkv BAAF04046434.1 6462 SRGQVTVTQPGPVSSAVGGSVSISCTTSQNIHSNYLAWFQQKDGQSPKLLIYYISSRASGTATRFTGSGSSSGQDFTLTISGIQAEDAAVYYCQS
Oryzias latipes Vs218 trdv BAAF04115323.1 5235 LTAGDSISSYQDHLTGTEGRFIIMKCNYQTDRSYPYLYWYKHDSDLQAPQFILWKGAKDSTGELIPDKRYISRTTDTSTELIIRELTLADTALYYCVL
Oryzias latipes Vs357 trav BAAF04095850.1 2520 CKGEDKVIQPGGEVIAAEGDSLTLNCTFETTFTPHLFWYRREKNGNINYILRRHSYGKDDNAPEFQKDRFDAELKDKSVPLKIQKLHVSDSAVYYCALQ
Oryzias latipes Vs158 ighv BAAF04098501.1 2097 TESQTLTESESAVKRPGESEKLTCTYSGFSGVPYIAWIRQAAGKQLEWIAYINPGSSGIYYSESVKNRFTISRDNSRKQVYLQMNSLRAEDSAVYYCAR
Oryzias latipes Vs159 ighv BAAF04098502.1 968 VKCEQLTQPASVSLQPGQRLTITCQVSYSLGYYTAWIRQPAGKGLEWIGMRYTGGSHYKDSLKNKFSIDLDSSNNRVTLNGQNMQPEDSAVYFCARR
Oryzias latipes Vs1 ighv BAAF04001538.1 230 VDGQTLTESESAVKRHGESHRLTCSASGFSFSGYHMGWIRQAPGKGLEWIAWIHTGSSSMYYSESVKNRFTISRDDSRQQLYLQMNSLRAEDSAVYYCAR
Oryzias latipes Vs47 igkv BAAF04046434.1 2461 SRGQVTVTQPGPVSSAVGGSVSISCTTSQNIHSNYLAWYQQKDGETPKLLIYYISSRASGTATRFTGSGSNSGTDFTLTISGIQAEDAAVYYCQS
Oryzias latipes Vs186 trdv BAAF04098699.1 1725 ITAGDSISPDQDQLTGTERKSVTMKCNYQTNYSHPWLYWYKHDSDLQAPQFILWKGAKNSTRELIPDKQYGSRTTDTSTELIIRELTLADTALYYCALET
Oryzias latipes Vs185 trdv BAAF04098697.1 1729 LTAGDSISSDQDQLTGTEVKSVTMKCNYQTDDSYPRLYWYKHDSDLQAPQFILWKGAKSHTGEHIPDKRYESRTNDTSTELIIRELTLADTALYYCAV
Oryzias latipes Vs184 trdv BAAF04098694.1 10887 ITVGDIISPDQDQLTATEGKSVTMKCNYQTSSSYPRLYWYKHDSDLQAPQFILWKGGKSETGELIPDKRYESRTTYTSTELIIRKLTLADTALYYCAV
Oryzias latipes Vs183 trav BAAF04098694.1 7851 CKGEDKVIQRGEVIAAEGDSLTLNCTFETSATVPYLFWYKQDVNSYPKYMLKRDTYGTKENSPEFKKDRFDAEFKDKSVPLKIQKLHVSDSAVYFCALQ
Oryzias latipes Vs182 trdv BAAF04098692.1 8267 LTAGDSISPEQDQLTGTEGKSVTMKCNYQSDESYPRLYWYKHDSDLQAPQFILWKGAKSYSKYEHIPDKRYGSRITDTSTELVIRKLTLADTALYYCAV
Oryzias latipes Vs181 trdv BAAF04098692.1 1716 LTAGDTISPEQDQLTGTEGKSVTMKCNYQTADSYPRLYWYKHDSDRQAPQFILLKGAKSSTAENIPDKLYESRTTDTSTELIITKLTLADTALYYCAL
Oryzias latipes Vs180 trav BAAF04098690.1 4419 CKGEDKVIQPGGEVIAAEGDSLTLNCTFETSDPYPYLFWYKQEVNSYPKYMLRRFSKTKENAPEFKKDRFDAELKDKSVPLKIQKLHVSDSALYYCALR
Oryzias latipes Vs106 igkv BAAF04089607.1 3536 QKNVLESSSVIQKGGFLSVSTGEAVTLECSYKGLDLTWIFWYKQTLGQRPEPISSFYTYASVLTFFDPFNNNPRFTLDTKNQNHHLRISDLQLSDSATYYCA
Oryzias latipes Vs457 trav BAAF04129164.1 815 CKGEDKVIQPGGEVIAAEGDSLTLNCSFETSFSQSYLFWYKQEVNSYPKYMLKRYSTTKENSPEFKEDRFDAELKDKSVPLKIQKLHVSDSAVYYCALR
Oryzias latipes Vs104 igkv BAAF04089494.1 1088 HLSAVIWAGAVKQDTGVRSVSVGENVTLQCFYENVMAMHFSWYQQPLGGRPELLSFFYKYDDPSKVDHWLQKKPRFSLQREEGINHLHISDVQLSDSATYFCGS
Oryzias latipes Vs103 igkv BAAF04089493.1 162 HLSAVIWAGAVKQDTGVRSVSVGENVTLQCFYENVMAMHFSWYQQPLGGRPELLSFFYKYDDPSKVDHWLQKKPRFSLQREEGINHLHISDVQLSDSATYFCGS
Oryzias latipes Vs450 trdv BAAF04122105.1 2797 LTDGDSISPDQDQLTGTEGKSVTMKCNYQTDYRNLWLSWYKHDSVLQAPQFILFKGAKGDKRELIPDKRYESRTTDTSTELIIRKLTLADTALYYCAV
Oryzias latipes Vs452 igkv BAAF04122300.1 2535 SSGEITLTQTPGSQSVVPGQTVSIRCQTSSGVSGLLHWYLQKSGEAPKLLIHSVSTRQSGVSDRFRGSGSGSDYTLTISGVQAEDSGVYYCQQGVNFPI
Oryzias latipes Vs459 igkv BAAF04133399.1 538 SRGQFTVTQPGVVRFAVGESVSISCRTSENVFVYNGYHRLSWYQQKDGESPKQLIYSASTQQSGIPSRFTGSGSNSDFTLTISGIQAEDAAVYYCQS
Oryzias latipes Vs165 ighv BAAF04098523.1 358 VLSQIKMDQSPNVVKRPGETVKMSCVCSGFSMTSFYIHWIRQKPGRALEWIGFMNAGSNSPTYSSSFQDRVIMTEVVSSSSQYLEISSLTAEDSAVYFCARK
Oryzias latipes Vs164 ighv BAAF04098521.1 6837 VDSIDLIQPDSKVVQPGQSLTISCQVSGYSLTDNSYATGWIRQREGKPMDWISHQWGGGNFYQNDALKNKFSYSRDTSAGTVTITGQNLQPEDTAVYYCVRR
Oryzias latipes Vs167 ighv BAAF04098537.1 174 WSITESEAAVKTPGESHRLTCTTSGFGFRGSVWNWIRQTHGKGLEWIALVHTSSSPIYYSESVKNRFTIFRDDSSSKVYPQMSNLKAEDTAMYYCAEE
Oryzias latipes Vs166 ighv BAAF04098523.1 1140 CIKKERKKALTESETVVKRPGESHKLTCTYSGFSGDQHIAWIRQPAGKGLEWIAYISSGSSSISYSESVKNRFTISRDNSRKQVYLQMNSLRAEDSAVYYCAR
Oryzias latipes Vs208 igkv BAAF04109807.1 384 SRGQVTVTQPGAVSSAVGGSVSISCRTSQNIYSDRLAWYQQKDGETPKLLIYYISSRASGTPTRFTGSGSNSGTDFTLTISGIQAEDAAVYYCQS
Oryzias latipes Vs209 igkv BAAF04109809.1 3288 SRGQVTVTQPGAVSSAVGGSVSISCRTSQDVNGNNLAWYQQKDGQSPKLLFYYVGNRVSGTPTRCTDGGSNSDFTLTINGIQAEDAAVYYCQS
Oryzias latipes Vs163 ighv BAAF04098521.1 3492 VLSQIKLDQSPNVVKRPGETVKMSCVCSGFDMTDYNIHWIRQKPGRALEWIGFMDAGNNDPTYSSSFQNRFLMTEVVSSSSQYLEISSLTAEDSAEYFCARQ
Oryzias latipes Vs162 ighv BAAF04098520.1 1682 AKCEQLPVSESLQPGERLTITCQVSYSVGSYHTAWIRQPAGKGLEWIGMKYTGGSYYKDSLKNKFSIDLDSSNNRVTLNGQNMQPEDSAVYFCARR
Oryzias latipes Vs205 trbv BAAF04109220.1 1177 AAVKVLQSEDLLSQAGAPLTLQCSMGGGLSMGSHTMLWYRQNRHGAQLEFLIKEYQDTAGRFHSSIDTNQNNFTLHLSGLLVNDSSTYFCAA
Oryzias latipes Vs206 trgv BAAF04109550.1 4463 ELIQEDLTLTRRVGESVSFSCGGIQECYGDYIVWYQKKETETFKVILDIDKRDSKLDKGYGHPQKDDFTADITKSGCELKINKVKVDHSASYYCSCWKD
Oryzias latipes Vs207 igkv BAAF04109806.1 659 SRGQVTVTQPGPVSSAVGGSVSISCRTSQNIYSDRLAWYQQKDGETPKLLIYYISSRASGTPTRFTGSGSNSGTDFTLTISGIQAEDAAVYYCQS
Oryzias latipes Vs201 trdv BAAF04107650.1 1783 LTDGETISPDQDQFTGAEGKSVTMKCNYQTDRSHPWLYWYKHDSDLQAPQFILWKGAKSSTDEHIPDKRYESSTTDTSTELIIRELTLADTAIYYCAI
Oryzias latipes Vs202 trav BAAF04107654.1 2475 CKGEDKVIQPGGEVIAAEGDSLILNCTFETSSTQLPTLFWYKQEVNSYPKYMLKRYSTAKENTPEFKEDRFDAELKDKSVPLKIQKLHVSDSAVYYCALQ
Oryzias latipes Vs168 ighv BAAF04098538.1 6549 VLSQIKLDQSPNVVKRRGESVKMSCVCSGFKMTEYFIHWIRQKPGRALEWIGYMDTGKNSPTYSSSFQGRFLMTEVVSSSSQYLEISSLTAEDSAVYFCARQ
Oryzias latipes Vs198 trdv BAAF04107643.1 8491 LTDGDSISSDQDQLTGTEGKSVTMKCIYQTGDSYPRLYWYKHDSDLQAPQFILFKGAKSSTSELIPDKRYLSRTTDTSTELIIRELTLADTALYYCAI
Oryzias latipes Vs199 trav BAAF04107643.1 11102 CKGEDKVIQPGGEVIAAEGDSLTLNCTFETSDTFPTLFWYKQEVNSYPKNMLKRYSTTKENAPGFKEDRFDAELKDISVPLKIQKLHVSDSAVYYCALQ
Oryzias latipes Vs195 trav BAAF04107638.1 3830 CKGEDKVIQPGGEVIAAEGDSLTLNCTFETSDTFPTLFWYKQEVNSYPKYMLKRYSKTKQNAPEFKEDRFDAELKGKSVPLKIQKLHVSDSAVYYCALQ
Oryzias latipes Vs197 trdv BAAF04107640.1 657 LTAGDSISPDQDQLTGTEGKSVTMKCNYQTSSRGIYLYWYKHDSDLQAPQFILWKRAKSEAREHIPDKRYDSRTTDTSTELIIRKLTLADTALYYCA
Oryzias latipes Vs110 igkv BAAF04089825.1 3500 SSEEILLTQTPGAQSVVEGQTVSIRCKSSKLIGDDINWYLQKPGEAPKLLIYDTTERQSGVPDRFRATAVQTDFTLTISRVQPEDSGVYYCQQHNSFP
Oryzias latipes Vs111 igkv BAAF04089825.1 9490 SSEKLLTQTPGAQSVVQGQTVSIRCKASSSVGTCLNWYLQKNGESPKLLIYYATNRQSGVSSHFSGSGSGTDFTLTVSGIEPEHAGVYYCQQCNSLP
Oryzias latipes Vs112 igkv BAAF04089825.1 13592 SRGQVTVTQPGAVSSAVGGSVSISCRTSQNVYGSNYLAWYQQKDGKSPKLLIYLSSTRETGTPTRFTGSGSNSDFTLTISGIQAEDAAVYYCQS
Oryzias latipes Vs445 trbv BAAF04120723.1 2638 GTDGSDVSQTSMLWTKKGQDATMNCSHTKGAQYFQMYWYRQLPGRTMEQIVCTTPSNKKNDYDFGAFSKEKFSATKTEPERGTFTVMKVEPGDKGLYFCSVA
Oryzias latipes Vs442 trbv BAAF04120721.1 347 GTDGSDVSQTSMLWTKKGQNATMNCSHTKGATYYQMYWYRQLPGETMELVVFTSTAQRGGEHDFGAFSKEKFSATKTEAERGTFTVKKVQPEDKGLYFCAVS
Oryzias latipes Vs443 trbv BAAF04120722.1 1254 SSLMDQITQTPAHVFKHAGEEAEIKCSHSIQSYDTGLWCKQSEDGQMQLLGYMMSGSAFPESGLGVTMGGSADKDQTFTLTIAGISEGSRAVYFCAAR
Oryzias latipes Vs440 trgv BAAF04120099.1 931 ELIQEDLTLTRRVGQSVSFSCGGIQECYDSDRYWYQKKETETFKIILYFDESNGYINKGYGHPQKDDFTAEKTQSGCELKINKVKVDHSASYYCSCYKYNP
Oryzias latipes Vs118 ighv BAAF04093782.1 15474 IRGQTLTESESVVKRPGESEKLTCTYSGFSSTPYIAWIRQPAGKRLEWIAYISDGSSYIYYSESVKNRFTISRDNSRKQLYLQMNSLRAEDSAVYYCAR
Oryzias latipes Vs119 ighv BAAF04093785.1 210 VRGQSLTSSQPVVSRPGQSVTLTCKVQGLSLAWLHWIRQKPGKGLEWIGRIDSGTGTIFAESLQSQFSISKDTSQNVVSLVVKSLTEDDTAVYYCARE
Oryzias latipes Vs449 trav BAAF04122104.1 2093 CRAQTDNVQQPGGDVTAAEGDTVTLGCHFNSSSSNYYLFWYKQDGSNRPTFILSRFKIGTGTTSEEFKERFSSSLDSESRSVPLKIQKLHVSDSAVYYCALQ
Oryzias latipes Vs176 trdv BAAF04098687.1 2588 LTDGVTISPDQDQLTGTEGKSVTMKCNYQTDYRDLWLYWYKHDFDLQAPQFILWKGGKDQTGEHIPDKRYESRTTDTSTELIIRELTLADTALYYCAV
Oryzias latipes Vs177 trdv BAAF04098687.1 8326 LTAGDSISPDQDQLTGTEGKSVTMKCNYQTADSTPYLYWYKHDSDLQAPQFILWKGAKSSTREFIPDKRYESRTTDTSTELIIRKLTLADTALYYCAV
Oryzias latipes Vs174 trdv BAAF04098683.1 8214 LTDGDSISPDQDQLTGTEGKSVIMKCNYQTSSSYPYLYWYKHDSDLQAPQFILWKGAKSSTREHIPNKRYESRTTDTSTELIIRELTLADTALYYCAI
Oryzias latipes Vs175 trdv BAAF04098685.1 9075 LTAGDSISPDQDQLTGTEGKSVTMKCNYQTDDSDLWLYWYKHDSDLQAPQFILLKGAKGSTDEHIPDKRYESRTTDTSTELTITKLTLADTALYYCAV
Oryzias latipes Vs172 trav BAAF04098682.1 9979 CKGEDKVIQPGGEVIAAEGDFLTLNCTFETSDTFPTLFWYKQEVNSYPKYMLKRYSKTKENAPEFKEDRFDAELKDKSVPLKIQKLHVSDSAVYYCALR
Oryzias latipes Vs173 trdv BAAF04098683.1 3024 LTDGDTISPDQDQLTGTEGKSVTMKCNYQTDESYIYLYWYKHDSDLRAPQFILWKRAKGSTDEHIPNKRYESRTTDTSTELIIRELTLADTALYYCAI
Oryzias latipes Vs170 trav BAAF04098682.1 5127 CKGEDKVIQPGGEVIAAEGDSLTLNCTFETSTVPYLFWYKQEVNSYPKYMLKRYSKTKENAPEFKEDRFDAELKDKSVPLKIQKLHVSDSAVYYCALK
Oryzias latipes Vs171 trdv BAAF04098682.1 8090 LTAGDTISPDQDQLTGTEGKSVTMKCNYQTTRTGLYLYWYKHDSDLRAPQFILWKGAKSYTNEHVPDKRYESRTTDTSTELIIRELTLADTALYYCAI
Oryzias latipes Vs304 igkv BAAF04062035.1 5854 SRGQVTVTQPGAVSSAVGGTVSISCRTSQDVYVYKSNHCLSWYQQKDGKSPKLLIYWASTRQSGIPSRFTGSGSNSDFTLTISGIQAEDAAVYYCQS
Oryzias latipes Vs141 trav BAAF04095352.1 8747 GDSLEDGITASRAEVFSSEELTVTLSCNYSVTANNLQWYRQDPGSAPRFLLLITDTKEPSVVEAKPPNPRLTAVLNRERNQVHLQISSAAVTDSAVYYCAVQ
Oryzias latipes Vs178 trdv BAAF04098687.1 21153 LTDGDSISPDQDQLTGTEGKSVTMKCNYQTSSSYPYLYWYKHDSDLQAPQFILWKGAKSYSKHENIPDKRYESRTTDTSTELIIRELTLADTALYYCALRR
Oryzias latipes Vs179 trdv BAAF04098689.1 6175 LTAGDSISPDQDQLTGTEGKSVTMKCNYQTDSNYVLLSWYKHDSVLQAPQFILWKGAKTSTRENIPDKRYISRTTDKSTELIIRELTLADTALYYCAADT
Oryzias latipes Vs389 ighv BAAF04111531.1 593 VKCEQLTQPASESLQPGERLTITCQVSYSVSSYYTGWIRQPAGKGLEWIGIKYTGGSHYKDSLKNKFSIDVDSSNNRVTLKGQNMQAEDSAVYFCARD
Oryzias latipes Vs222 igkv BAAF04117664.1 103 SVGQNVVLTQPAAKSVQLNQKVTIDCKASRQVAQYSGSQYWLSWYHQKSGEAPKALIYGTSERFSGISSRFSGSGSGNGIDFTLTISGVQAEDSGVYYCQS
Oryzias latipes Vs411 trdv BAAF04114957.1 7071 LTAGDSISPFRDQLTGTEGKLVIMKCNYQTDYSYPELYWFKHDSDLQAPLFILWKGAKSETREHIPDKRYESRTTDTSTELIIRELTLADTALYYCAI
Oryzias latipes Vs221 igkv BAAF04117659.1 231 SSGEITLTQTPGSQSVVPGETFSIRCQTSSSISNYIHWYLQKSGEAPKLLIRYATTRQSGVSDRFRGSGSGSDFTLTISGVQAEDSGVYYCQQGGYSFP
Oryzias latipes Vs365 trav BAAF04095862.1 586 CKGEDKVIQPGGEVIAAEGDSLTLNCTFETGATYAYLFWYKQEVNSYPKYMLKRDTYGTGENVPEFKKDRFDAELKDKSVPLKIQKLHVSDSAMYYCALQ
Oryzias latipes Vs364 trav BAAF04095861.1 7351 CKGEDKVIQPGGEVIAAEGDSLTLNCSFETIATFPKLFWYKQEVNSYPKYMLRCYSTSKENAPAFKKDRFDAELKEKSVPLKIQKLHVSDSAVYYCALQ
Oryzias latipes Vs349 igkv BAAF04091661.1 4533 SRGQVTVTQPGAVSSAVGGNVSISCRTSQDVNYWNSFYILSWFQQKDGESPKLLIYRASSRQSGIPSRFTGSGSNSDFTLTISGIQAEDAAVYYCLAEFKIS
Oryzias latipes Vs362 trav BAAF04095859.1 1573 CKGEDKVIQPGGEVIAAEGDSLTLNCTFETSTVPYLFWYKQEVNSYPKYMLRRYSKTKENAPEFKEDRFDAELKDKSVPLKIQKLHVSDSAVYYCALQ
Oryzias latipes Vs361 trdv BAAF04095858.1 1176 LTAGDSISPDQDQLTGTEGKFVTIECNYQTNSSDIILHWYKHNFDLQDPQFILWKGAKSCSNHENIPDKRYESDTTDTSTELIITNLTLADTALYYCVL
Oryzias latipes Vs360 trdv BAAF04095853.1 3766 LTAGDSISPDQDQLTGTEGKSVTMKCNYETSSSYPSLYWYKHDSYLQAPQFILWKRAKGYTEENIPDKRYESRTTDTSTELIIRKLTLADTALYYCALDT
Oryzias latipes Vs305 igkv BAAF04062239.1 14052 SSGEITVTQTPGSQSVVPGETFSIRCQTSSSVSTYLHWYLQKFGEAPKLLIRYATTRQSGVSDRYRGSGSGSDYTLTISGVQAEDSGVYYCQQGNSFP
Oryzias latipes Vs142 trdv BAAF04095357.1 5081 LTIGDTIFPFRDQPTGTEGKFVILKCNYQTDYSYPELYWFKHDSDLQAPQFILWKGAKRYSNNELIPDKRYESRTTDTSTELIITKLTLADTALYYCALQR
Oryzias latipes Vs307 igkv BAAF04062240.1 2782 SSGEITVTQTPGSQSVVPGETFSIRCQTSSYVGNNIGWYLQKSGEAPKLLIYDASTRQSGVSDRFRGSGSGSDYTLTISGVQAEDSGVYYCQQGYSFP
Oryzias latipes Vs306 igkv BAAF04062239.1 1693 SSGEITVTQTPGSQSVVPGETFSIRCQTSSYVSNNYLQWYLQKSGESPKLLIYDAVTRQSGVSDRFRGSGSGSDFTLTISRVQAEDSGVYYCQHDYSYP
Oryzias latipes Vs146 trdv BAAF04095364.1 3364 LTAGDSISPDQDQLTGTEGKSVTMKCNYQTDYSNRLLFWYKHYSDLQAPQFILWKGAKGSTGELIPDKRYESRTTDTSTELIIRELTLADTALYYCAV
Oryzias latipes Vs145 trav BAAF04095364.1 1465 GDSLEDGITASRAEVFSSEELTVTLSCNYSVRAENLQWYRQDPGSAPRFLLLITDTKEPSVVEAKPPNPRQTAVLNQERNQVHLQISSAAVTDSAVYYCALQ
Oryzias latipes Vs144 trav BAAF04095357.1 20525 GDSLEDGITASRAEVFSSEELTVTLSCNYSVKADNLQWYRQDPGSAPRFLLLITDTKEPSVVEAKPPNPRLAAVLNQERNQVHLQISSAAVTDSAVYYCALQ
Oryzias latipes Vs262 trdv BAAF04024431.1 2822 LTAGDSISPDQDQLTGTEGKSVTMKCNYLTDYSHPSLYWYKHDSDVKAPQFILWKGAKSWSNSEHIPDKRYESRTTDTSTELTIRELTLADTALYYCAV
Oryzias latipes Vs263 trdv BAAF04024432.1 9926 ITAGDSISPDQDQLTGTEGKSVTMKCNYQTDRSYPYLYWYKHDSDLQAPQFILWKGAKGDKRELIPDKRYESRTTDTSTELTITKLTLADTALYYCAI
Oryzias latipes Vs149 ighv BAAF04098476.1 1998 IRGQTLTESESVVRRPGEPHKLTCTYSGFSGDYWNAWIRQPAGKGLEWIATISPDSSGIYYSESMKNRFTISRDNSRKQVYLQMNSLRAEDSAVYYCAR
Oryzias latipes Vs261 trav BAAF04024431.1 6357 CKGEDKVIQPGGEVIAAEGDSLTLNCSFETSFSQSYLFWYKQEVNIYPKYMLKRDTYGTKENSPEFKEDRFDAELKDKSVPLKIQKLHVSDSAVYYCALQ
Oryzias latipes Vs96 igkv BAAF04089439.1 3377 NSWAQESSASLHFESVFVGQEVTLKCFLEGTGANVFFWYKQPLGQKPQLMSEFFNHKEIGTFADDFKKDPRFELQTNEDKNNLKISNVKMSDSATYYCISS
Oryzias latipes Vs308 igkv BAAF04062241.1 2358 SVGQNVVVTQPAAKSVQLGQKVTIDCKASQQVAHYSGSQYYLAWYHQKSGEAPKALIYRTSDRFSGISSRFSGSGSGNGIDFTLTISGVQAEDSGVYYCQS
Oryzias latipes Vs264 trdv BAAF04024435.1 4738 LTDGDTISPEQDQLTGTEGKSVTMKCNYQTAENYINLYWYTHDSDLQAPQFILWKGAKGYSKYENIPDKRYESRTTDTSTQLTIRELTLADTALYYCALEI
Oryzias latipes Vs265 trav BAAF04024435.1 2331 CKGEDKVIQPGGEVIAAEGDSLTLNCTFETSSTPLPTLFWYKQEVNSYPKYMLKRYSKTKENSPEFKEDRFDAKLKDKSVPLKIQKLHVSDSAVYYCALQ
Oryzias latipes Vs401 ighv BAAF04114429.1 2780 VKCEQLTQPASVSLQPGERLTITCQVSYSLGSYYTGWIRQPAGKGLEWIGSECVGCTKYYKDSLKNKFSMTLDSSNKRVTLKGQNMQPEDSAVYFCARD
Oryzias latipes Vs301 ighv BAAF04059805.1 11788 GLNGQALESIPSTSMVKKPQEVLSLSCKGSGFRFDQYGMNWIRQPVGKSLEWIGAIWYDASKTVYADSLQGRTEITRDNSNSFVYLKLSDLKPEDSALYYCARQ
Oryzias latipes Vs407 trav BAAF04114955.1 9875 GDSLEDGITASRAEVFSSEELTVTLSCNYSVKANNLQWYRQDPGSAPRFLLLITDTKEPSVVEAKPPNPRQTAVLNQERNQVHLQISSAAVTDSAVYYCALQ
Oryzias latipes Vs374 trdv BAAF04109781.1 8218 LTAGDSISPDQDQLTGTEGKSVTMKCNYQTADSGPWLYWYKHDSDLQAPQFILRKGGKSSTSELIPDKRYESRTTDTSTELIIRKLTLADTALYYCAI
Oryzias latipes Vs375 trav BAAF04109783.1 14378 CKGEDKVIQPGGEVIAAEGDSLTLNCSFETSFSQSYLFWYKQEVNIYPKYMLKRDTYGTKENSPEFKEDRFDAELKDKSVPLKIQKLHVSDSAVYYCALQ
Oryzias latipes Vs376 trav BAAF04109783.1 8099 CKGEDKVIQPGGEVIAAEGDSLTLNCTYETSFSQPTLFWYKQEVNSYAKYMLKRYSKTKENAPEFKEDRFDAELKDKSVPLKIQKLHVSDSAVYYCALQ
Oryzias latipes Vs377 trdv BAAF04109783.1 2202 LTAGDTISPDQDQLTGTEGKSVTMKCNYQTYDSYIYLYWYKHDSDLQAPQFILWKEAKGNTDENIPDKRYESRTTDTSTELTIRKLTLADTALYYCAI
Oryzias latipes Vs378 trav BAAF04109784.1 782 CKGEDKVIQPGGEVIAAEGDSLTLNCSFETSFSQSYLFWYKQEVNIYPKYMLKRDTYGTKENSPEFKEDRFDAELKDKSVPLKIQKLHVSDSAVYYCALQ
Oryzias latipes Vs379 trdv BAAF04109787.1 9659 LTAGDTISPDQDQLTGTEGKSVTMKCNYQTYDSYIYLYWYKHDFDLQAPQFILWKGAKRYSNNELIPDKRYESRTTDTSTELIIRELTLADTALYYCALQR
Oryzias latipes Vs314 igkv BAAF04062250.1 8631 QKIDLKSSSVIQKGFFLSVSTGDAVTLECSYEGLDLTWIFWYKQTLGQRPEPISSFYTYASVLTFFDPFNNSQRFTLDTKNQNHHLRISDLQLSDSATYYCA
Oryzias latipes Vs312 igkv BAAF04062247.1 5478 SVGQNVVVTQPAAKSVQLNQKVSIDCKASQQVAHYSGSQYFLAWYHQKSGEAPKALIRRTSDRFSGISSRFSGSGSGNGIDFTLTISGVQAEDSGVYYCQS
Oryzias latipes Vs313 igkv BAAF04062248.1 3756 SSGEITLTQTPGSKSVVPGETFSIRCQTSSSVSTNLHWYLQKSVEAPKLLIYYATTRQSGVSDRFRGSGSGSDFTLTISGVQAEDSGVYYCQQSNSFP
Oryzias latipes Vs310 igkv BAAF04062242.1 6170 SSGEITVTQTPGSQSVVPEQTVSIRCQTSSSVSNYIHWYLQKSGEAPKLLIKKATTRQSGVSDRFRGSGSGSDFTLTISGVQAEDSGVYYCQQSNSFP
Oryzias latipes Vs311 igkv BAAF04062243.1 431 SVGQNVVLTQPAAKSVQLNQKVSIDCKASQQVHHYSGSQYWLAWYHQKSGEAPKALIYRTSERFSGISSRFSGSGSGNGIDFTLTISGVQAEDSGVYYCQS
Oryzias latipes Vs154 ighv BAAF04098481.1 6543 VDSIDLIQPDSKVVQPGQSLTISCQVSGYSLTDSTYGYATGWIRQREGKPMDWIFHIYYDGSSNQNDALKNKISHSRDTSAGTVTITGQNLQPEDTAVYYCVR
Oryzias latipes Vs155 ighv BAAF04098481.1 8734 IRGQTLTESESVVKRPGEPHKLTCTYSGFSGDPSIAWIRQPAGKGLEWIAYINSGSNYIYYSESVKNRFTISRDNGRKQVYLQMNSLRAEDSAVYYCA
Oryzias latipes Vs156 ighv BAAF04098500.1 7716 VDGQTLTESESEVKSPGESHRLTCSASGFPFSSYRMAWIRQAPGKGLEWIAWINTGSSSIFYSESVKNRFTISRDNSRQEVYLQMNILRAEDSAVYYCAR
Oryzias latipes Vs157 ighv BAAF04098500.1 10507 VKCEQLTQPASVSLQPGERLTITCQVSYSVSSYRTAWIRQPAGKGLEWIGMRYTGDSYYKDSLKNKFSIDLDSSNNRVTLNGQNMQPEDSAVYFCARE
Oryzias latipes Vs150 ighv BAAF04098476.1 4456 VDGQTLTESESVVKRPGESHRLTCSASGFTFSSYGMNWVRQAPGKGLEWIAYICTSSSPIYYSQSVQGRFSISRDDSSSKLYLQMNSLRMEDTAVYYCARR
Oryzias latipes Vs151 ighv BAAF04098476.1 6018 VKCEQLTQPDSVSLQPGQRLTITCQVSYSVSSYWTGWIRQPAGKGLEWIGSERVGYAKYYKDSLKNKFSIDLDSSNNRVTLKGQNMQAEDSAVYFCARH
Oryzias latipes Vs152 ighv BAAF04098480.1 591 VDGQTLTESESVVKRPGESHRLTCSASGFTFSSYQMSWIRQAPGEGLEWIAFIDVTSIYYSESVKNRFTISRDNSRQQLYLQMNSLRVEDSAVYYCARR
Oryzias latipes Vs153 ighv BAAF04098481.1 4938 IDGQTLIQSESVVKRPGESNRLTCSPSGIDFSSYAMSWIRQAPGKGLEWIAYISSGSGSIYYSESVKNRFTISRDNSRQQLYLQMNSLRAEDSAVYYCA
Oryzias latipes Vs358 trav BAAF04095852.1 3230 CKGEDKVIQPGGEVIAAEGDSLTLNCTFETIYTPHLFWYRREKKGTINYILRRHSYGKNENAPEFKEDRFDAELKDKSVPLKIQKLHVSDSAVYYCALK
Oryzias latipes Vs454 igkv BAAF04123877.1 795 SRGQVTVTQPGAVSSAVGGTVSISCRTSRDVYVYKNNHCLAWYQQKDGESPKLLIYYASTRQSGIPSRFTGSGSNSDFILTISEIQAEDAAVYYCYS
Oryzias latipes Vs226 trdv BAAF04122475.1 6219 LAAGDSISPDQDQLTATEGKSVTMKCNYLTDYSLPSLYWYKQDFDLQAPQFILWKGAKSYSNSEHIPDKRYESRTTDTSTELIIRKLTLADTALYYCAV
Oryzias latipes Vs388 ighv BAAF04111530.1 3956 VKCEQLAQPASVSLQPGQRLTITCQVSYSVSSYYTAWIRQHAGKGLEWIGSERVGQTKYYKDSLKNKFSIDLDSSNNRVTLNGQNMQPEDTAVYFCARDPEAL
Oryzias latipes Vs384 trdv BAAF04110871.1 1391 LTAGCSISPDQDQLIGTEGKSVTMKCYYETDYSFPQLYWYKHDSDLRDPQFILWKGAKSYSNNKYIPDKRYESKTTDTSTELTIKKLNLADTALYYCAL
Oryzias latipes Vs413 igkv BAAF04115252.1 3036 SSGEITVTQTPGSQSVVPGQTVSIRCQTSSGVSGLLNWYLQKSGEAPKLLIYAATTRRSGVSDRFRGSGSGSDYTLTISGVQAEDSGVYYCQQGANFPI
Oryzias latipes Vs415 igkv BAAF04115259.1 3960 AKSVQLNQKVTIDCKASQQVFLCTDDYSCFMDYEWTDPHYLLSWYHQKSGEAPKALIYATSDRFSGISSRFSGSGSGNGIDFTLTISGVQAEDSGVYFCQS
Oryzias latipes Vs414 igkv BAAF04115257.1 3854 SVGQNVVVTQPAAKSVQLNQEVTIDCKASQKVAHYTGSQYYLAWYHQKSGEAPKALIYRTSDRLSGISSRISGSGSGYGIDFTLTISGVQAEDSGVYYCQS
Oryzias latipes Vs302 ighv BAAF04059805.1 9562 VLSQIKLDQSPNVVKKPGETVKMSCVCSGYSMTSFYIHWIRQKPGRALEWIGRMNTGNNSPTYSSSFQGRFLMTEVVSSSSQYLEISSLTAEDSAVYFCARS
Oryzias latipes Vs102 igkv BAAF04089466.1 7892 YSWAQKSSASLHFESVLVGQEVTLKCFHRGTVADFYFWYKQPLGQKPQRMSEFFDYKKNGTFSDDFKNDLRLQLQTNEGKNHLKISNVKMSDSATYYCISS
Oryzias latipes Vs129 ighv BAAF04093798.1 22061 VDSIDLIQPDSKVVQTGQSLTISCQVSGYSLTDGYATGWIRQREGKPMDWIFYQWGSSSGSFHQNDALKNKFSYSRDTSAGTVTITGQNLQPEDTAVYYCVRR
Oryzias latipes Vs128 ighv BAAF04093798.1 20290 VDGQTLTESESEVRRPGESHRLTCSASGFTFSSYHMGWVRQAPGKGLEWIAYIYTDSSGIFYSESVKNRFTISRDNSRQQLYLQMNSLRAEDSAVYYCAR
Oryzias latipes Vs121 ighv BAAF04093785.1 2136 KKTLTESESVVKRPGESQNLTCTYSGFSDDRHIAWIRQPAGKGLEWIASISTSSSSIYYSESVKNRFTISRDNSRKQVYLQMNSLRAEDSAVYYCARE
Oryzias latipes Vs120 ighv BAAF04093785.1 1357 VLSQIKLDQSPNVVKRPGETVKMSCVCSGFSMTSYYIHWIRQKPGRALEWIGRMNAGSNSPVYSSSFQDRFLMTEVVSSSSQYLEISSLTAEDSAVYFCARE
Oryzias latipes Vs123 ighv BAAF04093785.1 7233 FSSSSGVKCEQLTQPASESLQPGERLTITCQVSYSLSSYYTAWIRQPAGKGLEWIGMRDTGSSYYKDSLKNKFSIDLDSSNNRVTLNGQNMQPEDSAVYFCARR
Oryzias latipes Vs122 ighv BAAF04093785.1 5618 VDSIDLIQPDSKVVQTGQSLTISCQVSGYSLTDGYATGWIRQREGKPMDWISHQWGGGNFYQNDALKNKFSYSRDTSAGTVTITGQNLQPEDTAVYYCVR
Oryzias latipes Vs125 ighv BAAF04093798.1 8295 VKCEQLTQPASVSLQPGERLTITCQVSYSLSYYTGWIRQPAGKGLEWIGIKYTGDSHYKDSLKNKFSIDLDSSNNRVTLNGQNMQPEDSAVYFCARW
Oryzias latipes Vs124 ighv BAAF04093798.1 1721 VDGQTLTESESAVKRPGESHRLTCSASGFSFSSYRMSWVRQAPGKGLEWIAFIYSDSSGMFYSESVKNRFTISRDNSRQQLYLQMNSLRAEDSAVYYCAR
Oryzias latipes Vs127 ighv BAAF04093798.1 17628 VKCEQLTQPASVSLQPGQSLTITCQVSYSLGSYTAWIRQPAGKGLEWIGMKHTGASYYKDSLKNKFSIDLDSSNNRVTLNGQNMQPEDSAVYFCARR
Oryzias latipes Vs126 ighv BAAF04093798.1 11015 VDGQTLTESESVVKRPGESHRLTCSASGFTFSSYYMGWIRQAPGKGLEWIAYIYTGSSSMYYSESVKNRFIISRDDSRQQLYLQMNSLRAEDSAVYYCAR
Oryzias latipes Vs78 trbv BAAF04075119.1 14409 PTDGREVEQPPELWTRRGEDAKMDCSHTKGAGYYQMYWFRQLPGESMRLVVLTTAGTDKHDFGDFSTEKFSAWKPDAHSGSFSVLKVEPADEGVYFCAVG
Oryzias latipes Vs79 trbv BAAF04075119.1 16730 TSDTKTVLQTPAFIIKRTGESLNNEIECSHSIENYEVIMWYKTSWNETLRFLGFLNLGFPYPEEDLKAKISFEGDGSQKSKLSVSDLQVSDSAVYYCAAR
Oryzias latipes Vs410 trav BAAF04114956.1 4326 CKGEDKVIQPGGEVIAAEGDSLTLNCTFETSSTTLTTLFWYKQEVNSYPKYMLKRDTYGTEENSPEFKEDRFDAELKDKSVPLKIQKLHVSASAVYYCALK
Oryzias latipes Vs387 ighv BAAF04111530.1 5509 VDGQTLTESESEVKRPGESHRLTCSASGFSFSSYPMAWIRQAPGKGLEWIAWIHTGSSSIYYSESVKNRFTISRDDSRQQVYLQMNNLRAEDSAVYYCAR
Oryzias latipes Vs380 trav BAAF04109789.1 2276 CKGEDKVIQPEGEVIAAEGDSLTLNCTFETIDTFPYLFWYKQEVNSYPKYMLKRYSKTKENSPEFKEDRFDAELKDKSVPLKIQKLHVSDSAVYYCALQ
Oryzias latipes Vs224 trav BAAF04120709.1 135 CKGEDKVIQPGGEVIAAEGDSLTLNCTFETSSTQLPTLFWYKQEVNSYPKYMLKRYSKTKENSPEFKEDRFDAELKDKSVPLKIQKLHVLDSAVYYCALQ
Oryzias latipes Vs408 trdv BAAF04114955.1 7976 IIDGDTISPDQDQLTGTEGKSVTMKCNYQTDDSYPELHWYKHDSDLQAPQFILRKGAKSSTSEHIPDKRYESRTTDTSTELIIRKLTLADTALYYCALRR
Oryzias latipes Vs409 trdv BAAF04114955.1 1227 LTAGDSISPDQDQLTGTEGKSVTLKCNYQTDRSYPLLYWYKHDSDLQAPQFILLKGAKSSTAENIPDKYGSRTTVTSTELIIRELTLADTALYYCVLER
Oryzias latipes Vs81 trbv BAAF04075122.1 1276 PSSNAVQQTPPSLIRSPGQPVPSQIYCSHSITSFDNILWYKQDSGGALKYLGYLNLQFPYPENDVKETLSFSGDGRSHSNLSFSRLSEDDSAVYFCAARR
Oryzias latipes Vs80 trbv BAAF04075120.1 134 FAANDVTQTPAVLTELGGNATTECSHDKGGFYFYMLWFRQLSGGTMELIVSTTAGQSEHEFGAFSQEKFSATKAGVSRGTLTVKNVQPEDSGVYFCAVS
Oryzias latipes Vs399 trgv BAAF04114328.1 545 ELIQEDLTLTRRVGESVSFSCGGTQECYDSYRLWYQKKETETFRLILVFVESNGYIDKGYNHPQKDDFTAEKTQSGCELKINQVKVDHSASYYCSCWKSD
Oryzias latipes Vs402 ighv BAAF04114429.1 1711 VDGQTLTESESEVKRPGESHRLTCSASGFTFSSYYMAWIRQAPGKGLEWIAYISSGSSSIYYSESVKNRFIISRDNSRQQLYLQMNSLRAEDSAVYYCAR
Oryzias latipes Vs397 trgv BAAF04113934.1 6539 ELIQEDLTLTRRVGQSVSFSCGGIQECGNSYRRWYQKKETETFRVILRFDERNGETYKGYGHPQQDDFTAEKTQSGCELKINKVKVDHSASYYCSCWKSS
Oryzias latipes Vs400 ighv BAAF04114428.1 2627 IRGQTLTESESAVKRPGESHKLTCTYSGFSSDQHIAWIRQPAGKGLEWFAYISSGSSSIYYSDSVKNRFTISRDNSRKQVYLQMNSLRAEDSAVYYCAR
Oryzias latipes Vs416 igkv BAAF04115260.1 1985 SSGEITLTQTPGSQSVVPGETFSIRCQTSSSVGSWLHWYLQKSGEAPKLLIYLATNRQSGVSDRFRGSGFGSDFTLTISGVQAGDSGVYYCQQGSSFP
Oryzias latipes Vs392 trav BAAF04111825.1 4446 CKGEDKVIQPGGEVIAAEGDSLTLNCTFETSVSYPYLFWYKQEVNSYPKYMLKRYSKTKENAPEFKEDRFDAELKDKSVPLKIQKLHVSDTAVYYCALK
Oryzias latipes Vs393 trav BAAF04111825.1 2315 CRAQTDNVQQPGGDVTAAEGDTVTLGCHFNSSSSNYYLFWYKQDGSNRPTFILSRFKIGTGTTSEEFKERFSSSLDSESRSVPLKIQKLHVSDSAVYYCALQ
Oryzias latipes Vs404 ighv BAAF04114433.1 707 VDGQTLTESESEVKRPGESHRLTCSASGFSFSSYPMAWIRQAPGKGLEWIAWIHTGSSSIYYSESVKNRFTISRDDSRQQVYLQMNNLRAEDSAVYYCAR
Oryzias latipes Vs391 trav BAAF04111822.1 7093 CKGEDKVIQPGGEVIAAEGDSLTLNCTFETSDTFPRLFWYKQEVNSYPKYMLKRFSTTGENAPEFKKDRFDAELKDKSVPLKIQELHVSDSAVYYCALQ
Oryzias latipes Vs235 igkv BAAF04124144.1 3765 SRGQVTVTQPGAVSSAVGGNVSISCRTSRDVYVYNSNHLLAWYQQKDGESPKLLIYYASYRQSGIPSRFTGSGSNSDFTLTISGIQAEDAAVYYCQS
Oryzias latipes Vs237 ighv BAAF04125732.1 239 VDGQTLTESESVVKRPGESHRLTCSASGFTFSSYNMNWIRQAPGKGLEWIAYIGSGSISIYYSESVKNRFTISRDNSRQQLYLQMNSLRAEDSAVYYCAR
Oryzias latipes Vs230 trbv BAAF04123622.1 2560 ISLGLEVHQSPSEILTRPEQSVQISCSHSKTDYWQMLWYQRPPGDTAMKLIRYLYMKDPTVERPFQKHFSLSGDLSGNTQKNSSLVIRNAEQNLNAVYYCAARE
Oryzias latipes Vs233 trbv BAAF04123623.1 5209 EADAVTFDPTLPVIAQSKERVEMKCRHDDSNLNVMLWYQQTQSGGMNLMGYGYTGSEPILENEFKSQFEMTREEVRRGSLILRSAKESDSAVYFCAA
Oryzias latipes Vs239 ighv BAAF04125735.1 464 FSSSSGVKCEQLTQPASVSLQPGERLTITCQVSYSVSGYYTGWIRQPAGKGLEWIGMKYTGGSHYKDSLKNKFSIDLDSSNNRVTLNGQNMQPEDSAVYFCARR
Oryzias latipes Vs132 ighv BAAF04093804.1 2083 VDGQTLTESESVVKRPGESHRLTCSASGFTFSSYYMAWVRQAPGKGLEWIAWINTGSSSMYYSESVKNRFTISRDNSRQQLYLQMNSLRAEDSAVYYCARR
Oryzias latipes Vs133 ighv BAAF04093805.1 1807 IRGQTLTESESVVKRPGEPHKLTCTYSGFSGTPDIAWIRQPAGKGLEWIAYISSGSSIYYSESVKNRFTISRDNSRKQVYLQMNSLRAEDSAVYYCAR
Oryzias latipes Vs130 ighv BAAF04093801.1 1439 VKCEQLTQPASVSLQPGQRLTITCQVSYSVSSYWTAWIRQTAGKGLEWIGMKYTGASYYKDSLKNKFSIDLDSSNNRVTLNGQNMQPEDSAVYFCAR
Oryzias latipes Vs131 ighv BAAF04093802.1 3043 VKCEQLTQPASESLQPGERLTITCQVSYSVSSYYTAWIRQPAGKGLEWIGSECVGCTKYYKDSLKNKFSMTLDSSNKRVTLNGQNMQPEDSAVYFCARD
Oryzias latipes Vs136 ighv BAAF04093815.1 4189 VKCEQLTQPDSVSLQPGERLTITCQVSYSLSSYYTGWIRQPAGKGLEWIGIKHTGASHYKDSLKNKFSIDLDSSNKRVTLNGKNMQPEDSAVYFCARR
Oryzias latipes Vs238 ighv BAAF04125734.1 1052 VDSIDLIQPDSKVVQPGQSLTISCQVSGYSLTDGYGTGWIRQREGKPMDWIFHIYYDGSSNQNDALKNKFSYSRDTSAGTVTITGQNLQPEDTAVYYCVRY
Oryzias latipes Vs134 ighv BAAF04093806.1 73 VDSIDLIQPDSKVVQPGQSLNISCQVSGYSLTDGSYATGWIRQREGKPMYWIFYQWGGGSFYQYDALKNKFSHSRDTSAGTVTITGQNLQPEDTAVYYCVRR
Oryzias latipes Vs135 ighv BAAF04093815.1 2000 VDGQTLTESESVVKRPGESHRLTCSPSGFTFSSYGMAWIRQAPGKGLEWIAYIGTSSSPISYSQSVQGRFSISRDDSCSKVYPQMNSLRMEDTAVYYCAR
Oryzias latipes Vs214 trav BAAF04112379.1 3998 CKGEDKVIQPGREVIAAEGDSLTLNCTFETIDKSAYLFWYKQEVNSYPKYILKRDTYGTNENAPEFKKDRFDAELKDKSVHLQISSAAVTYSAVYYCVLR
Oryzias latipes Vs161 ighv BAAF04098520.1 905 TEGQTLTESESVVRRPGESHKLTCTYSGFSNDYWNAWIRQAAGKGLEWVATISHSSSYISYSESVKNRFTISRDNSRKQVYLQMNSLRAEDSAVYYCAR
Oryzias latipes Vs66 igkv BAAF04062072.1 1746 SRGQVTVTQPGAVSSAVGGNVSISCRTSRDVYVNWQRRHFLSWYQQRDGESPKLLIYSASTRQSGIPSRFTGSGSNSDFTLTISGIQAEDAAVYYCQS
Oryzias latipes Vs65 igkv BAAF04062032.1 8713 SRGQVTVTQPGAVSSAVGGNVSISCATSRGVNTYKKINHLLAWYQQKDGESPKLLIYYASTRESGIPSRFTGSGSNSDFTLTISEIQAEDAAVYYCQS
Oryzias latipes Vs160 ighv BAAF04098504.1 999 VDGQSLIQSKSVIKRPGESHRLTCSASGFTFSSYGMSWIRQAPGKGLEWIAYIYDSSGIYPESVKNRFTISRDNSRQQVYLQMNSLRAEDSAVYYCAR
Oryzias latipes Vs436 trdv BAAF04118507.1 1825 LTAGDTIFTYQDQLKEHEGKSVTMKCNYQTSSNYVLLYWYKHDSDLQAPQFILWKGAKSSTREFFPDKRYESRTTDTSTELTIRKLTLADTALYYCAV
Oryzias latipes Vs435 igkv BAAF04118059.1 2047 SVGQNVVVTQPAAKSVQLNQKVTIDCKASQQVVQHSGPQYYLAWYHQKSGEAPKALIYRTSDRLSGISSRFSGSGSGNGIDFTLTISGVQAEDSGVYYCQS
Oryzias latipes Vs434 igkv BAAF04118057.1 4393 SSGEITVTQTPGSQSVVPGETFSIRCQTSSGVGNHIGWYLQKSGEAPKLLMYASTRQSGVSDRFRGSGSGSDFTLTISGVQAEDSGVYYCQQGSSL
Oryzias latipes Vs433 igkv BAAF04118056.1 1054 SVGQNVVVTQPAAKSVQLDQKVTIDCKASQKVDHCCDTRYYLAWYHQKSGEAPKALIYVTSDRFSGISFRFSGSGSGNGIDFTLTISGVQAGDSGVYYCQS
Oryzias latipes Vs432 igkv BAAF04116073.1 2535 SSGEITVTQTPGSQSVVPGETFSIRCQTSSSVSTNLHWYLQKSGEAPKLLIRYASTRQSGVSDRFRGSGSGSDYTLTISGVQAEDSGVYYCQQSNSFP
Oryzias latipes Vs431 igkv BAAF04116073.1 7887 SSGEITVTQTPGSQSVVPGETFSIKCQTSSYVGNEIGWYLQKSGESPKLLIYNAVTRQSGVSDRFRGSGSGSDYTLTISGVQAEDSGVYYCQHDY
Oryzias latipes Vs430 igkv BAAF04116073.1 10564 SVGQNVVVTQPAAKSVQLNQTVSIDCKASQKVSQYSGPQYRLAWYHQKSGEAPKALIYRTSDRYSGISSRFSGSGSGNGIDFTLTISGVQAEDSGVYYCQS
Oryzias latipes Vs340 igkv BAAF04089440.1 5820 HLSAVIWAGAVKQDTGVRSVSVGENVTLQCFYENVMAMHFSWYQQPLGGRPELLSFFYKYDNPSKVDHWLQKKPRFSLQREEGINHLHISDVQLSDSATYFCGS
Oryzias latipes Vs438 igkv BAAF04118861.1 4164 SSGEITMTQTPGSQSVVPGETFSIRCQTSSSVYSNIQWYLQKSGEAPKLLIYSASTRQSGVSDRFSGSGFGSDFTLTISGVQAEDSGVYYCQQSDSFP
Oryzias latipes Vs242 igkv BAAF04126930.1 2984 SRGQVTVTQPGAVSSAVGGSVSISCRTSQDVYGSNYLAWYQQKDGESPKLLFYYVGNRISGTPSRFTDGESNSDFTLTISGIQAEDAAVYYCQS
Oryzias latipes Vs245 igkv BAAF04131993.1 29 SSGEITVTQTPGSQSVVPGETFSIRCQTSSSVYSYLHWYLQKSGEAPKLLIYNASTRQSGVSDRFRGSGSGSDFTLTISGVQAEDSGVYYCQQSNSL
Oryzias latipes Vs56 igkv BAAF04046453.1 12150 SRGQVTVTQPGPVSSAVGGSVSISCTTSQNVHNNNYLAWYYQKDGKTAKLLFYYVGSRVSGTPTRFTDGGSNSDFTLTISGIQAEDAAVYYCQS
Oryzias latipes Vs348 igkv BAAF04091659.1 9505 SRGQFTVTQPGAVSSAVGGNVSISCTTSRDVYRHIGKHRLAWYQQKNGESPKLLIYDASTRASGTPSRFTGSGSNSDFNLTISGIQAEDAAVYYCLG
Oryzias latipes Vs54 igkv BAAF04046452.1 2185 SRGQVTVTQPGPVSSAVGGSVSISCRTSQDVYSNNLLAWYQQKDGESPKLLIYYTSTRESGTPTRFTGSGSNSDFTLTISGIQAEDAAVYYCQS
Oryzias latipes Vs55 igkv BAAF04046453.1 10287 SSEEILLTQTPGAQSVVEGQTVSIRCKSSKLIGDDINWYLQKPGEAPKLLIYDTTARQSGVPDRFSATAVQTDFTLTISRVQPEDSGVYYCQQRNSFP
Oryzias latipes Vs52 igkv BAAF04046445.1 2568 SRGQVTVTQPGAVSSAVGGSVSISCRTSQDVYNNNFLAWYQQKDGETPKLLIYYASTRASGTPTRFTGSGSNSDFTLSISGIQAEDAAVYYCQS
Oryzias latipes Vs53 igkv BAAF04046451.1 3469 SRGQVTVTQPGAVSSAVGGSVSISCRTSQDVYNNNYLAWYQQKDGETPKLLFYYVGSRVSGTPARFTDGGSNSDFTLTISGIQAEDAAVYYCQS
Oryzias latipes Vs50 igkv BAAF04046439.1 7582 SRGQVTVTQPGAVSSAVGGSVSISCRTSQDIYSDRLAWYQQKDGETPKLLILYISSRASGTPTRFTGSGSNSGTDFTLTISGIQAEDAAVYYCQS
Oryzias latipes Vs51 igkv BAAF04046441.1 4003 SRGQVTVTQPGAVSSAVGGSVSISCRTSQNVHGNIHLAWYQQKDGETPKLLFYYVGSRVSGTPARFTDGGSNSDFTLTISGIQAEDAAVYYCQS
Oryzias latipes Vs169 trdv BAAF04098682.1 3045 LTAEDTIYPGQDELTGTERKSVTMKCNFQTDSSDLWLHWYKHDSDLQAPQFILFKGAKGDTRDRILDKRYKSRTTDTSTEPTITKLTLADTALYYCANE
Oryzias latipes Vs344 igkv BAAF04089492.1 657 QSISLGSSSSVLQESVFKSAHIGETVTLPCFYKEFYLKYVSWYIYILGKKPKQLSYLRKYDKNVTLSDEFKNRFTLKPGNQSSHLIISDLKQLDSATYFCIAGYQ
Oryzias latipes Vs228 trbv BAAF04123622.1 383 VSLSGQIQQYPAEMYIRSGNQADIGCSHSIDSYNRILWYRQESGALQLLGYMYAGSPNSEGAVTIAGGSSKGENCTLTTETLHSPGSAVYFCAAS
Oryzias latipes Vs229 trbv BAAF04123622.1 1023 FCQDVIQHPEISWSFASRSAEMTCRHTRDKGHNQMYWFRQRPGEAMTLVAYTVFGGTPDYGGGPQTKYSSVKETIEEGALTVKDLQPDDAGLYFCAVS
Oryzias latipes Vs309 igkv BAAF04062242.1 8699 SSGEITVTQTPGSHSVVPEQTFSIRCQTSSSVGTNLHWYLQKSGEAPKLLIYYATTRQSGVSDRFRGSGSGSDFTLTISGVQAEDSGVYYCQQGSSL
Oryzias latipes Vs451 igkv BAAF04122299.1 684 SVGQNVVVTQPAAKSVQLNQKVTIDCKASQQVAQYSGSQYWLSWYHQKSGEAPKALIYVTSERFSGISSRFSGSGSGNGIDFTLTISGVQAEDSGVYYCQS
Oryzias latipes Vs420 trbv BAAF04115365.1 2698 LSVSILQSVDLLSPPGASVALECQMGPGLSMSSFTILWYRQNRPGAPIQLLLTEYEQTKDHFRASIDGPKNNFTLQIHDLSEDDSSIYFCAA
Oryzias latipes Vs421 trbv BAAF04115365.1 948 FCHGVEIQQPSSVFGRDGDPSVTLTCKQDDSQFFYMFWYRQQGGGRMELLVYSPGALSANVEAPFNGSKYSASRPTVLASSLQVQAVEAADAAVYFCASSR
Oryzias latipes Vs422 trbv BAAF04115367.1 10051 SSSLRVQQTPAEMHRLPGSSTNLSCSHSIQNYDRILWYRQQGDGMQLLGYMNVMFGYPEPGVNVNITGSARQGQTCTLTIQDLSLSSSAVYFCAAS
Oryzias latipes Vs423 trbv BAAF04115367.1 9461 SSGKTQVYQTPSQIYSKPGQEAKIYCSHRESNYDQILWYKQSEGQMLLLGYVYFRDTYPEAGLGVKLGGGASKDQNCTLTVEDVNSSSSAVYFCAAR
Oryzias latipes Vs424 trbv BAAF04115367.1 7079 SSSLRVQQTPAEMHRLPSSSANLSCSHSIQNYDKILWYRQQGDGMQLLGYMNMMHGYPEPGVNVNITGSARQGQTCTLTIQDLSLSSSAVYFCAAS
Oryzias latipes Vs425 trbv BAAF04115367.1 6489 SSGKTQVYQTPSQIYSKPGQEAKIYCSHRESNYDQILWYKQSEGQMLLLGYVYFRDTYPEAGLGVKLGGGASKDQNCTLTVEDVNSSSSAVYFCAAR
Oryzias latipes Vs426 trbv BAAF04115367.1 3807 GLAVDVRQTPAEVFTHPRNSLVQLFCNHDKTDFYLMLWYQQTPGRTDMKLIGYLHHNEPTMEKEHKDDFDISGALSGSTAKNGSLMIKKAEQNSSAVYFCAASK
Oryzias latipes Vs427 trbv BAAF04115367.1 1966 FCQTLDVHQDPSDIVKEPSSTVQIVCTHEKTDYFQMLWYQQTPGRTDMKLIGYLHYSATTMEEEYKDDFTISGDLGGSTSKNGSLMIKKAEQNSSAVYFCAASK
Oryzias latipes Vs429 trbv BAAF04115368.1 1152 GTDGSDVSQTSMLWTKKGQDATMNCSHTKDATFYQMYWYRQLPGETMELVVFTSTAQRGGEHDFGAFSKEKFSATKTEAERGTFTVKKVQPEDKGLYFCAVS
Oryzias latipes Vs143 trav BAAF04095357.1 14061 CRAQTDNVQQPGGDVTAAEGDTVTLGCHFNSSSSNYYLFWYKQDGSNRPTFILSRFKIGTGTTAEEFKERFSSSLDSESRSVPLKIQKLHVSDSAVYYCALQ
Oryzias latipes Vs219 trav BAAF04115323.1 9119 CKGEDKVIQPGGEVIAAEGDSLTLNCTFETSSLQPYLFWYKQEGNSYPKYMLKRDTYGTEENSPDFKEDRFDAELKDKSVPLKIQKLHVSDSAVYYCALR
Oryzias latipes Vs200 trdv BAAF04107649.1 5022 LTAGDSISPDQDQLTGAEGKSVTMKCNYQTDRSHPWLYWYKHDSDLQAPQFILWKGAKGDTRELVPDKRYESRTTDTSTELIIRKLTLADTALYYCAV
Oryzias latipes Vs196 trdv BAAF04107639.1 266 LTAGDSISPDQDQLTGTEGKSVTMKCNYQTSSRGIYLYWYKHDSDLQAPQFILWKRAKSEAREHIPDKRYDSRTTDTSTELIIRKLTLADTALYYCAV
Oryzias latipes Vs447 trbv BAAF04121050.1 5384 GTDGSDVSQTSMLWTKKGQDATMNCSHTKGAQYFQMYWYRQLPGETMELVVFTSTAQRGGEHDFGAFSKEKFSATKTEAERGTFTVKKVEPEDKGLYFCSVA
Oryzias latipes Vs147 trav BAAF04095370.1 4262 CKGEDKVIQPGGEVIAAEGDSLTLNCSFETAATYAYLFWYKQEVNSYPKYMLKRFSTTKENFPEFKEDRFDAELKDKSVPLKIQKLHVSDSAVYYCALQ
Oryzias latipes Vs403 ighv BAAF04114430.1 2542 VDGQTLTESESVVKRPGESHRLTCSASGFTFSSYRMSWIRQAPGKGLEWIAYISTYSDPIYYSQSVQGRFSISRDDSSSKVYLQMNSLRMEDTAVYYCART
Oryzias latipes Vs385 trdv BAAF04110875.1 9057 LTDGDTISPDQDQLTGTEGKSVTMECNYQTADSAPLLFWYKHDSDIQAPQFILWKGAKRNTGEHIPNIRYESGTTYTSTELTIRELTLADTALYYCAV
Oryzias latipes Vs412 trav BAAF04114957.1 929 CKGEDKVIQPGGEVIAAEGDSLTLNCTFETSSTTLTTLFWYKQEVNSYPKYILKRDTYGTEENAPEFKEDRFDAELKDKSVPLKIQKLHVSASAVYYCALK
Oryzias latipes Vs236 ighv BAAF04125731.1 1411 VKCEQLTQPASVSLQPGERLTITCQVSYSVSGYYTGWIRQPAGKGLEWIGMKYTGGSHYKDSLKNKFSIDVDSSNNRVTLNGQNMQPEDSAVYFCARR
Oryzias latipes Vs243 trav BAAF04126940.1 1579 CKGEDKVIQPGGEVIAAVGDSLTLNCTFEKTTTHAYLFWYKQEVNSYPKYMLKRGTYGTGENSPEFEEDRFDAELKDKSVPLKIQKLHVSDSALYYCALQ
Oryzias latipes V22 trav BAAE01136910.1 72 NVQQPGGDVTAAEGDTVTLGCHFNSSSSNYYLFWYKQDGSNRPTFILSRFKIGTGTTAEEFNEKFSSSLDSESRSVPLKIQKVHVSDSAVYYCALQ
Oryzias latipes V21 trav BAAE01125556.1 858 VSLSSKVHQDPATILERSQGSATISCNHSVSSYNVILWYQKLQDDSALDLIGYTVYESATYEEKVMKNVKISGDGSKKSDLLLEKLNPADSGVYYCAAS
Oryzias latipes V20 trav BAAE01091402.1 321 CKGEDKVIQPGGEVIAAEGDSLTLNCTFETGAPYPYLFWYKQEVNSYPEYMLKRDTYGTQENSPEFKKDRFDAELKEKSVFLKIQKLHLSDSAVYYCALR
Oryzias latipes V19 trav BAAE01091401.1 1619 KVIQPGGEVIAAEGDSLTLNCTFEKTTTHAYLFWYKQEVNSYPKYMLKRGTYGTGENSPEFEDDRFDAELKDKSVPLKIQKLHVSDSALYYCALQ
Oryzias latipes V18 trav BAAE01091395.1 530 CKGEDKVIQPGGEVIAAEGDSLTLNCTFETTFTPHLFWYRREKNGNINYILRRHSYGKDDNAPEFQKDRFDAKLKDKSVPLKIQKLHVSDSAVYYCALQ
Oryzias latipes V17 igkv BAAE01090776.1 5859 SRGQVTVTQPGAVSSAVGGSVSISCRLSQNVYSNYLAWYQQKDGETPKLLIYYISTQVSGTPTRFTGSGSNSDFTLTISGIQAEDAAVYYCQS
Oryzias latipes V16 igkv BAAE01090775.1 554 SRGQVSVTQPGAVSSAVGGSVSISCRTSQDVYSNNRLAWYQQKDGESPKLLIYYATSRASGVPTRFTGSGSKSDFTLTISGIQAEDAAVYYCQS
Oryzias latipes V15 igkv BAAE01090770.1 547 SRGQVTVTQPGPVSSAVGGSVSISCRTSQDVYGSNYLAWYQQKDGKSPKLLIYLSSNRASGTPSRFTGSGSNSDFTLTISGIQAEDAAVYYCQS
Oryzias latipes V14 igkv BAAE01090769.1 55 SRGQVTVTQPGAVSSAVEGSVSISCRTSQDVYNNNYLAWYQQKDGETPKLLFHYVGSRVSGTPTRFTDGGSKSDFTLTISGIQAEDAAVYYCQS
Oryzias latipes V13 igkv BAAE01090764.1 2208 SRGQVTVTQPGAVSSAVGGSVSISCRTSQDVHGNIHLAWYQQKDGESPKLLFQYVGSRVSGTPTRFADGGSNSDFTLSISGVQAEDAAVYYCQS
Oryzias latipes V12 igkv BAAE01090760.1 2031 SRGQVTVTQPGPVSSAVGGSVSISCRTSQDVYWSSYHYLAWYQQKDGETPKPLFYYVGGRASGTPARFTDGGSNSDFTLTISGIQAEDAAVYYCQSFHVINSQYV
Oryzias latipes V11 ighv BAAE01071438.1 2179 QTLTESESVVKRPGEPHKLTCTYSGFSSDYWNAWIRQAAGKGLEWVATISDSGSIYYSESVKNRFTISRDNSRQQLYLQMNSLRAEDSAVYYCAR
Oryzias latipes V10 igkv BAAE01069785.1 4971 SRGQVTVTQPGAVSSAVGGSVSISCRTSQNVYWSSYHYLAWYQQKDGESPKLLFHHVGSRVSGTPTRFTDGGSHSDFTLTISGIQAEDAAVYYCQS
Oryzias latipes V9 igkv BAAE01060105.1 867 SRGQVTVTQPGAVSSAVGESVSISCRTSQDVYDDGSDHYLSWYQQKDGESPKLLIYYASTRASGIPSRFTGSGSNSDFNLTISGIQAEDAAVYYCQSYHEINSQDG
Oryzias latipes V8 igkv BAAE01060101.1 1029 SRGQFTVTQPGAVSSAVGGNVSISCTTSQDVYVYKSNHCLAWYQQKDGESPKLLIYYASTRASGIPSRFTGSGSKSDFTLTISGIQAEDAAVYYCLS
Oryzias latipes V7 trav BAAE01052094.1 116 CKGEDKVIQPGGEVIAAEGDSLTLNCTFETSSLQPYLFWYKQEGNSYPKYMLKRDTHGTEENSPDFKEDRFDAELKDKSVPLKIQKLHVSDSAVYYCALR
Oryzias latipes V6 trav BAAE01052091.1 1672 NVQQPGGDVTAAEGDTVTLGCHLNSSSSNYYLFWYKQDGSNRPTFILSRFKIGTGTTAEEFNERFSSSLDSESRSVPLKIQKLNVSDSAVYYCALQ
Oryzias latipes V5 trav BAAE01052088.1 1136 DVFVVTPLVQPRGEVIAAEGDSLTLNCTFETSDTLPTLFWYKQEVNSYPKYMLKRYSTTKENSPEFKEDRFDAELKDKSVPLKIQKLHVSDSAVYYCALR
Oryzias latipes V4 trav BAAE01047355.1 4216 DKVIQPGGEVIAAEGDSFTLNCTFETIDKSAYLFWYKQEVNSYPKYMLKRDTYGTKENAPEFKKDRFDAELKDKSVPLKISSAAVTDSAVYYCALR
Oryzias latipes V3 igkv BAAE01044962.1 1315 SSGEITVTQTPGSQSVVPGETFSIRCQTSSYVGNNIQWYHQKSGEAPKLLIYDASTRQSGVSDRFRGSGSDSDYTLTISGVQAEDSGVYYCQHDYNYP
Oryzias latipes V2 ighv BAAE01024679.1 3804 VDGQTLTESESVVKRPGESHRLTCSASGFTFSSYGMSWIRQAPGKRLDWIAYIYDSSGIYPESVKNRFTISRDNSRQQLYLQMNSLRAEDSAVYYCA
Oryzias latipes V1 trav BAAE01018728.1 727 FCHGVEIQQPSSVFGRDGDPSVTLTCKQDDSQFFYMFWYRQQGGGRMELLVYSPGASIASVEAPFNGSKYSAFRPTVLASSLQVQAVEAADAAVYFCASSR
Oryzias latipes V60 ighv BAAE01046117.1 2335 VLSQIKLDQSPNVVKRPGETVKMSCVCSGFKMTSFYIHWIRQKPGRALEWIGRMNAGSNSPVYSSSFQDRVLMTEVVSSSSQFLEISSLTAEDSAVYFCARE
Oryzias latipes V59 ighv BAAE01046116.1 183 VDGQTLTESESEVKRPGESHRLTCSASGFTFSSYHMGWIRQAPGKGLEWIAWISTSSGSIYYSESVKNRFIISRDNSRQQLYLQMNSLRAEDSAVYYCAR
Oryzias latipes V58 ighv BAAE01046116.1 2513 VKCEQLTQPASVSLQPGERLTITCQVSYSLGYYTAWIRQPAGKGLEWIGMKHTGGSHYKDSLKNKFSIDVDSSNNRVTLNGQNMQPEDSAVYFCARR
Oryzias latipes V57 ighv BAAE01014446.1 754 VKCEQLTQPASVSLQPGERLTITCQVTYSLSSYWTAWIRQPAGKGLEWIGIERVGYTKYYKDSLKNKFSMTLDSSNNRVTLNGQNMQPEDSAVYFCARD
Oryzias latipes V56 ighv BAAE01014445.1 2039 VDGQTLTESESVVKRPGESHRLTCSASGFTFSSYGMGWIRQAPGKGLEWIAYIYTDSSGIFYSEPVKNRFIISRDNSRQQLYLQMNSLRAEDSAVYYCAR
Oryzias latipes V55 ighv BAAE01014441.1 412 VDSIDLIQPDSKVVQPGQSLTISCQVSGYSLTDSSYGTGWIRQREGKPMDWISHQYGGGTLRQNDALKNKFSYSRDTSAGTVTITGQNLQPEDTAVYYCVRY
Oryzias latipes V54 ighv BAAE01014441.1 1995 VDGQTLTESESEVKRPGESHRLTCSASGFTFSSYYMGWIRQAPGKGLEWIAYINSGSIYYSESVKNRFTISRDNSRQQLYLQMNSLRAEDSAVYYCAR
Oryzias latipes V53 ighv BAAE01014441.1 3895 VKCEQLTQPASVSLQPGERLTITCQVSYSVGSYRTGWIRQLAGKGLEWIGSECVGCTKYYKDSLKNKFSMTLDSSNNRVTLNGQNMQPEDSAVYFCARD
Oryzias latipes V52 igkv BAAE01007555.1 1050 SRGQVTVTQPGAVSSAVGESVSISCRTSQDVDNDLLSWYQQKEGESPKLLIYWASTLESVIPSRFTGSGSNSDFTLTISGIQAEDAAVYYCQNYHEINSQAV
Oryzias latipes V51 trdv BAAE01284958.1 269 LTAGDSISPDQDQVTGTEGKSVTMKCNYQTSSSGVYLNWYKQDSDLQAPQFILWKGAKSWSNSEHIPNKRYESRTTDTSTELIITKLTLADTALYYCAV
Oryzias latipes V50 trbv BAAE01277829.1 354 SSGKIQVYQTPSQIYSKPGQEAKIYCSHSESNYDQILWYKQSEGQMLLLGYVYFRDTYPEAGLGVKLGGGASKDQNCTLTVEDVNSSSSAVYFCAAR
Oryzias latipes V49 ighv BAAE01276816.1 923 IRGQTLTESESVVKRPGESEKLTCTYSGFSSDYWNAWIRQAAGKGLEWVATISDSGSIYYSESVKNRFTISRDNSRKQVYLQMNSLRAEDSAVYYCAR
Oryzias latipes V48 trav BAAE01263842.1 5094 VKCEQLTQPASGSLQPGERLTITCQVSYSLSYYTGWIRQPAGKGLEWIGMKFTGGSHYKDSLKNKFSIDLDSSNNRVTLNGQNMQPEDSAVYFCARE
Oryzias latipes V47 igkv BAAE01260633.1 387 SSGEITVTQTPGSQSVVPGETFSIRCQTSSGVGNHIGWYLQKSGAAPKLLMYASTRQSGVSDRFRGSGSGSDYTLTISGVQAEDSGVYYCQQGYSTP
Oryzias latipes V46 igkv BAAE01260632.1 234 SVGQNVVLTQPAAKSVQLGQKVSIDCKASQQVDLWRGSKYYLAWYHQKSGEAPKALIDVTSDRLSGISSRFSGSGSGNGIDFTLTISGVQAEDSGVYYCQS
Oryzias latipes V45 trav BAAE01244641.1 1217 KVIQPGGEVIGAEGDSLTLNCTFETAATYAYLFWYKQKVNSYPKYMLKRYSKTKENAPEFKEDRFDAELKDKSVPLKIQKLHVSDSAVYYCALQ
Oryzias latipes V44 trav BAAE01244451.1 427 CKGEDKVIQPGGEVIAAEGDSLTLNCTFETSDPYPYLFWYKQEVNSYPKYMLKRYSKTKENAPEFKEDRFDAELKDKSVPLKIQKLHVSDSAVYYCALQ
Oryzias latipes V43 trav BAAE01244450.1 32 CKGEDKVIQPGGEVIAAEGDSLTLNCTFETSDPYPYLFWYKQEVNSYPKYMLKRYSKTKENAPEFKEDRFDAELKDKSVPLKIQKLHVSDSAVYYCALQ
Oryzias latipes V42 trav BAAE01231736.1 164 VLSQIELQQSPSVVKRPGETVKMSCVCSGYSMTSYNIHWIRQKPGRALEWIGWMDTGNNDPTYSSSFQDRFLMTEVESSSSQYLEISSLTAEDSAEYFCARQ
Oryzias latipes V40 igkv BAAE01199814.1 362 SRGQVTVTQPGAVSSAVGGSVSISCRTSQDVYGNSYLAWYQQKDGETPKLLIYYTSTRASGTPTRFTGSGSNSDFTLNISGIQAEDAAVYYCQSFHVINSQHV
Oryzias latipes V39 trav BAAE01190769.1 84 NVQQPGGDVTAAEGDTVTLGCHFNSSSSNYYLFWYKQDGSNRPTFILSRFKIGTGTTAEEFKERFSSSLDSESRSVPLKIQKLHVSDSAVYCCALQ
Oryzias latipes V38 trav BAAE01190764.1 64 CKGEDKVIQPGGEVIAAEGDSLTLNCTYETSFSQPTLFWYKQEVNSYPKYMLKRYSKTKENSPEFKEDRFDAELKDKSVPLKIQKLHVSDSAVYYCALK
Oryzias latipes V37 igkv BAAE01174034.1 25 SRGQVTVTQPGPVSSAVGGSVSISCRTSQDVYSNNLLAWYQQKDGESPKLLIYYASTRESGTPTRFTGSGSNSDFTLTISGIQAEDAAVYYCQS
Oryzias latipes V36 igkv BAAE01174033.1 1074 SRGQVTVTQPGPVSSAVGGSVSISCRTSQDVYSNNLLAWYQQKDGESPKLLIYYTSTRESGTPTRFTGSGSNSDFTLTISGIQAEDAAVYYCQS
Oryzias latipes V35 trbv BAAE01156399.1 361 FTLGLEVRQDPSDIIIKASSSIQIFCSHDKTDFYLMLWYQQTPGHTDMKLIGYLHYSATTMEQKYKDDFKISGDLSGSTAKNGSLMIKKAEQNSSAVYFCAASK
Oryzias latipes V34 igkv BAAE01149240.1 3047 SRGQYTVTQPGAVSSAVGGSVSISCRISQNVQGNIHLAWYQQKDGESPKLLFHHVGSRVSGTPTRFTDGGSNSDFTLTISGIQAEDAAVYYCQS
Oryzias latipes V33 igkv BAAE01149231.1 635 SRGQVTVTQPGAVSSAVGGSVSISCRTSQDVYNNNYLAWYQQKDGQTPKLLFYYVGNRVSGIPTRFADGGSNSDFTLNISGIHAEDAAVYYCQS
Oryzias latipes V32 trav BAAE01149230.1 300 SRGQVTVTQPGAVSSAVGGSVSISCRTSHSVDGADLSWYQQKDEETPKLLIYNINSIASGTPTRYTGSGTTSGQDFTLTISGIQAEDAAVYYCMGDFYINS
Oryzias latipes V31 ighv BAAE01145039.1 1231 VDSIDLIQPDSKVVQPGQSLTISCQVSGYSLTDSSYATGWIRQREGKPMDWISHQWGSSGGSFYQNDALKNKFSYSRDTSAGTVTITGQNLQPEDTAVYYCVR
Oryzias latipes V30 ighv BAAE01145036.1 5179 VDGQTLTESESEVKSPGKSHRLTCSASGFTFSSYGMGWIKQAPGKGLEWIAYIYSSSIYYSESVKNRFTISRDNSRQQLYLQMNSLRAEDSAVYYCA
Oryzias latipes V29 ighv BAAE01145036.1 2504 ADGQTLTESESVVKRPGESHRLTCSASGFTFSSYNMGWIRQAPGKGLEWIAYIYTDSSGIFYSESVKNRFIISRDNSRQQLYLQMNSLRAEDSAVYYCARE
Oryzias latipes V28 trav BAAE01144490.1 515 KVIQPGGEVIAAEGDSLTLNCTYETSFSQSYLFWYKQEVNSYPKYMLKRYLKTKENAPEFKEDRFDAELKDKSVPLKIQKLHVSDSAVYYCALQ
Oryzias latipes V27 trav BAAE01143297.1 350 VSLSSKVHQDPATILGRSQGSATISCNHSISSYDTILWYQKLQDDSALDLIGYTFLTTPNYEEKFKKNVKISGDGSKKSDLLLEKLNPADSGVYYCAAS
Oryzias latipes V26 trbv BAAE01143294.1 452 SSAGNDVTQTPLLWTEEGGSATMECSHTKDHSHFQMYWYRQLPGRTMELVVFTSTANRGEHDFGAFSKEKFSATKTEAERGTFTVKEVQPEDKGLYFCAVS
Oryzias latipes V25 trbv BAAE01143292.1 260 SSLMDRITQTPAHVFKHAGEEAEIKCSHSSQSYNNGLWYKQSEDGQMQLLGYMMSGSAFPESGLGVTMGGSADKDQTFTLTIAGISESSRAVYFCAARLYSAS
Oryzias latipes V24 trbv BAAE01137218.1 802 VSLSDQIQQYPAEMYIRSGNQADIGCSHSIDSYNRILWYRQESGALQLLGYMYAGSPNSEGAVTIAGGSSKGENCTLTTETLHSPGSAVYFCAAS
Oryzias latipes V23 trav BAAE01137213.1 1389 TSDTKTVLQTPAFIIKRTGESLNNEIECSHSIENYEVIMWYKTSWNETLRFLGFLNLGFPYPEEDLKAKISFEGDGSQKSELRVSDLQVSDSAVYYCAAR
Oryzias latipes V96 trav BAAE01297614.1 326 CKGEDKVIQPGGEVIAAEGDSLTLNCTFETTDTFPRLFWYKQEVNSYPKYMLKRFSTTGENAPEFKKDIFDAELKDKSVPLKIQELHVSDSAVYYCALQ
Oryzias latipes V95 trgv BAAE01288642.1 192 NSWAQKSSASLHFESVFVGQEVTLECFLEGTVSNVFLWYKQPLGQKPQLISEFFNHKEIGTFADDFKNDPRFELQTNEDKNNLKISNVKMSDSATYYCISS
Oryzias latipes V94 igkv BAAE01287509.1 16 SVGQNVVVTQPAAKSVQLGQKVTIDCKASRQVAVWSGSQYYLSWYHQKSGEAPKALIHRTSDRFSGISSRFSGSGSRNGIDFTLTISGVQAEESGVYYCQS
Oryzias latipes V93 ighv BAAE01286102.1 342 IRGQTLTESESVVKKPGEPHKLTCTYSGFSGDPSIAWIRQPAGKALEWIAYIRYDSGSIYYSESVKNRFTISRDNSRKQVYLQMNSLRAEDSAVYYCAR
Oryzias latipes V92 ighv BAAE01286102.1 1618 VDSIDLIQPDSKVVQPGQSLTISCQVSGYSLTDSSYGTGWIRQREGKPMDWISHQWGGGNFYQNDALKNKFSYSRDTSAGTVTITGQNLQPEDTAVYYCVR
Oryzias latipes V91 trgv BAAE01284757.1 842 ELSQEDLTLIRGVGESVSFSCGGTQPCSGSYIYWYQKKNTETFKPILRYDQNSRVAYDGYGHPQKDDFSALKTQTGCELKINKVKVDHSASYYCICW
Oryzias latipes V90 ighv BAAE01253805.1 9 VKCEQLTQPASVSLQPAERLTITCQVSYSVSSYRTGWIRQPAGKGLEWIGMRSTGGSYYKDSLKNKFSIDLDSSNNRVTLNGQNMQPEDSAVYFCARR
Oryzias latipes V89 ighv BAAE01253804.1 2739 IDGQTLTESESVVKRPGESHRLTCSASGFTFSSYHMGWVRQAPGKGLEWIAWIQTGSSYIYYSESVKNRFTISRDDSRQQLYLQMNSLRAEDSAVYYCAR
Oryzias latipes V88 igkv BAAE01236651.1 896 SRGQVTVTQPGAVSSAVGGSVSISCRTSQNVYGNNYLAWYQQKDGETPKLLIYYASNRASGTPTRLTGSGSNSDFTLTISGIQAEDAAVYYCQS
Oryzias latipes V87 igkv BAAE01225985.1 1966 SSGEITLTQTPGSQSAVPGQTVSIRCQTSSSVSNYIHWYLQKSGTAPKLLIYYAITRQSGVSDRFRGSGSGSDFTLTISGVQAEDSGVYYCQQGGYSFP
Oryzias latipes V86 igkv BAAE01212062.1 142 SRGQVTVTQPGAVSSAVGGSVSISCRTSQNIYSDRLAWYQQKDVETPKLLIYYISSRASGTPTRFTGSGSNSGTDFTLTISGIQAEDAAVYYCQS
Oryzias latipes V85 igkv BAAE01212061.1 932 SRGQVTVTQPGAVSSAVGGSVSISCRTSQNIYSDRLAWYQQKDVETPKLLIYYISSRASGTPTRFTGSGSNSGTDFTLTISGIQAEDAAVYYCQS
Oryzias latipes V84 igkv BAAE01212061.1 2245 SSEQLLTQTPGAQSVVQGQTVSIRCKASSSVGGCLNWYLQKNGESPKLLIYSATNRQSGVSSHFSGSGSGTDFTLTLSGIEPEHAGVYYCLNSLP
Oryzias latipes V83 igkv BAAE01212060.1 1308 SRGQVTMTQPGAVSSAVGGSVSISCRSSQNFCGNTNLAWYQQKDGETPKLLFYYVSSRVSGTPTRFTGSGSNSDFTLTISGIQAEDAAVYYCQSLTSINSQYV
Oryzias latipes V82 trav BAAE01206181.1 8 SSEDLLKPLKVELMALGGDTVTLSCKYSGSIQYFYWYQQKSSSSPQFLIRDYSDETQKFSVKHDKQKQEFHVKISSAAVTDSAVYYCAVT
Oryzias latipes V81 trbv BAAE01203864.1 2387 FTLGLEVHQDPSDIIIEGHSPVQIFCSHDKTDFRVMLWYQQTPGHTDMKLIGYLYFKDATMEEEYKEDYKISGDLSGNTAKNGSLMIKKPEQKSSAVYFCAARE
Oryzias latipes V80 trbv BAAE01203862.1 529 FCLNVEVHQSSSEITDAKKKVQIFCSYDKSDFRVMLWYRQTPGRTDMDLIGYLNYKEPKMEEKYEKTFTIAGDLSVNTLKTGSLSITAAEAGNSAVYFCAASR
Oryzias latipes V79 trav BAAE01185109.1 398 SSEDLLKPLKDELMALEGDTVTLSCKYSGSIQFFFWYQQKSSSSPQFLIAEYSGETEKFSVKHDKEQKEFLVKISSAAVTDSVVYYCAVE
Oryzias latipes V78 trav BAAE01175713.1 54 DSLEDGITASRAEVFSSEELTVTLSCNYSVTANNLQWYRQDPGSAPRFLLLITDTKEPSVVEAKPPNPRLTAVLNQERNQVHLQISSAAVTDSAVYYCALQPTVTGN
Oryzias latipes V77 trdv BAAE01175708.1 1114 LTAGDTISPDQDQITGTEGKSVTMKCNYQTSSSDIILHWYKHDSDLQAPQFLLWKGAKSLSNSELIPDKRYESRTTYTSAELTITKLTLADTALYYCVLER
Oryzias latipes V76 ighv BAAE01173534.1 653 VDGQTLTESESEVKRPGESHRLTCSASGFPFSDYYMSWIRQAPGKGLEWIAWIHTVSGSMYYSESVKNRFIITRDNSRKQVYLQMNILRAEDSAVYYCAR
Oryzias latipes V75 trav BAAE01156853.1 20 SSEDLLKPLKDELMTLEGDTVTLSCKYSGSVRYLFWYQQKSSSSPQFIISDILDETEKFSVKHDKQKQEFHVKISSAAVTDSAVYYCAVR
Oryzias latipes V74 trdv BAAE01156851.1 683 LTAGCSISPDQDQLIGTEGKSVTMKCYYETDYSFPQLYWYKHDSDLRAPQFIFWKGAKSYSNNKYIPDKRYESKTTDTSTELTIKKLNLADTALYYCAL
Oryzias latipes V73 trav BAAE01156850.1 1874 SSEDLLKPLKDELMTLEGDTVTLSCKYSGSVRYLFWYQQKSSSSPQFIISDILDETEKFSVKHDKQKQEFHVKISSAAVTDSAVYYCAVR
Oryzias latipes V72 igkv BAAE01142468.1 1587 SRGQYTVTQPGAVSSAVGGSVSISCRTSQNVYNNNYLAWYQQKDGKTPKLLFYYVGSRVSGTPTRFTDGGSNSDFTLSISGIQAEDAAVYYCQS
Oryzias latipes V70 trbv BAAE01133826.1 5201 LSQIKLDQSPNVVKKPGETVKMSCVCSGYSMTSFYIHWIRQKPGRALEWIGRMNTGNNAPIYSSSFQDRFLMTEVVSSSSQYLEISSLTAEDSAVYFCARS
Oryzias latipes V69 igkv BAAE01127732.1 1159 SRGQVTVTQPGPLSSAVGGSVSISCRTSQNVHSNRLSWYQQKDGETPKLLIYRASTRESGTPSRFTGSGSNSDFTLTISGIQAEDAAVYYCLGQ
Oryzias latipes V68 igkv BAAE01125134.1 1690 SSGEITVTQTPGSQSVVPGETFSIRCQTSSDVGSYLHWYLQKSGEAPKLLIYYATTRQSGVSDRFSGSGSGSDFTLTISGVQAEDSGVYYCQQGYSFP
Oryzias latipes V67 trdv BAAE01108142.1 931 LTDGETISPDQDQLTGTEGKSVKLKCNYQTSRSAPLLFWYQHDSDLQAPQFILWKGAKRSTGEHIPNIRYESGTTYTSTELTIRELTLADTALYYCAV
Oryzias latipes V66 trav BAAE01108142.1 7673 CKGEDKVIQPGGEVIAAEGDSLILNCTFETSSTQLPTLFWYKQEVNSYPKYMLKRYSTTKENTPEFKEDRFDAELKDKSVPLKIQKLHVSDSAVYYCALQ
Oryzias latipes V65 trav BAAE01105916.1 434 GDSLEDGITASRAEVFSSEELTVTLSCNYSVTANNLQWYRQDPGSAPRFLLLITDTKEPSVVEAKPPNPRLTAVLNQERNQVHLQISSAAVTDSAVYYCAGSPQ
Oryzias latipes V64 igkv BAAE01082330.1 128 GSGGGGSDIELTQSPAIMSASPGERVTMTCSASSSIRYIYWYQQKPGSSPRLLIYDTSNVAPGVPFRFSGSGSGTSYSLTINRMEAEDAATYYCQEWSGYP
Oryzias latipes V63 igkv BAAE01066253.1 730 SSGELLTQSAGAQSVVQGQTVSIRCKISQSTGYCFNWYFQRRAEAPKLLIFCTSTCQFGVFDRFSGLNFGLDYTLTISGVQAEDAAVYYCQS
Oryzias latipes V62 trdv BAAE01054370.1 384 LNGQVMESIPSTSMVKKPQEVLNLSCKGSGFRFDKAGMHWIRQPVGKTLEWIGVIWFDASKTVYADSFQGRVEITRDNNNSFVYLKLSDLKPEDSALYYCAA
Oryzias latipes V97 ighv BAAE01311044.1 239 VLSQIKLDQSPNVVKRPGESVKMSCVCSGYSMTSNDIHWIRQKPGRALEWIGYMDTGNNNPTYSSSFQVRFLMTEVESSSSQFLEISSLTAEDSAVYFCARE
Oryzias latipes V71 igkv BAAE01142467.1 1252 SRGQYTVTQPGPVSSAVGGSVSISCRTSQDVHGNIHLAWYQQKDGETPKLLIYWASTRASGTPSRFTGSGSNSDFTLSISGIQAEDAAVYYCQSFHVINSQYV
Oryzias latipes V61 ighv BAAE01046120.1 1859 IRGQTLTESESVVKRPGESEKLTCTYSGFSSTPDIAWIRQPAGKRLEWIAYISSGSGSIYYSESVKNRFTISRDNSRKQVYLQMNSLRAEDSAVYYCA
Oryzias latipes V41 trgv BAAE01225937.1 278 LVAMAAELIQEDLTLTRKVGESVSFSCGGTQQRSNDIYWYQKKDTEQFKIILHFNKNDCGINKGYGHPQKDDFTAEKTQRGCELKINKVRVDHSASYYCSCW
Oryzias latipes V0 trav BAAE01009248.1 1456 DKVIQPGGEVIAAEGDSLTLNCTFETSSTTLPTLFWYKQEVNSYPKYMLKCYSKTKENSPEFKEDRFDAKLKDKSVPLKIQKLHVSDSAVYYCALQ